| Basic Information | |
|---|---|
| Family ID | F054761 |
| Family Type | Metagenome |
| Number of Sequences | 139 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MSGVMADLDDRNRLLRRILLGIVAVLVIASFLVGIRW |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 139 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.16 % |
| % of genes near scaffold ends (potentially truncated) | 13.67 % |
| % of genes from short scaffolds (< 2000 bps) | 82.01 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.122 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (17.266 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.180 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (37.410 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.85% β-sheet: 0.00% Coil/Unstructured: 46.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 139 Family Scaffolds |
|---|---|---|
| PF01040 | UbiA | 48.20 |
| PF00510 | COX3 | 33.81 |
| PF02628 | COX15-CtaA | 1.44 |
| PF04011 | LemA | 0.72 |
| PF13186 | SPASM | 0.72 |
| PF13620 | CarboxypepD_reg | 0.72 |
| PF00701 | DHDPS | 0.72 |
| PF00115 | COX1 | 0.72 |
| PF03626 | COX4_pro | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 139 Family Scaffolds |
|---|---|---|---|
| COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 33.81 |
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 1.44 |
| COG1612 | Heme A synthase | Coenzyme transport and metabolism [H] | 1.44 |
| COG1704 | Magnetosome formation protein MamQ, lipoprotein antigen LemA family | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
| COG3125 | Heme/copper-type cytochrome/quinol oxidase, subunit 4 | Energy production and conversion [C] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.12 % |
| Unclassified | root | N/A | 2.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000363|ICChiseqgaiiFebDRAFT_11113547 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300005167|Ga0066672_10252782 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1135 | Open in IMG/M |
| 3300005171|Ga0066677_10426973 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300005174|Ga0066680_10118395 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1636 | Open in IMG/M |
| 3300005343|Ga0070687_100870197 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300005406|Ga0070703_10422280 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300005526|Ga0073909_10244190 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300005543|Ga0070672_101708794 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 565 | Open in IMG/M |
| 3300005552|Ga0066701_10073222 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1947 | Open in IMG/M |
| 3300005561|Ga0066699_10854221 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300005569|Ga0066705_10361984 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300005617|Ga0068859_103053252 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300005764|Ga0066903_100781081 | All Organisms → cellular organisms → Bacteria | 1704 | Open in IMG/M |
| 3300005843|Ga0068860_102219708 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300006046|Ga0066652_100619709 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300006049|Ga0075417_10007357 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3887 | Open in IMG/M |
| 3300006755|Ga0079222_10574040 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300006806|Ga0079220_10586219 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300006844|Ga0075428_100000123 | All Organisms → cellular organisms → Bacteria | 66826 | Open in IMG/M |
| 3300006844|Ga0075428_100002086 | All Organisms → cellular organisms → Bacteria | 21561 | Open in IMG/M |
| 3300006844|Ga0075428_101017355 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 877 | Open in IMG/M |
| 3300006844|Ga0075428_101087757 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300006844|Ga0075428_101951168 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300006845|Ga0075421_100157490 | All Organisms → cellular organisms → Bacteria | 2836 | Open in IMG/M |
| 3300006845|Ga0075421_100361046 | All Organisms → cellular organisms → Bacteria | 1753 | Open in IMG/M |
| 3300006852|Ga0075433_10397734 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| 3300006854|Ga0075425_100129462 | All Organisms → cellular organisms → Bacteria | 2884 | Open in IMG/M |
| 3300006854|Ga0075425_101150354 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300006854|Ga0075425_101671725 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300006871|Ga0075434_101579591 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300006880|Ga0075429_100938886 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300006903|Ga0075426_11217393 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300006904|Ga0075424_100903965 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300006969|Ga0075419_11486677 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300007004|Ga0079218_10008328 | All Organisms → cellular organisms → Bacteria | 4909 | Open in IMG/M |
| 3300007004|Ga0079218_12670178 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300007255|Ga0099791_10542281 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300009090|Ga0099827_10695178 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 879 | Open in IMG/M |
| 3300009100|Ga0075418_11591502 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300009157|Ga0105092_10017101 | All Organisms → cellular organisms → Bacteria | 3816 | Open in IMG/M |
| 3300010359|Ga0126376_11501891 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300010360|Ga0126372_12501218 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300010362|Ga0126377_11471462 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300010371|Ga0134125_10200127 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2223 | Open in IMG/M |
| 3300010373|Ga0134128_10756114 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300010399|Ga0134127_11389577 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300010400|Ga0134122_10044965 | All Organisms → cellular organisms → Bacteria | 3378 | Open in IMG/M |
| 3300010401|Ga0134121_10674230 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300010401|Ga0134121_13063486 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300012355|Ga0137369_10113646 | All Organisms → cellular organisms → Bacteria | 2201 | Open in IMG/M |
| 3300012582|Ga0137358_10692332 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300012685|Ga0137397_10012897 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 5843 | Open in IMG/M |
| 3300012685|Ga0137397_10416691 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| 3300012685|Ga0137397_11137134 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 566 | Open in IMG/M |
| 3300012922|Ga0137394_10063528 | All Organisms → cellular organisms → Bacteria | 3067 | Open in IMG/M |
| 3300012922|Ga0137394_10914726 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300012948|Ga0126375_11269294 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300012948|Ga0126375_11340685 | Not Available | 603 | Open in IMG/M |
| 3300013297|Ga0157378_10130792 | All Organisms → cellular organisms → Bacteria | 2323 | Open in IMG/M |
| 3300015241|Ga0137418_10171890 | All Organisms → cellular organisms → Bacteria | 1893 | Open in IMG/M |
| 3300015264|Ga0137403_11172242 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300015371|Ga0132258_11882275 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1506 | Open in IMG/M |
| 3300015371|Ga0132258_12681349 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1243 | Open in IMG/M |
| 3300015372|Ga0132256_102688052 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300015374|Ga0132255_104176663 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300018028|Ga0184608_10013703 | All Organisms → cellular organisms → Bacteria | 2818 | Open in IMG/M |
| 3300018031|Ga0184634_10184087 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 947 | Open in IMG/M |
| 3300018052|Ga0184638_1087916 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1140 | Open in IMG/M |
| 3300018059|Ga0184615_10146045 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1335 | Open in IMG/M |
| 3300018059|Ga0184615_10446401 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300018061|Ga0184619_10137232 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300018076|Ga0184609_10065616 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
| 3300018077|Ga0184633_10395744 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300018482|Ga0066669_10554642 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300019360|Ga0187894_10442600 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 571 | Open in IMG/M |
| 3300019789|Ga0137408_1224843 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 1033 | Open in IMG/M |
| 3300020004|Ga0193755_1088894 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300021081|Ga0210379_10466191 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300023072|Ga0247799_1064427 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300025318|Ga0209519_10361857 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300025324|Ga0209640_10640282 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300025327|Ga0209751_10679406 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 818 | Open in IMG/M |
| 3300025893|Ga0207682_10249768 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 826 | Open in IMG/M |
| 3300025899|Ga0207642_10625892 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300025907|Ga0207645_10670377 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300025930|Ga0207701_11137113 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300025938|Ga0207704_10133060 | All Organisms → cellular organisms → Bacteria | 1726 | Open in IMG/M |
| 3300025942|Ga0207689_10398134 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300026297|Ga0209237_1045043 | All Organisms → cellular organisms → Bacteria | 2267 | Open in IMG/M |
| 3300026309|Ga0209055_1088087 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300026315|Ga0209686_1141324 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300026535|Ga0256867_10019283 | All Organisms → cellular organisms → Bacteria | 2926 | Open in IMG/M |
| 3300026547|Ga0209156_10218377 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 902 | Open in IMG/M |
| 3300027787|Ga0209074_10273124 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300027873|Ga0209814_10247106 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300027880|Ga0209481_10456478 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300027886|Ga0209486_10141589 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300027907|Ga0207428_10400905 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300027909|Ga0209382_10000149 | All Organisms → cellular organisms → Bacteria | 106182 | Open in IMG/M |
| 3300027909|Ga0209382_10114624 | All Organisms → cellular organisms → Bacteria | 3147 | Open in IMG/M |
| 3300027909|Ga0209382_10252873 | All Organisms → cellular organisms → Bacteria | 2000 | Open in IMG/M |
| 3300028592|Ga0247822_10718360 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300028792|Ga0307504_10206630 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300028878|Ga0307278_10050231 | All Organisms → cellular organisms → Bacteria | 1890 | Open in IMG/M |
| 3300030006|Ga0299907_10197844 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1659 | Open in IMG/M |
| 3300030006|Ga0299907_10389142 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1122 | Open in IMG/M |
| 3300030619|Ga0268386_10028520 | All Organisms → cellular organisms → Bacteria | 4411 | Open in IMG/M |
| 3300031228|Ga0299914_10031407 | All Organisms → cellular organisms → Bacteria | 4429 | Open in IMG/M |
| 3300031538|Ga0310888_10679819 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300031548|Ga0307408_100119009 | All Organisms → cellular organisms → Bacteria | 2043 | Open in IMG/M |
| 3300031716|Ga0310813_10036401 | All Organisms → cellular organisms → Bacteria | 3525 | Open in IMG/M |
| 3300031716|Ga0310813_10343524 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
| 3300031720|Ga0307469_10066863 | All Organisms → cellular organisms → Bacteria | 2358 | Open in IMG/M |
| 3300031720|Ga0307469_10995500 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 782 | Open in IMG/M |
| 3300031720|Ga0307469_11344326 | Not Available | 680 | Open in IMG/M |
| 3300031740|Ga0307468_101120177 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300031740|Ga0307468_101304639 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300031740|Ga0307468_101970879 | Not Available | 558 | Open in IMG/M |
| 3300031820|Ga0307473_10225907 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1130 | Open in IMG/M |
| 3300031820|Ga0307473_10668339 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 726 | Open in IMG/M |
| 3300031852|Ga0307410_10456724 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1043 | Open in IMG/M |
| 3300031913|Ga0310891_10091503 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300031949|Ga0214473_11514746 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300032000|Ga0310903_10097190 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1246 | Open in IMG/M |
| 3300032017|Ga0310899_10472077 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300032174|Ga0307470_10695790 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300032180|Ga0307471_102839708 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300032211|Ga0310896_10783676 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300032770|Ga0335085_10322015 | All Organisms → cellular organisms → Bacteria | 1823 | Open in IMG/M |
| 3300032770|Ga0335085_10363532 | All Organisms → cellular organisms → Bacteria | 1692 | Open in IMG/M |
| 3300032782|Ga0335082_11213082 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300032828|Ga0335080_10076775 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → environmental samples → uncultured Poribacteria bacterium | 3705 | Open in IMG/M |
| 3300033416|Ga0316622_103142372 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 524 | Open in IMG/M |
| 3300033417|Ga0214471_10286857 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1341 | Open in IMG/M |
| 3300033433|Ga0326726_10526826 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria | 1132 | Open in IMG/M |
| 3300033551|Ga0247830_11009750 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300034165|Ga0364942_0201494 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 650 | Open in IMG/M |
| 3300034692|Ga0373917_0011502 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1082 | Open in IMG/M |
| 3300034894|Ga0373916_0069016 | Not Available | 540 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 17.27% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.63% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.47% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.04% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.32% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.32% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.60% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 2.16% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.16% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.16% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.16% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.44% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.44% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 1.44% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.72% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.72% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.72% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.72% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.72% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300023072 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6 | Environmental | Open in IMG/M |
| 3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
| 3300034692 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A0.3 | Engineered | Open in IMG/M |
| 3300034894 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A0.2 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiFebDRAFT_111135472 | 3300000363 | Soil | MNGAMDGLDDRNRFVRRILLGIVAVLLIASFLVGIRW* |
| Ga0066672_102527821 | 3300005167 | Soil | MSAVMTDPGDLGQRNRLVRRILLGIVAVLIVASFMVGIRW* |
| Ga0066677_104269732 | 3300005171 | Soil | MSEVMIDPGDLGQRNRLVRRVLLGIVAVLIVASFMVGIRW* |
| Ga0066680_101183954 | 3300005174 | Soil | MSMSAVMTDPGDLGQRNRLVRRILLGIVAVLIVASFMVGIRW* |
| Ga0070687_1008701972 | 3300005343 | Switchgrass Rhizosphere | AGVRQGMSRVMTGLDDRNRLVRRILLGAVAILVIASFLVGIRW* |
| Ga0070703_104222802 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | PGLRQGMNVMASEHDARNRRIVRVLLAIVAVLIVASFMVGIRW* |
| Ga0073909_102441902 | 3300005526 | Surface Soil | MSLVMSDLQERNRWVRRIILTAVAVLVVASFLVGIRW* |
| Ga0070672_1017087942 | 3300005543 | Miscanthus Rhizosphere | MSVLMASEHDARNRRIVRVLLAIVAVLIVASFMVGIRW* |
| Ga0066701_100732222 | 3300005552 | Soil | MSTLMSELDDRNRLVRRVLLAIAAVLIVASFLVGIRW* |
| Ga0066699_108542211 | 3300005561 | Soil | MTDPGDLGQRNRLVRRILLGIVAVLIVASFMVGIRW* |
| Ga0066705_103619842 | 3300005569 | Soil | MSTLMSELGDRNRLVRRVLLAIMAVLIVASFLVGIRW* |
| Ga0068859_1030532522 | 3300005617 | Switchgrass Rhizosphere | MSVLMASEHDARNRRLVRVLLAIVAVLIVASFMVGIRW* |
| Ga0066903_1007810812 | 3300005764 | Tropical Forest Soil | MSIMSSELQDRNRLVRRIILTAVALLVVASFLVGIRW* |
| Ga0068860_1022197082 | 3300005843 | Switchgrass Rhizosphere | MSRVMTGLDDRNRLVRRILLGAVAILVIASFLVGIRW* |
| Ga0066652_1006197092 | 3300006046 | Soil | MSVLMASEDDARNRRIVRVLLAIVAVLIVASFMVGIRW* |
| Ga0075417_100073572 | 3300006049 | Populus Rhizosphere | MSLAMDSLGERNRLVRRILLTIVAALVIGSFLVGIRW* |
| Ga0079222_105740402 | 3300006755 | Agricultural Soil | MSTLRSELHDRNRLVRRVLLAIMAVLAIASFLVGIRW* |
| Ga0079220_105862192 | 3300006806 | Agricultural Soil | MSPMMSELDDRNRWVRRLLLGVVATLVVASFLVGIRW* |
| Ga0075428_10000012333 | 3300006844 | Populus Rhizosphere | MSLAMDSLEERNRTLRRVLLAIVALLVVASFLVGIRW* |
| Ga0075428_10000208622 | 3300006844 | Populus Rhizosphere | MSIVASDLEERNRRVRRIILTAVALLVVASFLVGIRW* |
| Ga0075428_1010173551 | 3300006844 | Populus Rhizosphere | MSDVMATLDERNRWVRRILLGVVAVLVVASFLVGIRW* |
| Ga0075428_1010877572 | 3300006844 | Populus Rhizosphere | MSIVMGGLEDRNRLVRRILLGIVALLVVASFLVGIRW* |
| Ga0075428_1019511682 | 3300006844 | Populus Rhizosphere | MNGVVDGLDDRNRFVRRILLGIVAVLLIASFLVGIRW* |
| Ga0075421_1001574904 | 3300006845 | Populus Rhizosphere | MSSVLMGLDDRNRRVRRILLGIVAVLVVVSFLVGIRW* |
| Ga0075421_1003610462 | 3300006845 | Populus Rhizosphere | MSVAMDSLGERNRLVRRILLTIVAALVIGSFLVGIRW* |
| Ga0075433_103977342 | 3300006852 | Populus Rhizosphere | MSTLMTDLAERNRLLRRVLLTIVAVLVVASFLVGIRW* |
| Ga0075425_1001294626 | 3300006854 | Populus Rhizosphere | MSTLMTDLTERNRLLRRVLLTIVAVLVVASFLVGIRW* |
| Ga0075425_1011503542 | 3300006854 | Populus Rhizosphere | MSVSMSELGDRNRLVRRVLLTIVAVLVVASFLVGIRW* |
| Ga0075425_1016717252 | 3300006854 | Populus Rhizosphere | MSTLMSELGDRNRLVRRMLLAIVAVLVVASFLVGIRW* |
| Ga0075434_1015795912 | 3300006871 | Populus Rhizosphere | MSTVMMSELGDRNRRLRRVLLLIAAALVVASFLVGIRW* |
| Ga0075429_1009388862 | 3300006880 | Populus Rhizosphere | MSTLTTDLPERNRLLRRVLLTIVAVLVVASFLVGIRW* |
| Ga0075426_112173932 | 3300006903 | Populus Rhizosphere | MSTMLSDLAERNRLVRRILLGIVAVLLVASFLVGIRW* |
| Ga0075424_1009039653 | 3300006904 | Populus Rhizosphere | GVRQGMSVAMDSLGERNRLVRRILLTIVAALVIGSFLVGIRW* |
| Ga0075419_114866772 | 3300006969 | Populus Rhizosphere | MSMLMTDLTERNRLLRRVLLTIVAVLVVASFLVGIRW* |
| Ga0079218_100083283 | 3300007004 | Agricultural Soil | MSVVMAGLDERNRRLRRLLLGIVAALVIASFLVGIRW* |
| Ga0079218_126701782 | 3300007004 | Agricultural Soil | MNGVMDGLEDRNRFVRRILLGIVAVLLIASFLVGIRW* |
| Ga0099791_105422811 | 3300007255 | Vadose Zone Soil | MSEVMTALGERNRLVRRVLLGIVATLLVASFLVGIRW* |
| Ga0099827_106951782 | 3300009090 | Vadose Zone Soil | MSTLMSELDDRNRLVRRVLLAIAAVLVVASFLVGIRW* |
| Ga0075418_115915021 | 3300009100 | Populus Rhizosphere | MSTLTTDLAERNRLLRRVLLTIVAVLVVASFLVGIRW* |
| Ga0105092_100171016 | 3300009157 | Freshwater Sediment | MSGIMVGLDDRNRRLRRILLGIVAVLVVVSFLVGIRW* |
| Ga0126376_115018912 | 3300010359 | Tropical Forest Soil | MSVSMTSELHDRNRRVRWILLGIMAVLVVASFLVGIRW* |
| Ga0126372_125012182 | 3300010360 | Tropical Forest Soil | MSIMSSELEDRNRLVRRIILTAVAVLVVASFLVGIRW* |
| Ga0126377_114714622 | 3300010362 | Tropical Forest Soil | MSIMSSELQERNRLVRRIILTTVAVLVVASFLVGIRW* |
| Ga0134125_102001275 | 3300010371 | Terrestrial Soil | MSQVMADLEERNRLVRRILLGAVAVLVVASFLVGIRW* |
| Ga0134128_107561142 | 3300010373 | Terrestrial Soil | MSVMVSKLDDRNRWVRRLLLGIVATLVVASFLVGIRW* |
| Ga0134127_113895772 | 3300010399 | Terrestrial Soil | SIVSSELQERNRWVRRIILTGVAVLVVASFLVGVRW* |
| Ga0134122_100449654 | 3300010400 | Terrestrial Soil | MSIVSSELQERNRWVRRIILTGVAVLVVASFLVGVRW* |
| Ga0134121_106742302 | 3300010401 | Terrestrial Soil | MSVMVSELDDRNRWVRRLLLGIVAVLVVASFLVGIRW* |
| Ga0134121_130634862 | 3300010401 | Terrestrial Soil | PGLRQGMSVLMASEQDDRNRLVRRVLLAIVAVLIIASFLVGIRW* |
| Ga0137369_101136464 | 3300012355 | Vadose Zone Soil | MSGVMADLDDRNRLLRRILLGIVAALVIASFLVGIRW* |
| Ga0137358_106923322 | 3300012582 | Vadose Zone Soil | MSTLMRTSLDERNRWIRRLLLGIVATLVVASFFVGIRW* |
| Ga0137397_100128977 | 3300012685 | Vadose Zone Soil | MSVLMASEHDDRNRIVRRVLLAIVAVLVIASFLVGIRW* |
| Ga0137397_104166912 | 3300012685 | Vadose Zone Soil | MSIVMSDIQERNRWVRRIILTAVAVLVVASFLVGIRW* |
| Ga0137397_111371341 | 3300012685 | Vadose Zone Soil | MSSVMADLDDRNRLLRRVLLGIVAVLVIASFLVGIRW* |
| Ga0137394_100635285 | 3300012922 | Vadose Zone Soil | MNALMSDLDERNRLLRRLLLTVVAVLLVASFLVGIRW* |
| Ga0137394_109147262 | 3300012922 | Vadose Zone Soil | MSLMMSDLQERNRWVRRIILTAVAVLVVASFLVGIRW* |
| Ga0126375_112692942 | 3300012948 | Tropical Forest Soil | MMSELADRNRRVRKILLVIMAVLIVASFLVGIRW* |
| Ga0126375_113406852 | 3300012948 | Tropical Forest Soil | MSAAVDSLRERNRLVRRILLTIVAALVIASFLVGIRW* |
| Ga0157378_101307926 | 3300013297 | Miscanthus Rhizosphere | MNVMASEHDARNRRIVRVLLAIMAVLIVASFMVGIRW* |
| Ga0137418_101718903 | 3300015241 | Vadose Zone Soil | MSVLMASEHDDRNRLVRRVLLAIVAVLVIASFLVGIRW* |
| Ga0137403_111722422 | 3300015264 | Vadose Zone Soil | GLRQGMSTVMPELGDRNRVVRRVLLAVVAVLVIASFLVGIRW* |
| Ga0132258_118822751 | 3300015371 | Arabidopsis Rhizosphere | MSIMTSDLQDRNRLVRRIILTAVAVLIVASFLVGIRW* |
| Ga0132258_126813493 | 3300015371 | Arabidopsis Rhizosphere | MSRVMADLEERNRLVRRILLGAVAVLVVASFLVGIRW* |
| Ga0132256_1026880521 | 3300015372 | Arabidopsis Rhizosphere | MSIMTSGLQDRNRLVRRIILTAVAVLIVASFLVGIRW* |
| Ga0132255_1041766631 | 3300015374 | Arabidopsis Rhizosphere | MSIMSSDLQERNRLVRRIILAGVAVLVVASFLVGI |
| Ga0184608_100137034 | 3300018028 | Groundwater Sediment | MSGVMVDLDDRNRLLRRILLGIVAVLVIASFLVGIRW |
| Ga0184634_101840871 | 3300018031 | Groundwater Sediment | MSGAMADLDDRNRLLRRILLGIVATLVIASFLVGIRW |
| Ga0184638_10879162 | 3300018052 | Groundwater Sediment | MSGVMADLDDHNRLLRRILLGIVAVLVIASFLVGIRW |
| Ga0184615_101460451 | 3300018059 | Groundwater Sediment | MSGVMADLDDRNRLLRRILLGIVAVLVIASFLVGIRW |
| Ga0184615_104464012 | 3300018059 | Groundwater Sediment | MSGVMAHLDDRNRLLRRILLGIVAALVIASFLVGIRW |
| Ga0184619_101372322 | 3300018061 | Groundwater Sediment | MSGVMVDLEDRNRLLRRILLGIVATLVIASLLVGIRW |
| Ga0184609_100656162 | 3300018076 | Groundwater Sediment | MSDVMVDLDDRNRLLRRILLGIVAVLVIASFLVGIRW |
| Ga0184633_103957442 | 3300018077 | Groundwater Sediment | MSGVMADLDDRNRLLRRILLGIVATLVIASFLVGIRW |
| Ga0066669_105546422 | 3300018482 | Grasslands Soil | MSVLMAFEHDDRNRLVRRVLLAIVAVLVIASFLVGIRW |
| Ga0187894_104426001 | 3300019360 | Microbial Mat On Rocks | MSLVMADLDDRNRLVRRILLGIVAALVVAAFLVGIRW |
| Ga0137408_12248432 | 3300019789 | Vadose Zone Soil | MSTLMRTSLDERNRWIRRLLLGIVATLVVASFFVGIRW |
| Ga0193755_10888942 | 3300020004 | Soil | MSLVMSDLQERNRWVRRIILTAVAVLVVASFLVGIRW |
| Ga0210379_104661912 | 3300021081 | Groundwater Sediment | MSGAMADLDDRNRLLRRILFGIVAALVIASFLVGIRW |
| Ga0247799_10644272 | 3300023072 | Soil | MSRVMTGLDDRNRLVRRILLGAVAILVIASFLVGIRW |
| Ga0209519_103618572 | 3300025318 | Soil | MSGMMVDLDDRNRRVRRILLGIVAVLVVASLLVGIRW |
| Ga0209640_106402822 | 3300025324 | Soil | MSRAMADLDDRNRLVRRILLGLVAVLVVASFLVGIRW |
| Ga0209751_106794061 | 3300025327 | Soil | MSGVMTDLEDRNRLVRRVLLGIVAALVVASFLVGIRW |
| Ga0207682_102497681 | 3300025893 | Miscanthus Rhizosphere | MSIVSSELQERNRWVRRIILTGVAVLVVASFLVGVRW |
| Ga0207642_106258922 | 3300025899 | Miscanthus Rhizosphere | MNVMASEHDARNRRIVRVLLAIVAVLIVASFMVGIRW |
| Ga0207645_106703771 | 3300025907 | Miscanthus Rhizosphere | MSVLMASEHDARNRRLVRVLLAIVAVLIVASFMVG |
| Ga0207701_111371132 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLVMSDLQERNRWVRRIILTAVAVLVVASFLVGIR |
| Ga0207704_101330603 | 3300025938 | Miscanthus Rhizosphere | MSLVMSDLQERNRWVRRIILTGVAVLVVASFLVGVRW |
| Ga0207689_103981342 | 3300025942 | Miscanthus Rhizosphere | MSQVMADLEERNRLVRRILLGAVAVLVVASFLVGIRW |
| Ga0209237_10450434 | 3300026297 | Grasslands Soil | MSTLMSELDDRNRLVRRVLLAIAAVLIVASFLVGIRW |
| Ga0209055_10880872 | 3300026309 | Soil | MSMSAVMTDPGDLGQRNRLVRRILLGIVAVLIVASFMVGIRW |
| Ga0209686_11413242 | 3300026315 | Soil | MSEVMIDPGDLGQRNRLVRRVLLGIVAVLIVASFMVGIRW |
| Ga0256867_100192837 | 3300026535 | Soil | MSGIMVGLDDRNRCLRRILLGIVAVLVVVSFLVGIRW |
| Ga0209156_102183772 | 3300026547 | Soil | MSTLMTDLAERNRLLRRVLLTIVAVLVVASLLVGI |
| Ga0209074_102731242 | 3300027787 | Agricultural Soil | MSTLRSELHDRNRLVRRVLLAIMAVLAIASFLVGIRW |
| Ga0209814_102471062 | 3300027873 | Populus Rhizosphere | MSVAMDSLGERNRLVRRILLTIVAALVIGSFLVGIRW |
| Ga0209481_104564782 | 3300027880 | Populus Rhizosphere | MSLAMDSLEERNRTLRRVLLAIVALLVVASFLVGIRW |
| Ga0209486_101415893 | 3300027886 | Agricultural Soil | MSVVMAGLDERNRRLRRLLLGIVAALVIASFLVGIRW |
| Ga0207428_104009052 | 3300027907 | Populus Rhizosphere | MSVLMASEHDARNRRIVRVLLAIVAVLIVASFMVGIRW |
| Ga0209382_10000149101 | 3300027909 | Populus Rhizosphere | MSDVMATLDERNRWVRRILLGVVAVLVVASFLVGIRW |
| Ga0209382_101146244 | 3300027909 | Populus Rhizosphere | MNGVVDGLDDRNRFVRRILLGIVAVLLIASFLVGIRW |
| Ga0209382_102528734 | 3300027909 | Populus Rhizosphere | MSSVLMGLDDRNRRVRRILLGIVAVLVVVSFLVGIRW |
| Ga0247822_107183602 | 3300028592 | Soil | MNGVMDGLEDRNRFVRRILLGIVAVLLIASFLVGIRW |
| Ga0307504_102066302 | 3300028792 | Soil | MSGVMADLEDRNRLLRRILLGIMAVLVIASFLVGIRW |
| Ga0307278_100502311 | 3300028878 | Soil | MSGVMADLDDRNRLLRRILLGIVAALVIASFLVGIRW |
| Ga0299907_101978442 | 3300030006 | Soil | MNGMMVDLDDRNRRVRRVLLGIVAVLVVASFLVGIRW |
| Ga0299907_103891422 | 3300030006 | Soil | MSGIMVGLDDRNRRVRRILLGIVAVLVVVSFLVGIRW |
| Ga0268386_100285202 | 3300030619 | Soil | MSGIMVGLDDRNRRLRRILLGIVAVLVVVSFLVGIRW |
| Ga0299914_100314078 | 3300031228 | Soil | MSSAMVGLDDRNRRVRRILLGIVAVLVVASLLVGIRW |
| Ga0310888_106798191 | 3300031538 | Soil | VRQGMSIVASDLEERNRRVRRIILTAVALLVVASFLVGIRW |
| Ga0307408_1001190094 | 3300031548 | Rhizosphere | MNGLMVGLDDRNRRVRRILLGIVAALVVVSFLVGIRW |
| Ga0310813_100364013 | 3300031716 | Soil | MSVMVSKLDDRNRWVRRLLLGIVATLVVASFLVGIRW |
| Ga0310813_103435242 | 3300031716 | Soil | MSVLMAAEHDARNRRIVRVLLAIVAVLIVASFMVGIRW |
| Ga0307469_100668632 | 3300031720 | Hardwood Forest Soil | MSTVMMSELGDRNRRLRRVLLLIAAALVVASFLVGIRW |
| Ga0307469_109955002 | 3300031720 | Hardwood Forest Soil | MSTLMADLDERNRLLRRVLLTIVAMLVVASLLVGIRW |
| Ga0307469_113443262 | 3300031720 | Hardwood Forest Soil | MSVPMMSDLADRNRRVRWVLLGLVAVLVAASFLVGIRW |
| Ga0307468_1011201772 | 3300031740 | Hardwood Forest Soil | MSTVMAGLDDRNRMVRRVLLAVVAVLIVASFMVGIRW |
| Ga0307468_1013046392 | 3300031740 | Hardwood Forest Soil | MSIVMSELQDRNRWVRRIILTVVAALIVASFLVGIRW |
| Ga0307468_1019708792 | 3300031740 | Hardwood Forest Soil | MSTVMTGLGDRNRLVRRVLLAIVALLVIVSFMVGIRW |
| Ga0307473_102259072 | 3300031820 | Hardwood Forest Soil | MSIMPSELQDRNRLVRRIILTAVAVLVVASFLVGVRW |
| Ga0307473_106683392 | 3300031820 | Hardwood Forest Soil | MSVMMSDLQERNRWVRRIILTAVAVLVVASFLVGIRW |
| Ga0307410_104567243 | 3300031852 | Rhizosphere | SVVMAGLDERNRRLRRLLLGIVAALVIASFLVGIRW |
| Ga0310891_100915033 | 3300031913 | Soil | RVMTGLDDRNRLVRRILLGAVAILVIASFLVGIRW |
| Ga0214473_115147461 | 3300031949 | Soil | MSRAMADLDDRNRLVRRILLGLVAVLMVASLLVGIR |
| Ga0310903_100971904 | 3300032000 | Soil | MSLVMADLEERNRLVRRILLGAVAVLVVASFLVGIRW |
| Ga0310899_104720772 | 3300032017 | Soil | MSIVSSDLQERNRWVRRIILTGVAVLVVASFLVGVRW |
| Ga0307470_106957902 | 3300032174 | Hardwood Forest Soil | MSVVMSDLQERNRWVRRIILTAVAVLVVASFLVGIRW |
| Ga0307471_1028397082 | 3300032180 | Hardwood Forest Soil | MSTLMSELDDRNRLVRRVLLAIAAVLVVASFLVGIRW |
| Ga0310896_107836762 | 3300032211 | Soil | VRQGMSRVMTGLDDRNRLVRRILLGAVAILVIASFLVGIRW |
| Ga0335085_103220154 | 3300032770 | Soil | MSIMRSELHDRNRLVLRIIVTAVAVLVVASFLVGIRW |
| Ga0335085_103635322 | 3300032770 | Soil | MSTVMTSALGDRNRRLRRLLLVIMAVLVVGSFLVGIRW |
| Ga0335082_112130822 | 3300032782 | Soil | MSIMASALHDRNRLVRRIILTVVAVLVVASFLVGIRW |
| Ga0335080_100767754 | 3300032828 | Soil | MSIMASGLADRNRLVRRIILTAVAVLVVASFLVGIRW |
| Ga0316622_1031423721 | 3300033416 | Soil | GVRQGMSGVMAGLDDRNRRVRWILLGIVAALVVASFLVGIRW |
| Ga0214471_102868572 | 3300033417 | Soil | MSLATADLDDRNRLVRRILLGIVAVLVIVSLLVGIRW |
| Ga0326726_105268262 | 3300033433 | Peat Soil | MSSLMTSLEERNRWIRRLLLGIVATLVVASFLVGIRW |
| Ga0247830_110097502 | 3300033551 | Soil | MNGVMDGLDDRNRFVRRILLGIVAVLLIASFLVGIRW |
| Ga0364942_0201494_518_631 | 3300034165 | Sediment | MSRVMADLDDRNRLVRRILLGLVAVLVIASFLVGIRW |
| Ga0373917_0011502_850_963 | 3300034692 | Sediment Slurry | MSDVMVGLDDRNRRVRWILLGIVAVLVVASFLVGIRW |
| Ga0373916_0069016_189_302 | 3300034894 | Sediment Slurry | MSIVASDLDERNRRVRRIILTAVALLVVASFLVGIRW |
| ⦗Top⦘ |