| Basic Information | |
|---|---|
| Family ID | F054760 |
| Family Type | Metagenome |
| Number of Sequences | 139 |
| Average Sequence Length | 44 residues |
| Representative Sequence | AWRAYSLNFDREHGGEKGEPWRRMFMSDAATAFAVLALVASD |
| Number of Associated Samples | 125 |
| Number of Associated Scaffolds | 139 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.46 % |
| % of genes near scaffold ends (potentially truncated) | 97.12 % |
| % of genes from short scaffolds (< 2000 bps) | 89.93 % |
| Associated GOLD sequencing projects | 121 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (86.331 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (8.633 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.338 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.129 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.29% β-sheet: 0.00% Coil/Unstructured: 55.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 139 Family Scaffolds |
|---|---|---|
| PF01904 | DUF72 | 4.32 |
| PF12680 | SnoaL_2 | 3.60 |
| PF00664 | ABC_membrane | 3.60 |
| PF00072 | Response_reg | 2.16 |
| PF01261 | AP_endonuc_2 | 2.16 |
| PF13577 | SnoaL_4 | 2.16 |
| PF07963 | N_methyl | 1.44 |
| PF02687 | FtsX | 1.44 |
| PF00753 | Lactamase_B | 1.44 |
| PF05099 | TerB | 1.44 |
| PF07676 | PD40 | 1.44 |
| PF01980 | TrmO | 1.44 |
| PF12681 | Glyoxalase_2 | 0.72 |
| PF08334 | T2SSG | 0.72 |
| PF01012 | ETF | 0.72 |
| PF12161 | HsdM_N | 0.72 |
| PF00999 | Na_H_Exchanger | 0.72 |
| PF14302 | DUF4377 | 0.72 |
| PF01872 | RibD_C | 0.72 |
| PF00069 | Pkinase | 0.72 |
| PF01699 | Na_Ca_ex | 0.72 |
| PF03193 | RsgA_GTPase | 0.72 |
| PF00441 | Acyl-CoA_dh_1 | 0.72 |
| PF01327 | Pep_deformylase | 0.72 |
| PF07690 | MFS_1 | 0.72 |
| PF13669 | Glyoxalase_4 | 0.72 |
| PF02834 | LigT_PEase | 0.72 |
| PF00083 | Sugar_tr | 0.72 |
| PF14236 | DUF4338 | 0.72 |
| PF01370 | Epimerase | 0.72 |
| PF12867 | DinB_2 | 0.72 |
| PF00814 | TsaD | 0.72 |
| PF01810 | LysE | 0.72 |
| PF14516 | AAA_35 | 0.72 |
| PF01555 | N6_N4_Mtase | 0.72 |
| PF11196 | DUF2834 | 0.72 |
| PF00583 | Acetyltransf_1 | 0.72 |
| PF04343 | DUF488 | 0.72 |
| PF13248 | zf-ribbon_3 | 0.72 |
| PF00230 | MIP | 0.72 |
| PF13518 | HTH_28 | 0.72 |
| PF03886 | ABC_trans_aux | 0.72 |
| PF13714 | PEP_mutase | 0.72 |
| PF00248 | Aldo_ket_red | 0.72 |
| PF01757 | Acyl_transf_3 | 0.72 |
| PF13546 | DDE_5 | 0.72 |
| PF03989 | DNA_gyraseA_C | 0.72 |
| PF04909 | Amidohydro_2 | 0.72 |
| PF13452 | MaoC_dehydrat_N | 0.72 |
| PF13673 | Acetyltransf_10 | 0.72 |
| PF06964 | Alpha-L-AF_C | 0.72 |
| PF13740 | ACT_6 | 0.72 |
| PF00893 | Multi_Drug_Res | 0.72 |
| PF13899 | Thioredoxin_7 | 0.72 |
| PF00480 | ROK | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 139 Family Scaffolds |
|---|---|---|---|
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 4.32 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.88 |
| COG3793 | Tellurite resistance protein TerB | Inorganic ion transport and metabolism [P] | 1.44 |
| COG1720 | tRNA (Thr-GGU) A37 N6-methylase | Translation, ribosomal structure and biogenesis [J] | 1.44 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.44 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.72 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.72 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.72 |
| COG2025 | Electron transfer flavoprotein, alpha subunit FixB | Energy production and conversion [C] | 0.72 |
| COG2076 | Multidrug transporter EmrE and related cation transporters | Defense mechanisms [V] | 0.72 |
| COG2086 | Electron transfer flavoprotein, alpha and beta subunits | Energy production and conversion [C] | 0.72 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.72 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.72 |
| COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 0.72 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.72 |
| COG3534 | Alpha-L-arabinofuranosidase | Carbohydrate transport and metabolism [G] | 0.72 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.72 |
| COG1514 | RNA 2',3'-cyclic phosphodiesterase (2'-5' RNA ligase) | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG1214 | tRNA A37 threonylcarbamoyladenosine modification protein TsaB | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG1162 | Ribosome biogenesis GTPase RsgA | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.72 |
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.72 |
| COG0533 | tRNA A37 threonylcarbamoyltransferase TsaD | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG0530 | Ca2+/Na+ antiporter | Inorganic ion transport and metabolism [P] | 0.72 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.72 |
| COG0387 | Cation (Ca2+/Na+/K+)/H+ antiporter ChaA | Inorganic ion transport and metabolism [P] | 0.72 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.72 |
| COG0242 | Peptide deformylase | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG0188 | DNA gyrase/topoisomerase IV, subunit A | Replication, recombination and repair [L] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 86.33 % |
| Unclassified | root | N/A | 13.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004092|Ga0062389_102883423 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 642 | Open in IMG/M |
| 3300004480|Ga0062592_102419384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300004643|Ga0062591_101962385 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300005166|Ga0066674_10369471 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300005331|Ga0070670_101266304 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300005332|Ga0066388_100205564 | All Organisms → cellular organisms → Bacteria | 2592 | Open in IMG/M |
| 3300005332|Ga0066388_105759570 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300005333|Ga0070677_10149722 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300005335|Ga0070666_10897281 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300005343|Ga0070687_101243742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300005446|Ga0066686_10219230 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300005459|Ga0068867_101169103 | Not Available | 705 | Open in IMG/M |
| 3300005526|Ga0073909_10716731 | Not Available | 503 | Open in IMG/M |
| 3300005557|Ga0066704_10460313 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 840 | Open in IMG/M |
| 3300005713|Ga0066905_101995221 | Not Available | 538 | Open in IMG/M |
| 3300005719|Ga0068861_101105509 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300005983|Ga0081540_1235361 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300006162|Ga0075030_101593604 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300006755|Ga0079222_10591775 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300006796|Ga0066665_10098515 | All Organisms → cellular organisms → Bacteria | 2139 | Open in IMG/M |
| 3300006796|Ga0066665_10389980 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300006804|Ga0079221_10193730 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| 3300006847|Ga0075431_100456512 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1273 | Open in IMG/M |
| 3300006852|Ga0075433_10137620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2171 | Open in IMG/M |
| 3300006853|Ga0075420_100053433 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3592 | Open in IMG/M |
| 3300006854|Ga0075425_100900839 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300006954|Ga0079219_11892835 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300007076|Ga0075435_100642369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 921 | Open in IMG/M |
| 3300009094|Ga0111539_10659841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1218 | Open in IMG/M |
| 3300009100|Ga0075418_12603134 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300009101|Ga0105247_11163184 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300009137|Ga0066709_103832462 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 546 | Open in IMG/M |
| 3300009518|Ga0116128_1128232 | Not Available | 734 | Open in IMG/M |
| 3300009549|Ga0116137_1188867 | Not Available | 555 | Open in IMG/M |
| 3300009615|Ga0116103_1119594 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300009621|Ga0116116_1148672 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300009631|Ga0116115_1115633 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300009762|Ga0116130_1222986 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium → unclassified Verrucomicrobium → Verrucomicrobium sp. | 598 | Open in IMG/M |
| 3300009795|Ga0105059_1034766 | Not Available | 616 | Open in IMG/M |
| 3300010320|Ga0134109_10202392 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 733 | Open in IMG/M |
| 3300010362|Ga0126377_12798770 | Not Available | 562 | Open in IMG/M |
| 3300010371|Ga0134125_12995130 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 512 | Open in IMG/M |
| 3300010398|Ga0126383_12499488 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300010403|Ga0134123_11571539 | Not Available | 704 | Open in IMG/M |
| 3300011269|Ga0137392_10815335 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 770 | Open in IMG/M |
| 3300012198|Ga0137364_10839007 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 695 | Open in IMG/M |
| 3300012199|Ga0137383_10516582 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300012212|Ga0150985_120051609 | All Organisms → cellular organisms → Bacteria | 2545 | Open in IMG/M |
| 3300012359|Ga0137385_10093875 | All Organisms → cellular organisms → Bacteria | 2661 | Open in IMG/M |
| 3300012685|Ga0137397_11225981 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 539 | Open in IMG/M |
| 3300012917|Ga0137395_10127534 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1721 | Open in IMG/M |
| 3300012923|Ga0137359_10355948 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1301 | Open in IMG/M |
| 3300012931|Ga0153915_13226955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300012940|Ga0164243_10162617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1889 | Open in IMG/M |
| 3300012971|Ga0126369_10558412 | Not Available | 1210 | Open in IMG/M |
| 3300012971|Ga0126369_11375316 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300012971|Ga0126369_12501257 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300012971|Ga0126369_13001959 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300013296|Ga0157374_12972558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300014156|Ga0181518_10058645 | All Organisms → cellular organisms → Bacteria | 2273 | Open in IMG/M |
| 3300014156|Ga0181518_10515701 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300014326|Ga0157380_13430591 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300014638|Ga0181536_10318766 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300015245|Ga0137409_10561893 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300015358|Ga0134089_10096356 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300015371|Ga0132258_12369111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1330 | Open in IMG/M |
| 3300016319|Ga0182033_11501971 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 608 | Open in IMG/M |
| 3300017823|Ga0187818_10371112 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 633 | Open in IMG/M |
| 3300017938|Ga0187854_10055480 | All Organisms → cellular organisms → Bacteria | 1964 | Open in IMG/M |
| 3300017940|Ga0187853_10475039 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 547 | Open in IMG/M |
| 3300018020|Ga0187861_10432678 | Not Available | 548 | Open in IMG/M |
| 3300018025|Ga0187885_10152239 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300018025|Ga0187885_10367947 | Not Available | 646 | Open in IMG/M |
| 3300018035|Ga0187875_10010708 | All Organisms → cellular organisms → Bacteria | 5803 | Open in IMG/M |
| 3300018035|Ga0187875_10222794 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1035 | Open in IMG/M |
| 3300018060|Ga0187765_10812737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 625 | Open in IMG/M |
| 3300018422|Ga0190265_10904954 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300018432|Ga0190275_11371461 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 784 | Open in IMG/M |
| 3300018433|Ga0066667_11403464 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300018468|Ga0066662_11689291 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300018468|Ga0066662_11805955 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300018476|Ga0190274_11004861 | Not Available | 909 | Open in IMG/M |
| 3300018476|Ga0190274_12343132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
| 3300018476|Ga0190274_13912073 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
| 3300018481|Ga0190271_12670547 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300019356|Ga0173481_10170242 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300020170|Ga0179594_10058929 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1314 | Open in IMG/M |
| 3300022915|Ga0247790_10091308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
| 3300025324|Ga0209640_10512733 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300025506|Ga0208937_1144108 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300025899|Ga0207642_10652483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
| 3300025900|Ga0207710_10326276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 779 | Open in IMG/M |
| 3300025908|Ga0207643_10446458 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300025922|Ga0207646_11126229 | Not Available | 690 | Open in IMG/M |
| 3300025923|Ga0207681_10918310 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300025925|Ga0207650_10851216 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300025926|Ga0207659_11685517 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300025941|Ga0207711_11246431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 685 | Open in IMG/M |
| 3300025960|Ga0207651_10236149 | All Organisms → cellular organisms → Bacteria | 1487 | Open in IMG/M |
| 3300026035|Ga0207703_10840453 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300026089|Ga0207648_10551615 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300026095|Ga0207676_11222448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 745 | Open in IMG/M |
| 3300026095|Ga0207676_11829176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300026296|Ga0209235_1103792 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1220 | Open in IMG/M |
| 3300027696|Ga0208696_1033883 | All Organisms → cellular organisms → Bacteria | 1844 | Open in IMG/M |
| 3300027815|Ga0209726_10437760 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300027854|Ga0209517_10070755 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 2478 | Open in IMG/M |
| 3300027874|Ga0209465_10634190 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300027907|Ga0207428_10530800 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300027909|Ga0209382_10888047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 940 | Open in IMG/M |
| 3300028379|Ga0268266_10603481 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300028381|Ga0268264_11510888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 682 | Open in IMG/M |
| 3300028556|Ga0265337_1032712 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
| 3300028802|Ga0307503_10421459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 702 | Open in IMG/M |
| 3300028889|Ga0247827_11221838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300029999|Ga0311339_10818076 | Not Available | 895 | Open in IMG/M |
| 3300031525|Ga0302326_10832392 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300031538|Ga0310888_10257890 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300031708|Ga0310686_110170942 | Not Available | 542 | Open in IMG/M |
| 3300031708|Ga0310686_116218876 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2397 | Open in IMG/M |
| 3300031854|Ga0310904_10207897 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300031858|Ga0310892_10839912 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300032000|Ga0310903_10643507 | Not Available | 568 | Open in IMG/M |
| 3300032005|Ga0307411_10373190 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1171 | Open in IMG/M |
| 3300032013|Ga0310906_10271721 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300032017|Ga0310899_10243428 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300032059|Ga0318533_10658571 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 769 | Open in IMG/M |
| 3300032075|Ga0310890_10054214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2311 | Open in IMG/M |
| 3300032157|Ga0315912_11561821 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 519 | Open in IMG/M |
| 3300032677|Ga0316227_1146639 | Not Available | 868 | Open in IMG/M |
| 3300032828|Ga0335080_10367826 | All Organisms → cellular organisms → Bacteria | 1548 | Open in IMG/M |
| 3300032897|Ga0335071_10749700 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300033402|Ga0326728_10389247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 1199 | Open in IMG/M |
| 3300033402|Ga0326728_11211838 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 500 | Open in IMG/M |
| 3300033405|Ga0326727_10064361 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → Opitutus terrae | 5426 | Open in IMG/M |
| 3300033412|Ga0310810_11053515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_65_29 | 685 | Open in IMG/M |
| 3300034147|Ga0364925_0205218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.63% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.47% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.76% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.04% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 5.04% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.60% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.88% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.16% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.16% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 2.16% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.16% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.44% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.44% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.44% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.44% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.44% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.72% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.72% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.72% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.72% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.72% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.72% |
| Compost | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost | 0.72% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.72% |
| Green-Waste Compost | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost | 0.72% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.72% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.72% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.72% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.72% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2070309004 | Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto Rico | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009549 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 | Environmental | Open in IMG/M |
| 3300009615 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 | Environmental | Open in IMG/M |
| 3300009621 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 | Environmental | Open in IMG/M |
| 3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300009795 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012940 | Organic Plus compost microbial communities from Emeryville, California, USA - Original compost - Organic plus compost (OP) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025506 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Host-Associated | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032677 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18019 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| prs_03874660 | 2070309004 | Green-Waste Compost | AANQQECQIDQSRWRCWRTFSLNFDTEHGGETGEPWRRMFMSDAATAFAALALLPSE |
| Ga0062389_1028834232 | 3300004092 | Bog Forest Soil | DKNHWKCWRSYSLNYDREHGGRHGEPWRRMFMSDAATSFAVLALLPSD* |
| Ga0062592_1024193841 | 3300004480 | Soil | WHAHSLNYDREHGGEKGEPWRRLFMSDTATAFAILALADSE* |
| Ga0062591_1019623852 | 3300004643 | Soil | WHAHSLNYDREHGGEKGEPWRRLFMSDTATAFAILALADGE* |
| Ga0066674_103694711 | 3300005166 | Soil | NVWKCWRTNSLNHDRENGGARGGAWKRMFMSDAATAFAVLALSPLD* |
| Ga0070670_1012663042 | 3300005331 | Switchgrass Rhizosphere | HSLNYDREHGGEKVEPWRRLFMSDTATAFAILALAESERGAHGSP* |
| Ga0066388_1002055644 | 3300005332 | Tropical Forest Soil | QHEWPAWRAHSLNFDREHGGEKGEPWRRMFMSDSATAFAALALLASD* |
| Ga0066388_1057595702 | 3300005332 | Tropical Forest Soil | FSLNHDRENGGDEGDSWPRMFMTDAATAFAVLALLPSDHNPKPK* |
| Ga0070677_101497221 | 3300005333 | Miscanthus Rhizosphere | HAHSLNYDREHGGEKGEPWRRLFMSDTATAFAILALADGE* |
| Ga0068869_1001038931 | 3300005334 | Miscanthus Rhizosphere | DVPGRAWHAHSLNYDREHGGEKGEPWRRLFMSDTATAFAILALEDGGSQ* |
| Ga0070666_108972812 | 3300005335 | Switchgrass Rhizosphere | EWLAWRAHSLNYDREHGGSRGEPWRRLFMSDAATAFASLALCASE* |
| Ga0070687_1012437422 | 3300005343 | Switchgrass Rhizosphere | WLAWRAHSLNYDREHGGAKGLPWQRLFMSDAATAFAALALTEAEKQ* |
| Ga0066686_102192303 | 3300005446 | Soil | VNQRIHPAWRAYSLNFDREHGGEKGQPWRRMFMSDAATAFAVLALVASD* |
| Ga0068867_1011691031 | 3300005459 | Miscanthus Rhizosphere | AWRAHSLNFDREHGGEKGEPWRRMFMSDSATAFAVLALVASD* |
| Ga0073909_107167312 | 3300005526 | Surface Soil | NADREHGGPGGDTWRRLFMSDAATAFSVLALLEVESK* |
| Ga0066704_104603131 | 3300005557 | Soil | RAWRAHSLNVDREHGGKDGEPWRRMFMSDAATAFAVLALAASD* |
| Ga0066905_1019952211 | 3300005713 | Tropical Forest Soil | QRNVQVGQHEWPAWRAHSLNFDREHEGEKGEPWRRMFMSDSATAFAALALLASD* |
| Ga0068861_1011055092 | 3300005719 | Switchgrass Rhizosphere | AHSLNYDREHGGSRGEPWRRLFMSDAATAFASLALCASE* |
| Ga0081540_12353612 | 3300005983 | Tabebuia Heterophylla Rhizosphere | LNYDRERGGDKGEPWRRMFMSDSATAFAALALIESK* |
| Ga0075030_1015936042 | 3300006162 | Watersheds | DQHRWDCWRTFSLNHDREHGGDEGDSWPRMFMSDAATAFAALALLPSDRSPTLK* |
| Ga0079222_105917751 | 3300006755 | Agricultural Soil | NQREGQIDQNRWQCWRTYSLNCDREHGGDEGEPWRRMFMSDAATAFAVLALLPSD* |
| Ga0066665_100985151 | 3300006796 | Soil | AWRAYSLNFDREHGGEKGEPWRRMFMSDAATAFAVLALVASD* |
| Ga0066665_103899803 | 3300006796 | Soil | HPAWRSYSLNHDREHGGERGESWRRLFMSDAATAYAVLALLATD* |
| Ga0079221_101937303 | 3300006804 | Agricultural Soil | EIDQYRWDCWRTFSLNHDREHGGEEGDSWPRMFMSDAATAFASLALLRSDRSLTLK* |
| Ga0075431_1004565123 | 3300006847 | Populus Rhizosphere | WQAHSLNYDREHGGEKGEPWRRLFMSDTATAFAILALADN* |
| Ga0075433_101376201 | 3300006852 | Populus Rhizosphere | HSLNYDREHGGEKGEPWRRLFMSDSATAFAVLALVASD* |
| Ga0075420_1000534336 | 3300006853 | Populus Rhizosphere | LNYDREHGGEKGEPWRRLFMSDTATAFAILALADN* |
| Ga0075425_1009008391 | 3300006854 | Populus Rhizosphere | REWPAWRAHSLNYDREHGGTRGEPWRQLFMSDAATAFAALALLE* |
| Ga0079219_118928351 | 3300006954 | Agricultural Soil | LNFDREQNSDKGEPWRRIFMSDSATAFAALALAVSE* |
| Ga0075435_1006423693 | 3300007076 | Populus Rhizosphere | AWRAHSLNFDREHGGDKGEPWRRMFMSDSATAFAVLALVASD* |
| Ga0111539_106598413 | 3300009094 | Populus Rhizosphere | SLNYDREHGGEKGEPWRRLFMSDTATAFAILALADGE* |
| Ga0075418_126031341 | 3300009100 | Populus Rhizosphere | HSIRPAWRAHSLNFDREHGGEKGEPWRRMFMSDAATAFAILALVESD* |
| Ga0105247_111631842 | 3300009101 | Switchgrass Rhizosphere | AHSLNFDREQNTDKGEPWRRMFMSDSATAFAALALAVSE* |
| Ga0066709_1038324621 | 3300009137 | Grasslands Soil | YRAWRAYSLNIDREHGGKEGEPWRRMFMSDAATTFAVLALVASD* |
| Ga0116128_11282321 | 3300009518 | Peatland | CWRSHSLNYDRENGGARGEPFKRMVMSDLATAFAVLALSPPD* |
| Ga0116137_11888671 | 3300009549 | Peatland | KCWRTYSLNHDRENGGDHGGDWKQMLMSDMATAFAVLALSASD* |
| Ga0116103_11195942 | 3300009615 | Peatland | RVKHENPRSDQSQWKCWRTYSLNYEYEQGGDDGEPWRRMFMSDAATAFAVLALLPKD* |
| Ga0116116_11486721 | 3300009621 | Peatland | CWRTYSLNYDREHGGKHGDPWSRMFMSDAATAFAVLALLPAD* |
| Ga0116115_11156331 | 3300009631 | Peatland | NQRECQIDQARWNCWRTYSLNYDREHGGKHGDPWSRMFMSDAATAFAVLALLPAD* |
| Ga0116130_12229861 | 3300009762 | Peatland | WKCWRTYSLNYDREHGGDHGEPWRRMFMSDGATAFAALALLPAD* |
| Ga0105059_10347661 | 3300009795 | Groundwater Sand | AWRAHSLNYDREHGGSRGEPWRRLFMSDTATAFASLALSASE* |
| Ga0134109_102023921 | 3300010320 | Grasslands Soil | NFDREHGGEKGEPWRRMFMSDSATAFAVLALVASD* |
| Ga0126377_127987701 | 3300010362 | Tropical Forest Soil | HYDNSTLKGDKGEPWRRLFMSDTATAFAILALADSE* |
| Ga0134125_129951301 | 3300010371 | Terrestrial Soil | LNYDREHGSLKSDSALAGDKGEPWRRLFMSDTATAFAILALADRE* |
| Ga0126383_124994882 | 3300010398 | Tropical Forest Soil | DCWRTFSLNHDRENGGDEGDSWPRMFMSDAATAFTALALLPSQRSSKPK* |
| Ga0134123_115715392 | 3300010403 | Terrestrial Soil | LNFDREHGGEKGEPWRRMFMSDSATAFAVLALVDSD* |
| Ga0137392_108153351 | 3300011269 | Vadose Zone Soil | NIDREHGGKEGEPWRRMFMSDAATTFAVLALVASD* |
| Ga0137364_108390071 | 3300012198 | Vadose Zone Soil | RPAWRAYSLNFDREHGGEKGEPWRRMFMSDAATAFAVLALVASD* |
| Ga0137383_105165821 | 3300012199 | Vadose Zone Soil | VQAGQHSWPAWRAHSLNFDREHGGDKGEPWRRMFMSDSATAFAVLALVASD* |
| Ga0150985_1200516094 | 3300012212 | Avena Fatua Rhizosphere | HSLNYDREHGGEKGEPWRRLFMSDTATAFAILALADDQS* |
| Ga0137385_100938757 | 3300012359 | Vadose Zone Soil | HSLNFDREHGGDDGESWRRMFMSDAATAFAALALLPSD* |
| Ga0137397_112259811 | 3300012685 | Vadose Zone Soil | MHRAWRSYSLNVDREHGGDKGEPWRRMFMSDAATAFAVLALAASD* |
| Ga0137395_101275341 | 3300012917 | Vadose Zone Soil | ANQREYQIEQSHWKCWRTYSLNYDHEHGGDDGEPWRRMFMSDAATAFAALALLASH* |
| Ga0137359_103559483 | 3300012923 | Vadose Zone Soil | AYSLNIDREHGGKEGEPWRRMFMSDAATTFAVLALVASD* |
| Ga0153915_132269551 | 3300012931 | Freshwater Wetlands | IGPSHWKCWRTSSLNFDTEHGGESGEPWRRMFMSDAATAFAALALLPSDE* |
| Ga0164243_101626171 | 3300012940 | Compost | SPHYDSALRGDKGEPWRRLFMADTATAFAVLALAGSEQEKE* |
| Ga0126369_105584121 | 3300012971 | Tropical Forest Soil | YKWNCWRTYSLNCDREHGGDEGEPWRRMFMSDAATAFASLALLAYD* |
| Ga0126369_113753161 | 3300012971 | Tropical Forest Soil | GRAWRAHSLNYDREHGGEKGEPWRRLFMSDTATAFAILALEASERGSVSDTR* |
| Ga0126369_125012572 | 3300012971 | Tropical Forest Soil | WPAWRAHSLNFDREHGGEKGEPWRRMFMSDSATAFAALALVTSD* |
| Ga0126369_130019592 | 3300012971 | Tropical Forest Soil | YDREHGGPTGEPWRRLFMSDAATAFAVLALTEAESR* |
| Ga0157374_129725581 | 3300013296 | Miscanthus Rhizosphere | LNYDREHGGEKGEPWRRLFMSDTATAFAILALADGE* |
| Ga0181518_100586453 | 3300014156 | Bog | NYDREHGGDHGEPWRRMFMSDGATAFAALALLPAD* |
| Ga0181518_105157012 | 3300014156 | Bog | LNYDREHGGDHGEPWRRMFMSDGATAFAALALLPAD* |
| Ga0157380_134305911 | 3300014326 | Switchgrass Rhizosphere | SSLISLALAAPSVIFDRENGGDKGESWRRMFMSDSATAFAALALLAAD* |
| Ga0181536_103187661 | 3300014638 | Bog | QRWKCWRTPSLNHDRENGGPRGDPWKATVMSDMATAFAVLALSPPD* |
| Ga0137409_105618932 | 3300015245 | Vadose Zone Soil | IDQNRWKCWRTYSLNCDREHGGDEGEPWRRMFMSDAATAFAALALLASD* |
| Ga0134089_100963563 | 3300015358 | Grasslands Soil | QVNQRMHHAWRAHSLNFDREHGGEKGEPWRRMFMSDSATAFAVLALVASD* |
| Ga0132258_123691113 | 3300015371 | Arabidopsis Rhizosphere | SLNYDREHGGSRGESWRRLFMSDAATAFAALALLSAE* |
| Ga0182033_115019712 | 3300016319 | Soil | WRTFSLNQDREKGGDEGDSWPRMFMSDAATAFAALALLPSDRDPKAK |
| Ga0187818_103711122 | 3300017823 | Freshwater Sediment | YSLNYDREAGGAHGEPFNRMLMSDLATAFAVLALSPPD |
| Ga0187854_100554801 | 3300017938 | Peatland | IDQSHWKCWRTYSLNYDHEQGGDDGEPWRRMFMSDAATAFAVLALLPKD |
| Ga0187853_104750391 | 3300017940 | Peatland | IDQNRWKCWRTYSLNHDQEHGGGEGEPWRRMFMSEGATAFAALALLPSD |
| Ga0187861_104326781 | 3300018020 | Peatland | TYSLNHDRENGGDHGGDWKQMLMSDMATAFAVLALSASD |
| Ga0187885_101522391 | 3300018025 | Peatland | NQKECQIDQSRWKCWRAYSLNFDTEQGGEDGEPWRRMFMSDGATAFAALALLPSN |
| Ga0187885_103679472 | 3300018025 | Peatland | CQIDQQHWKCWRSHSLNYDRENGGARGEPFKRMVMSDLATAFAVLALSPPD |
| Ga0187875_100107081 | 3300018035 | Peatland | KCWRTYSLNYDREHGGDHGEPWRRMFMSDGATAFAALALLPAD |
| Ga0187875_102227941 | 3300018035 | Peatland | KCWRTYSLNYDREHGGDHGEPWRRMFMSDGATAFAALALLPSD |
| Ga0187765_108127371 | 3300018060 | Tropical Peatland | RCWRTLSLNFDTEHGGESGEPWRRMFMSDAATAFAALALLSSD |
| Ga0190265_109049542 | 3300018422 | Soil | GRGWQSHSLNYDREHGSPIYDRALGGEKGEPWRRLFMSDTATAFAILALADSK |
| Ga0190275_113714611 | 3300018432 | Soil | AWAPWRSHSLNHDREHGGPKGEPWRRMFMSDLATAFGVLALL |
| Ga0066667_114034641 | 3300018433 | Grasslands Soil | QIRPAWRTHSINYDREHGGEEGEPWPRMFMSDAATAFSVLALVGSD |
| Ga0066662_116892911 | 3300018468 | Grasslands Soil | NQWKWWRTYSLNCDREHGGDEGETWRRLFMSYAATSFAVLALLSSD |
| Ga0066662_118059553 | 3300018468 | Grasslands Soil | ISAWRAHSLNFDREHAGDKGEPWRRMFMSDLATGFAVLALVGSD |
| Ga0190274_110048611 | 3300018476 | Soil | NYDREHGGEKGEPWRRLFMSDTATAFAILALADSN |
| Ga0190274_123431322 | 3300018476 | Soil | WHAHSLNYDREHGGEKGEPWRRLFMSDTATAFAILALADSE |
| Ga0190274_139120731 | 3300018476 | Soil | NYDREHGSLNYNSALNGEKGEPWRRLFMSDTATAFAILALADSE |
| Ga0190271_126705471 | 3300018481 | Soil | PAWAPWRAHSLNHDREHGGPRGEAWRRMFMSDLATAFAALALL |
| Ga0173481_101702423 | 3300019356 | Soil | NYDREHGGEKGEPWRRLFMSDTATAFAILALADGE |
| Ga0179594_100589293 | 3300020170 | Vadose Zone Soil | QRTYRAWRAYSLNIDREHGGKEGEPWRRMFMSDAATTFAVLALVASD |
| Ga0247790_100913082 | 3300022915 | Soil | EVPGRGWHAHSLNYDREHGGEKGEPWRRLFMSDTATAFAILALADSE |
| Ga0209640_105127331 | 3300025324 | Soil | SLNFDREHGGRRGEPVRRLFMSDLATAFAVLALIEPGGK |
| Ga0208937_11441081 | 3300025506 | Peatland | LNYDREHGGDHGEPWRRMFMSDGATAFAALALLPAD |
| Ga0207642_106524831 | 3300025899 | Miscanthus Rhizosphere | LTYDREHGGPKGEPWRRLFMSDAATAFAALALTEAEKQ |
| Ga0207710_103262761 | 3300025900 | Switchgrass Rhizosphere | SLNYDREHGGARGAPWQRLFMSDAATAFATLGLLATD |
| Ga0207643_104464581 | 3300025908 | Miscanthus Rhizosphere | WQAHSLNYDREHGGEKGEPWRRLFMSDTATAFAVLALAGTE |
| Ga0207646_111262292 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | WRTHSLNFDREHGGEKGEAWRRMFMSDSATAFAVLALVASE |
| Ga0207681_109183101 | 3300025923 | Switchgrass Rhizosphere | SLNFDREHGGEKGEPWRRLFMSDTATAFAILALAD |
| Ga0207650_108512161 | 3300025925 | Switchgrass Rhizosphere | HSLNYDREHGGEKVEPWRRLFMSDTATAFAILALAESERGAHGSP |
| Ga0207659_116855171 | 3300025926 | Miscanthus Rhizosphere | AYSLNYDREHGGARGEPWRRLFMSDAATGFASLALTESE |
| Ga0207711_112464312 | 3300025941 | Switchgrass Rhizosphere | RAYSLNYDREHGGARGEPWRRLFMSDAATAFATLGLLATD |
| Ga0207651_102361491 | 3300025960 | Switchgrass Rhizosphere | PGRGWHAHSLNFDREHGGEKGEPWRRLFMSDTATAFAILALTD |
| Ga0207703_108404531 | 3300026035 | Switchgrass Rhizosphere | SLNYDREHGGEKGEPWRRLFMSDTATAFAILALADGE |
| Ga0207648_105516152 | 3300026089 | Miscanthus Rhizosphere | EVPGRGWHAHSLNYDREHGGEKGEPWRRLFMSDTATAFAILALAD |
| Ga0207676_112224482 | 3300026095 | Switchgrass Rhizosphere | PGRAWRAHSLNYDREHGSEKGEPWRRLFMSDTATAFAILALADN |
| Ga0207676_118291761 | 3300026095 | Switchgrass Rhizosphere | PERRAWRTHSLNFDREHGGQRGEPWRRLFMSDAATAFSVMTLAASE |
| Ga0209235_11037924 | 3300026296 | Grasslands Soil | YRAWRSYSLNHAREHGGTAGEPWRRMFMSDAATTFAVLALTASD |
| Ga0208696_10338834 | 3300027696 | Peatlands Soil | AHSLNYDREHGGEKGEPRRRLFMSDTATAFAILALEDSEQGSASEAR |
| Ga0209726_104377601 | 3300027815 | Groundwater | LNFEREHGGNKGEPLRRMFMSDAATAFAVLALVGSE |
| Ga0209517_100707552 | 3300027854 | Peatlands Soil | QQEWQIDQSHWNCWRTYSLNYDHEHGGDDGEPWQRMFMSDAATAFAALALLPSD |
| Ga0209465_106341901 | 3300027874 | Tropical Forest Soil | GAVHHREHGGDEGEPWRRMFMSDAATAFASLALLAYD |
| Ga0207428_105308001 | 3300027907 | Populus Rhizosphere | PGRAWHAHSLNYDREHGGEKGEPWRRLFMSDTATAFAILALAESN |
| Ga0209382_108880472 | 3300027909 | Populus Rhizosphere | AHSLNFDREHGGEKGEPWRRMFMSDAATAFAILALVESD |
| Ga0268266_106034811 | 3300028379 | Switchgrass Rhizosphere | PDVPGRAWHAHSLNYDREHGGEKGEPWRRLFMSDTATAFAILALADGE |
| Ga0268264_115108882 | 3300028381 | Switchgrass Rhizosphere | RAWQAHSLNYDREHGGEKGEPWRRLFMSDTATAFAILALADGE |
| Ga0265337_10327123 | 3300028556 | Rhizosphere | QSHWKCWRTYSLNYDTEHGGDHGKALGRMFMSDAATAFAALALLPSD |
| Ga0307503_104214591 | 3300028802 | Soil | WRAYSLNYDREHGGPKGEPWRRLFMSDAATAFAALALLEAENK |
| Ga0247827_112218381 | 3300028889 | Soil | RGWHAHSLNFDREHGGEKGEPWRRLFMSDTATAFAILALADSE |
| Ga0311339_108180762 | 3300029999 | Palsa | RECQIDQSHWKCWRTYSLNYDHEHGGDDGEPWRRMFMSDAATAFAALALMPSD |
| Ga0302326_108323923 | 3300031525 | Palsa | IDQSHWQCWRTYSLNYDHEHGGDDGEPWRRMFMSDAATAFAALALLPSD |
| Ga0310888_102578903 | 3300031538 | Soil | GRAWQAHSLNYDREHGGEKGEPWRRLFMSDTATAFAILALAESN |
| Ga0310686_1101709421 | 3300031708 | Soil | LNYDREHGGEKGEPWRRLFMSDTATAFAILALAESEQRSDSATR |
| Ga0310686_1162188761 | 3300031708 | Soil | WQIDQHHWSCWRSYSLNQEREQDGDEGEPWRRMFMSDAATAFAALALLPPNSSALYK |
| Ga0310904_102078973 | 3300031854 | Soil | QAHSLNYDREHGGEKGEPWRRLFMSDTATAFAILALAESN |
| Ga0310892_108399121 | 3300031858 | Soil | IDQQTWRAWRAHSLNFDREHGGDKGESWRRMFMSDSATAFAALALLAAD |
| Ga0310903_106435071 | 3300032000 | Soil | HSLNFDREHGGEKGEPWRRMFMSDSATAFAVLALVASD |
| Ga0307411_103731901 | 3300032005 | Rhizosphere | WRAHSLNFDREHGGEKGEPWRRLFMSDLATAFAVLALTD |
| Ga0310906_102717211 | 3300032013 | Soil | PEVPGRGWHAHSLNFDREHGGEKGEPWRRLFMSDTATAFAILALAD |
| Ga0310899_102434281 | 3300032017 | Soil | GWHAHSLNFDREHGGEKGEPWRRLFMSDTATAFAILALTD |
| Ga0318533_106585711 | 3300032059 | Soil | ECWRTFSLNQDREKGGDEGDSWPRMFMSDAATAFAALALLPSDRDPKAK |
| Ga0310890_100542144 | 3300032075 | Soil | HAHSLNYDREHGGEKGEPWRRLFMSDTATAFAILALAESN |
| Ga0315912_115618212 | 3300032157 | Soil | SLNYDREHGSLKYDRELGGEKGEPWRRLFMSDTATAFAILALAERE |
| Ga0316227_11466391 | 3300032677 | Freshwater | SRWKCWRTYSLNFDTEHGGENGESWRRMFMSDAATAFAALALLSSD |
| Ga0335080_103678261 | 3300032828 | Soil | WRTYSLNYDREHGGKHGDPWSRMFMSDAATAFAVLALLPAE |
| Ga0335071_107497001 | 3300032897 | Soil | RIEQDNWDCWRTHSLNFDREHGGEEGEPWRRMFMSDGATAFAVLALLAAD |
| Ga0326728_103892472 | 3300033402 | Peat Soil | MTGWIYGQIDQQHWKCWRSYSLNYDRENGGARGEPFKRMVMSDLATAFAVLALSPPD |
| Ga0326728_112118382 | 3300033402 | Peat Soil | NHDQEHGGGEGEPWRRMFMSEAATAFAALALLPSD |
| Ga0326727_100643612 | 3300033405 | Peat Soil | MLNYDREHGGQRGQPWKRMFMSDAATAFAVLALLPSD |
| Ga0310810_110535152 | 3300033412 | Soil | WRAHSLNYDREHGGEKGEPWRRLFMSDTATAFAILALADNL |
| Ga0364925_0205218_1_126 | 3300034147 | Sediment | REHGSLNYNSALNGEKGEPWRRLFMSDTATAFAVLALADSE |
| ⦗Top⦘ |