| Basic Information | |
|---|---|
| Family ID | F054666 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 139 |
| Average Sequence Length | 40 residues |
| Representative Sequence | IPLLPGTDEILTFTPNAYFTGITSTSSANVYITPGDGD |
| Number of Associated Samples | 118 |
| Number of Associated Scaffolds | 139 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 79.86 % |
| % of genes from short scaffolds (< 2000 bps) | 69.06 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (47.482 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater (24.460 % of family members) |
| Environment Ontology (ENVO) | Unclassified (82.734 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (82.014 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 15.15% Coil/Unstructured: 84.85% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 139 Family Scaffolds |
|---|---|---|
| PF00041 | fn3 | 1.44 |
| PF08291 | Peptidase_M15_3 | 0.72 |
| PF02801 | Ketoacyl-synt_C | 0.72 |
| PF13385 | Laminin_G_3 | 0.72 |
| PF11351 | GTA_holin_3TM | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.52 % |
| Unclassified | root | N/A | 47.48 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000162|TB03JUN2009H_c007504 | All Organisms → Viruses → Predicted Viral | 1700 | Open in IMG/M |
| 3300000203|TB18AUG2009E_c025751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
| 3300001850|RCM37_1179989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
| 3300001851|RCM31_10362799 | Not Available | 512 | Open in IMG/M |
| 3300002091|JGI24028J26656_1001927 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4157 | Open in IMG/M |
| 3300002091|JGI24028J26656_1017527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → Bdellovibrionaceae → Bdellovibrio | 746 | Open in IMG/M |
| 3300002092|JGI24218J26658_1033820 | Not Available | 612 | Open in IMG/M |
| 3300002098|JGI24219J26650_1015394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1127 | Open in IMG/M |
| 3300002098|JGI24219J26650_1022462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → Bdellovibrionaceae → Bdellovibrio | 835 | Open in IMG/M |
| 3300002301|JGI24891J29808_1002606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2497 | Open in IMG/M |
| 3300002301|JGI24891J29808_1009340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → Bdellovibrionaceae → Bdellovibrio → Bdellovibrio bacteriovorus | 916 | Open in IMG/M |
| 3300002301|JGI24891J29808_1016643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
| 3300002307|JGI24890J29729_1005110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4177 | Open in IMG/M |
| 3300003375|JGI26470J50227_1021140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1425 | Open in IMG/M |
| 3300003814|Ga0007877_1007262 | All Organisms → Viruses → Predicted Viral | 1462 | Open in IMG/M |
| 3300004448|Ga0065861_1204948 | Not Available | 659 | Open in IMG/M |
| 3300004770|Ga0007804_1087824 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300004805|Ga0007792_10089018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → Bdellovibrionaceae → Bdellovibrio | 940 | Open in IMG/M |
| 3300004805|Ga0007792_10147060 | Not Available | 723 | Open in IMG/M |
| 3300005805|Ga0079957_1224913 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 887 | Open in IMG/M |
| 3300006103|Ga0007813_1026397 | Not Available | 1319 | Open in IMG/M |
| 3300006103|Ga0007813_1061604 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300006104|Ga0007882_10159560 | Not Available | 791 | Open in IMG/M |
| 3300006108|Ga0007862_1009635 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2277 | Open in IMG/M |
| 3300006109|Ga0007870_1086473 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300006109|Ga0007870_1116278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
| 3300006114|Ga0007815_1034897 | Not Available | 1102 | Open in IMG/M |
| 3300006114|Ga0007815_1118825 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300006115|Ga0007816_1104737 | Not Available | 620 | Open in IMG/M |
| 3300006119|Ga0007866_1008569 | All Organisms → Viruses → Predicted Viral | 2327 | Open in IMG/M |
| 3300006122|Ga0007837_1067204 | Not Available | 606 | Open in IMG/M |
| 3300006123|Ga0007852_1075847 | Not Available | 768 | Open in IMG/M |
| 3300006805|Ga0075464_10452536 | Not Available | 783 | Open in IMG/M |
| 3300007542|Ga0099846_1036950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1871 | Open in IMG/M |
| 3300008072|Ga0110929_1036677 | Not Available | 775 | Open in IMG/M |
| 3300008266|Ga0114363_1111926 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 964 | Open in IMG/M |
| 3300009152|Ga0114980_10745853 | Not Available | 547 | Open in IMG/M |
| 3300009154|Ga0114963_10391799 | Not Available | 755 | Open in IMG/M |
| 3300009155|Ga0114968_10161756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1321 | Open in IMG/M |
| 3300009158|Ga0114977_10460012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
| 3300009160|Ga0114981_10506959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
| 3300009164|Ga0114975_10044776 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2619 | Open in IMG/M |
| 3300009175|Ga0073936_10210560 | Not Available | 1363 | Open in IMG/M |
| 3300009180|Ga0114979_10381900 | Not Available | 826 | Open in IMG/M |
| 3300009181|Ga0114969_10214975 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300009183|Ga0114974_10182172 | All Organisms → Viruses → Predicted Viral | 1294 | Open in IMG/M |
| 3300009184|Ga0114976_10046771 | All Organisms → Viruses → Predicted Viral | 2565 | Open in IMG/M |
| 3300009184|Ga0114976_10175877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1188 | Open in IMG/M |
| 3300009184|Ga0114976_10570861 | Not Available | 577 | Open in IMG/M |
| 3300009185|Ga0114971_10394938 | Not Available | 786 | Open in IMG/M |
| 3300010157|Ga0114964_10041411 | All Organisms → cellular organisms → Bacteria | 2461 | Open in IMG/M |
| 3300010160|Ga0114967_10110451 | All Organisms → Viruses → Predicted Viral | 1582 | Open in IMG/M |
| 3300011184|Ga0136709_1007861 | All Organisms → Viruses → Predicted Viral | 1527 | Open in IMG/M |
| 3300012786|Ga0157527_169006 | All Organisms → Viruses → Predicted Viral | 2999 | Open in IMG/M |
| 3300013093|Ga0164296_1148488 | Not Available | 936 | Open in IMG/M |
| 3300014962|Ga0134315_1008879 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1620 | Open in IMG/M |
| 3300015050|Ga0181338_1015296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1228 | Open in IMG/M |
| 3300016693|Ga0180038_1131416 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6465 | Open in IMG/M |
| 3300017707|Ga0181363_1084425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
| 3300017716|Ga0181350_1003993 | All Organisms → Viruses → Predicted Viral | 4300 | Open in IMG/M |
| 3300017716|Ga0181350_1094690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 741 | Open in IMG/M |
| 3300017722|Ga0181347_1142674 | Not Available | 658 | Open in IMG/M |
| 3300017736|Ga0181365_1013828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2018 | Open in IMG/M |
| 3300017777|Ga0181357_1156586 | Not Available | 836 | Open in IMG/M |
| 3300017784|Ga0181348_1214370 | Not Available | 683 | Open in IMG/M |
| 3300017788|Ga0169931_10486665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 876 | Open in IMG/M |
| 3300019783|Ga0181361_106356 | Not Available | 905 | Open in IMG/M |
| 3300019784|Ga0181359_1195021 | Not Available | 657 | Open in IMG/M |
| 3300020159|Ga0211734_10832888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 796 | Open in IMG/M |
| 3300020179|Ga0194134_10057259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2107 | Open in IMG/M |
| 3300020723|Ga0214249_1016872 | All Organisms → Viruses → Predicted Viral | 1302 | Open in IMG/M |
| 3300020726|Ga0214220_1037879 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
| 3300021091|Ga0194133_10006845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13871 | Open in IMG/M |
| 3300021124|Ga0214199_1017871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 781 | Open in IMG/M |
| 3300021138|Ga0214164_1067840 | Not Available | 728 | Open in IMG/M |
| 3300021142|Ga0214192_1046411 | All Organisms → Viruses → Predicted Viral | 1366 | Open in IMG/M |
| 3300021602|Ga0194060_10510943 | Not Available | 564 | Open in IMG/M |
| 3300022752|Ga0214917_10338657 | Not Available | 649 | Open in IMG/M |
| 3300024545|Ga0256347_1095297 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
| 3300025340|Ga0208866_1001591 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1436 | Open in IMG/M |
| 3300025389|Ga0208257_1010616 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1540 | Open in IMG/M |
| 3300025413|Ga0208614_1057217 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
| 3300025420|Ga0208111_1041686 | Not Available | 746 | Open in IMG/M |
| 3300025426|Ga0208739_1052844 | Not Available | 657 | Open in IMG/M |
| 3300025428|Ga0208506_1027482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → Bdellovibrionaceae → Bdellovibrio | 1028 | Open in IMG/M |
| 3300025450|Ga0208744_1051845 | Not Available | 823 | Open in IMG/M |
| 3300025616|Ga0208613_1077567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 756 | Open in IMG/M |
| 3300025647|Ga0208160_1153383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
| 3300025778|Ga0208388_1039003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
| 3300027697|Ga0209033_1212415 | Not Available | 574 | Open in IMG/M |
| 3300027712|Ga0209499_1072021 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1362 | Open in IMG/M |
| 3300027712|Ga0209499_1137615 | Not Available | 900 | Open in IMG/M |
| 3300027741|Ga0209085_1042152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2134 | Open in IMG/M |
| 3300027759|Ga0209296_1171688 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 954 | Open in IMG/M |
| 3300027785|Ga0209246_10244547 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
| 3300027896|Ga0209777_10458439 | Not Available | 948 | Open in IMG/M |
| 3300027896|Ga0209777_10754291 | Not Available | 687 | Open in IMG/M |
| 3300028392|Ga0304729_1060209 | Not Available | 1393 | Open in IMG/M |
| 3300028394|Ga0304730_1126369 | All Organisms → Viruses → Predicted Viral | 1064 | Open in IMG/M |
| 3300031772|Ga0315288_10891738 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 807 | Open in IMG/M |
| 3300031787|Ga0315900_10239124 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1564 | Open in IMG/M |
| 3300032173|Ga0315268_12645607 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
| 3300032516|Ga0315273_11967307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 696 | Open in IMG/M |
| 3300032579|Ga0316228_1247287 | Not Available | 565 | Open in IMG/M |
| 3300032665|Ga0316221_1114755 | Not Available | 969 | Open in IMG/M |
| 3300032665|Ga0316221_1166167 | Not Available | 755 | Open in IMG/M |
| 3300032676|Ga0316229_1181760 | Not Available | 832 | Open in IMG/M |
| 3300033233|Ga0334722_10254476 | Not Available | 1289 | Open in IMG/M |
| 3300033521|Ga0316616_100015671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4765 | Open in IMG/M |
| 3300034073|Ga0310130_0147322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 720 | Open in IMG/M |
| 3300034101|Ga0335027_0144661 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1752 | Open in IMG/M |
| 3300034118|Ga0335053_0219044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1239 | Open in IMG/M |
| 3300034168|Ga0335061_0001412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12106 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 24.46% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 17.27% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 10.79% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 8.63% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 6.47% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.47% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 5.04% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.32% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.16% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.44% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.44% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.44% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater | 0.72% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.72% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.72% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 0.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.72% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.72% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.72% |
| Water Bodies | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies | 0.72% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.72% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.72% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000162 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 hypolimnion | Environmental | Open in IMG/M |
| 3300000203 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
| 3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
| 3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
| 3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
| 3300002098 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome | Environmental | Open in IMG/M |
| 3300002301 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI co-culture FSW-F8 | Environmental | Open in IMG/M |
| 3300002307 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7 | Environmental | Open in IMG/M |
| 3300002933 | Combined Assembly of freshwater hypolimnion microbial communities from Trout Bog Lake, Wisconsin, USA | Environmental | Open in IMG/M |
| 3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
| 3300003797 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07 | Environmental | Open in IMG/M |
| 3300003812 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 | Environmental | Open in IMG/M |
| 3300003814 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Jul09 | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004770 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 | Environmental | Open in IMG/M |
| 3300004805 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006103 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09 | Environmental | Open in IMG/M |
| 3300006104 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 | Environmental | Open in IMG/M |
| 3300006108 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 | Environmental | Open in IMG/M |
| 3300006109 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08 | Environmental | Open in IMG/M |
| 3300006114 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug09 | Environmental | Open in IMG/M |
| 3300006115 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 | Environmental | Open in IMG/M |
| 3300006118 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 | Environmental | Open in IMG/M |
| 3300006119 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 | Environmental | Open in IMG/M |
| 3300006122 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE31Jul07 | Environmental | Open in IMG/M |
| 3300006123 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH28Sep08 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300008072 | Microbial Communities in Water bodies, Singapore - Site MA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009175 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300011184 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG | Environmental | Open in IMG/M |
| 3300012786 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES010 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
| 3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300016693 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES036 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300019783 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
| 3300020723 | Freshwater microbial communities from Trout Bog Lake, WI - 23JUN2009 hypolimnion | Environmental | Open in IMG/M |
| 3300020726 | Freshwater microbial communities from Trout Bog Lake, WI - 31JUL2007 hypolimnion | Environmental | Open in IMG/M |
| 3300020733 | Freshwater microbial communities from Trout Bog Lake, WI - 12JUL2007 epilimnion | Environmental | Open in IMG/M |
| 3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
| 3300021124 | Freshwater microbial communities from Trout Bog Lake, WI - 04OCT2008 epilimnion | Environmental | Open in IMG/M |
| 3300021125 | Freshwater microbial communities from Trout Bog Lake, WI - 11AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300021133 | Freshwater microbial communities from Trout Bog Lake, WI - 09AUG2007 epilimnion | Environmental | Open in IMG/M |
| 3300021137 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021138 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300021142 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnion | Environmental | Open in IMG/M |
| 3300021602 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m | Environmental | Open in IMG/M |
| 3300022602 | Freshwater microbial communities from Trout Bog Lake, Vilas County, Wisconsin, United States - 30JULY2014 epilimnion | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300024545 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025340 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE20Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025382 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025389 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025391 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE08Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025413 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025420 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Aug08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025421 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025426 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025428 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH29Jul08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025450 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025487 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025616 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025778 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031759 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003P | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300032579 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18021 | Environmental | Open in IMG/M |
| 3300032665 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18007 | Environmental | Open in IMG/M |
| 3300032676 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18023 | Environmental | Open in IMG/M |
| 3300032677 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18019 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB03JUN2009H_0075045 | 3300000162 | Freshwater | TMPGPAIPLLPGTDEILTFAPNAYFTGVTTSGTAQVYISPGDGM* |
| TB18AUG2009E_0257513 | 3300000203 | Freshwater | AIPLLPGTDEILTFAPNAYFTGVTTSGTAQVYISPGDGM* |
| RCM37_11799891 | 3300001850 | Marine Plankton | SSQKSYPLLPGTDEILTFAPNWYFTGITASSTATIYVTPGDGL* |
| RCM31_103627993 | 3300001851 | Marine Plankton | TAPSIPLLPGTDEILTLPPNGFFTGITSANTAIIYMTPGDGL* |
| JGI24028J26656_10019278 | 3300002091 | Lentic | FPLLAGTDEILTFAPNAYFTGTSTANATIYITPGDGL* |
| JGI24028J26656_10175271 | 3300002091 | Lentic | LAGTDEILTFVPNAYFTGTSTANATIYITPGDGV* |
| JGI24218J26658_10338202 | 3300002092 | Lentic | SSGAAFPLLPSTDEILTFVPNAYFTGTSTANAVIYITPGDGV* |
| JGI24219J26650_10153943 | 3300002098 | Lentic | PLLAGTDEILTFAPNAYFTGTSTANAVVYITPGDGL* |
| JGI24219J26650_10224621 | 3300002098 | Lentic | GTAFPLLAGTDEILTFAPNAYFTGTSTANAVVYITPGDGM* |
| JGI24891J29808_10026067 | 3300002301 | Lentic | TSGTAFPLLAGTDEILTFAPNAYFTGTSTANATIYITPGDGL* |
| JGI24891J29808_10093402 | 3300002301 | Lentic | TTSGTAFPLLAGTDEILTFAPNAYFTGTSTANAVVYITPGDGV* |
| JGI24891J29808_10166432 | 3300002301 | Lentic | SIPLLAGTDEILTFLPNAYFTGVTGSSTAVIYITPGDGX* |
| JGI24890J29729_10051108 | 3300002307 | Lentic | TTSGTAFPLLAGTDEILTFAPNAYFTGTSTANATIYITPGDGL* |
| G310J44882_100586592 | 3300002933 | Freshwater | PNPSLGNCIPLLAGTDEILTFQPNAYFTANASVSTVIYITPGDGS* |
| JGI26470J50227_10211405 | 3300003375 | Freshwater | QSYPLLPGTDEILTFAPNWYFTGITSSGTSQIYITPGDGL* |
| JGI26470J50227_10252332 | 3300003375 | Freshwater | LGNCMPLLPGTDEIITFQPNAYFTANASTSCVLYLTSGDGS* |
| Ga0007846_10197051 | 3300003797 | Freshwater | KNCLPLLPGTDEILSFIPNAYFTANAASSCVIYITPGDGC* |
| Ga0007861_10119311 | 3300003812 | Freshwater | PLLPGTDEIITFVPNAYFSANATTGTATIYITCGDGD*Y* |
| Ga0007877_10072621 | 3300003814 | Freshwater | STTASSIPLLPGTDEILTFTPNAYFTGITSTSSANVYITPGDGD* |
| Ga0065861_12049481 | 3300004448 | Marine | RAFPLLPGTDEILTFNANQYFTGITASGTAVLYVTPGDGM* |
| Ga0007804_10878241 | 3300004770 | Freshwater | TTASSIPLLPGTDEILTFTPNAYFTGITSTSSANVYITPGDGD* |
| Ga0007792_100890183 | 3300004805 | Freshwater | TSGTAFPLLAGTDEILTFAPNAYFTGTSTANAVVYITPGDGM* |
| Ga0007792_101470601 | 3300004805 | Freshwater | TGQAFPLLPGTDEILTFVPNAYFTGYSTANAVCYITPGDGV* |
| Ga0079957_12249131 | 3300005805 | Lake | NLSIPLLAGTDEILTFPPNAYFTGITASSSAVIYITPGDGA* |
| Ga0007813_10263971 | 3300006103 | Freshwater | PLLPGTDEILTFIPNAYFTGTSTSNAVIYITPGDGM* |
| Ga0007813_10616041 | 3300006103 | Freshwater | ASSIPLLPGTDEILTFTPNAYFTGITSTSSANVYITPGDGD* |
| Ga0007882_101595602 | 3300006104 | Freshwater | GAIPLLPGTDEILTFTPNAYFTGITGSSSANVYITPGDGS* |
| Ga0007862_10096351 | 3300006108 | Freshwater | FPLLAGTDEILTFAPNAYFTGTSTANAVVYITPGDGL* |
| Ga0007870_10864731 | 3300006109 | Freshwater | SSIPLLPGTDEILTFTPNAYFTGITSTSSANVYITPGDGD* |
| Ga0007870_11162781 | 3300006109 | Freshwater | ASAYPLLSGTDEILTFAPNWYFAGITASGSATVYITPGDGL* |
| Ga0007815_10348971 | 3300006114 | Freshwater | AFPLLAGTDEILTFAPNAYFTGTSTANAVVYITPGDGV* |
| Ga0007815_11188252 | 3300006114 | Freshwater | PGTDEILTFTPNAYFTGITSTSSANVYITPGDGD* |
| Ga0007816_11047371 | 3300006115 | Freshwater | PLLPGTDEILTFTPNAYFTGITSTSSANVYITPGDGD* |
| Ga0007859_10283651 | 3300006118 | Freshwater | TTTQNNCLPLLPGTDEIITFAPNSYFSANATSSTATIYITPGDGD* |
| Ga0007866_10085695 | 3300006119 | Freshwater | VTSTGPSIVLLAGTDEILTFTTNAYFTGLTSTSTSVVYIVPGDGQ* |
| Ga0007837_10672042 | 3300006122 | Freshwater | LAGTDEILTFVPNAYFTGTSTSSAVIYITPGDGM* |
| Ga0007852_10758471 | 3300006123 | Freshwater | VSTTASSIPLLPGTDEILTFTPNAYFTGITSTSSANVYITPGDGD* |
| Ga0075464_104525361 | 3300006805 | Aqueous | LAGTDEILTFVPNAYFTGITSSSTAAVYITPGDGL* |
| Ga0099846_10369501 | 3300007542 | Aqueous | SNATVVSTSGAAFPLLPGTDEVLTFTPNAYFTAITSSSTADIYVTPGDGL* |
| Ga0110929_10366771 | 3300008072 | Water Bodies | NVAIPLLAGTDEILTFTPNVYVTGITASGTATIYVTPGDGM* |
| Ga0114363_11119261 | 3300008266 | Freshwater, Plankton | SSGQAIPLLAGTDEIITFLPNAYFTASTSSSSAVIYITPGDGS* |
| Ga0114980_107458533 | 3300009152 | Freshwater Lake | SSANCLPILPGAIEVFMFGLNSYFTGITSSGTAVVYVTPGAGI* |
| Ga0114963_103917992 | 3300009154 | Freshwater Lake | LLAGTDEILTFAPNAYFTGVTSTGSANVYITPGDGM* |
| Ga0114968_101617562 | 3300009155 | Freshwater Lake | PIIASTDEILSFVPNMYVTGITASGTAVVYITPGDGL* |
| Ga0114977_104600121 | 3300009158 | Freshwater Lake | SSQAAFPLLAGTDEILTFAPNAYFTGYSTTTAVVYITPGDGV* |
| Ga0114981_105069592 | 3300009160 | Freshwater Lake | AGTDEILTFSPNAYFTGITSSSTAVVFITPGDGS* |
| Ga0114975_100447761 | 3300009164 | Freshwater Lake | LLAGTDEILSFVPNAYFTGITGSSTAAVYITPGDGM* |
| Ga0073936_102105601 | 3300009175 | Freshwater Lake Hypolimnion | PLLAGTDEILTFQPNAYFTGITASGNATIYISPGDGL* |
| Ga0114979_103819003 | 3300009180 | Freshwater Lake | PAYPLLAGTDEILSFVPNAYFTGITGSSTAAVYITPGDGM* |
| Ga0114969_102149751 | 3300009181 | Freshwater Lake | PLLASTDEILTFIPNAYFTGTSTANATIYITPGDGV* |
| Ga0114969_105876901 | 3300009181 | Freshwater Lake | NCLPLLPGTDEILTFIPNAYFSANATSSTVIYITPGDGS* |
| Ga0114974_101821724 | 3300009183 | Freshwater Lake | ITTTGTSIPLLPGTDEVLSFVPNAYFTGITSTSTAAVYIVPGDGM* |
| Ga0114976_100467711 | 3300009184 | Freshwater Lake | VITTTGTAFPLLPGTDEILSFVPNAYFTGITSSGTATVYVTPGDGM* |
| Ga0114976_101758771 | 3300009184 | Freshwater Lake | IPLLAGTDEILTFSPNAYFTGITSSSTAVVFITPGDGS* |
| Ga0114976_105708611 | 3300009184 | Freshwater Lake | LLPGTDEILSFVPNAYFTGITSSGTATVYVTPGDGM* |
| Ga0114971_103283061 | 3300009185 | Freshwater Lake | TGTVANCLPLLPGTDEILTFIPNAFFSANATSSTTIYITPGDGS* |
| Ga0114971_103949381 | 3300009185 | Freshwater Lake | AGTDEILSFVPNAYFTGITGSSTAAVYITPGDGM* |
| Ga0114964_100414111 | 3300010157 | Freshwater Lake | IVTSTQASIPLLSGTDEILTFTPNAYFAGITSSGNATIYITPGDGV* |
| Ga0114967_101104515 | 3300010160 | Freshwater Lake | PLLPGTDEVLSFVPNAYFTGITSSGTAVVYVTCGDGM* |
| Ga0136709_10078615 | 3300011184 | Freshwater | LPGTDEILSFVPSAYFTGITATSNATVYVTPGDGM* |
| Ga0157527_1690067 | 3300012786 | Freshwater | PLLSGTDEILTFTPNAYFAGITSSGNAVIYITPGDGV* |
| Ga0164296_11484884 | 3300013093 | Freshwater | LLPGTDEILTFAPNWYFTGITSSGTSQIYITPGDGI* |
| Ga0134315_10088795 | 3300014962 | Surface Water | VSTSNVAIPLLAGTDEILTFTPNVYVTGITSSGTATIYVTPGDGM* |
| Ga0181338_10152961 | 3300015050 | Freshwater Lake | CLPLLPGTDEILTFIPNAFFSANATSSTTIYITPGDGS* |
| Ga0180038_11314169 | 3300016693 | Freshwater | VVTSTQSSIPLLSGTDEILTFTPNAYFAGITSSGNAVIYITPGDGV |
| Ga0181363_10844251 | 3300017707 | Freshwater Lake | VVSTSGAAFPLLPGTDEVLTFTPNAYFTAITSSSTADIYVTPGDGL |
| Ga0181350_10039931 | 3300017716 | Freshwater Lake | TGTSIPLLPGTDEVLSFVPNAYFTGITVSGTAAVYITCGDGM |
| Ga0181350_10946901 | 3300017716 | Freshwater Lake | AFPLLAGTDEILTFIPNAYFTGITGSSTASVYITPGDGM |
| Ga0181347_11426742 | 3300017722 | Freshwater Lake | TGTSIPLLPGTDEILSFVPNAYFTGITVSGTAAVYITCGDGL |
| Ga0181365_10138286 | 3300017736 | Freshwater Lake | TGTSIPLLPGTDEVLSFVPNAYFTGITATSNATVYVTPGDGM |
| Ga0181352_10468551 | 3300017747 | Freshwater Lake | TSSGQAMPLLAGTDEIITFLPNAYFTASTGSSTAVIYITPGDGQ |
| Ga0181352_11072601 | 3300017747 | Freshwater Lake | TSSGQAMPLLAGTDEIITFLPNAYFTASTGSSTAVIYITPGDGS |
| Ga0181343_10528793 | 3300017766 | Freshwater Lake | TVANCLPLLPGTDEILTFIPNAFFSANASSSTTIYITPGDGS |
| Ga0181357_11565862 | 3300017777 | Freshwater Lake | EDTQSSIPLLSGTDEILTFTPNAYFAGITISGNAVIYITPGDGV |
| Ga0181348_12143702 | 3300017784 | Freshwater Lake | AIPLLAGTDEILSFAPNAYFTGITGTSSAVVYITPGDGS |
| Ga0169931_104866652 | 3300017788 | Freshwater | VVTTSGEAIPLLPGTDEVLTFLPNAYFTGITATGTASVYVTPGDGL |
| Ga0181361_1063561 | 3300019783 | Freshwater Lake | IITTTGTSIPLLPGTDEVLSFVPNAYFTGITATSNATVYVTPGDGM |
| Ga0181359_11950211 | 3300019784 | Freshwater Lake | LPLLAGTDEILSFVPNAYFTGKTASGTSVIYISPGDGL |
| Ga0211734_108328881 | 3300020159 | Freshwater | GSIPLLAGTDEILTFLPNAYFTGVTGSSTAVIYITPGDGS |
| Ga0194134_100572594 | 3300020179 | Freshwater Lake | TTTLPARTIPLLPGTDEILTFTPDAWFTGATASSTAVIYITPGSGA |
| Ga0214249_10168721 | 3300020723 | Freshwater | IPLLPGTDEILTFAPNAYFTGVTTSGTAQVYISPGDGM |
| Ga0214220_10378792 | 3300020726 | Freshwater | SSIPLLPGTDEILTFTPNAYFTGITSTSSANVYITPGDGD |
| Ga0214172_10396222 | 3300020733 | Freshwater | STQANCLPLLPGTDEIITFAPNAYFSANCTTGTATLYITPGDGD |
| Ga0194133_100068451 | 3300021091 | Freshwater Lake | LLPGTDEILSFVPNAYFTGVTSSGTASIYVTPGDGL |
| Ga0214199_10178712 | 3300021124 | Freshwater | SGAAFPLLPGTDEILTFIPNAYFTGTSTSNAVIYITPGDGM |
| Ga0214211_10206531 | 3300021125 | Freshwater | VKNCLPLLPGTDEILSFIPNAYFTANAASSCVIYITAGDGC |
| Ga0214175_10217001 | 3300021133 | Freshwater | LLPGTDEIITFMPNAYFSANCVTSTATLYITPGDGD |
| Ga0214165_10712792 | 3300021137 | Freshwater | LPGTDEIITFTPNAYFSANCVTGTATIYITPGDGD |
| Ga0214164_10678403 | 3300021138 | Freshwater | TAFPLLAGTDEILTFAPNAYFTGTSTANAVVYITPGDGL |
| Ga0214192_10464114 | 3300021142 | Freshwater | PLLPGTDEILTFTPNAYFTGITGSSSANVYITPGDGS |
| Ga0194060_105109432 | 3300021602 | Anoxic Zone Freshwater | IVTSTGPAYPLLAGTDEILSFVPNSYFTGITSSGSAAIYITPGDGM |
| Ga0248169_1469221 | 3300022602 | Freshwater | PNTSLSNCIPLLPGTDEVLTFVPNAYFTANASTSTVLYITPGDGD |
| Ga0214917_103386572 | 3300022752 | Freshwater | PLLAGTDEILTFVPNSYFTGITSSGTATIYVTPGDGM |
| Ga0256347_10952971 | 3300024545 | Freshwater | TTAESIPLLAGTDEILTFTPNAYFTGVTSSSSAVVYITPGDGS |
| Ga0208866_10015911 | 3300025340 | Freshwater | SYPLLPGTDEILTFAPNWYFTGITSSGTSQIYITPGDGL |
| Ga0208256_10178042 | 3300025382 | Freshwater | ANCLPLLPGTDEIITFAPNAYFSANCTTGTATLYITPGDGD |
| Ga0208256_10454661 | 3300025382 | Freshwater | NNCLPLLPGTDEIITFMPNAYFSANCVTSTATLYITPGDGD |
| Ga0208257_10106162 | 3300025389 | Freshwater | FPLLPGTDEILTFNANQYFTGITASGTAVLYVTPGDGM |
| Ga0208740_10483971 | 3300025391 | Freshwater | LGNCIPLLAGTDEILTFQPNAYFTANASVSTVIYITPGDGS |
| Ga0208614_10572171 | 3300025413 | Freshwater | PLLPSTDEILTFVPNAYFTGVSTSTAVIYITPGDGV |
| Ga0208111_10416861 | 3300025420 | Freshwater | SFTIPILPGTDEILTFLPNAYFTAVTLAGSTSVYITPGDGV |
| Ga0207958_10395681 | 3300025421 | Freshwater | LPLLPGTDEIITFAPNSYFSANATSSTATIYITPGDGD |
| Ga0208739_10528442 | 3300025426 | Freshwater | STTASSIPLLPGTDEILTFTPNAYFTGITSTSSANVYITPGDGD |
| Ga0208506_10274823 | 3300025428 | Freshwater | VTTSGTAFPLLAGTDEILTFAPNAYFTGTSTANAVVYITPGDGL |
| Ga0208744_10518451 | 3300025450 | Freshwater | LLPSTDEILTFVPNAYFTGVSTSTAVIYITPGDGV |
| Ga0208105_10252862 | 3300025487 | Freshwater | QANCLPLLPGTDEIITFAPNAYFSANCTTGTATLYITPGDGD |
| Ga0208613_10775671 | 3300025616 | Freshwater | SGTAFPLLAGTDEILTFAPNAYFTGTSTANAVVYITPGDGL |
| Ga0208160_11533832 | 3300025647 | Aqueous | PLLPGTDKIISAPPNAYFTGITSSGNAVIYVTPGEGL |
| Ga0208388_10390031 | 3300025778 | Freshwater | IPLLPGTDEILTFTPNAYFTGITSTSSANVYITPGDGD |
| Ga0209033_12124151 | 3300027697 | Freshwater Lake | SLPLLAGTDEILSFVPNAYFTGKTASGTSVIYISPGDGL |
| Ga0209499_10720211 | 3300027712 | Freshwater Lake | PAYPLLAGTDEILTFVPNAYFTGTTSTGTANIYITPGDGM |
| Ga0209499_11376152 | 3300027712 | Freshwater Lake | VVVSSSQQALPLLPGTDEILSFVPNAYFTGITSTGTAAVYVTPGDGM |
| Ga0209085_10421521 | 3300027741 | Freshwater Lake | PLLAGTDEILTFAPNAYFTGVTSTGSANVYITPGDGM |
| Ga0209296_11716883 | 3300027759 | Freshwater Lake | LPGTDEVLSFVPNAYFTGITSTSTAAVYIVPGDGM |
| Ga0209500_104453441 | 3300027782 | Freshwater Lake | CLPLLPGTDEILTFIPNAYFSANATSSTTIYITPGDGS |
| Ga0209246_102445472 | 3300027785 | Freshwater Lake | AVTSTGNSIPLLAGTDEILTFVPNAYFTGLTGSSTAVVYVTPGDGS |
| Ga0209777_104584391 | 3300027896 | Freshwater Lake Sediment | SYPLLPGTDEILTFAPNWYFTGITSSGTSQIYITPGDGI |
| Ga0209777_107542912 | 3300027896 | Freshwater Lake Sediment | QAFPLLPGTDEILTFAPNAYFTGYSTANAVCYITPGDGV |
| Ga0304729_10602093 | 3300028392 | Freshwater Lake | QPAFPLLPGTDEILTFVPNAYFTGYSSTTAIVYITPGDGV |
| Ga0304730_11263694 | 3300028394 | Freshwater Lake | PLLPGTDEVLSFVPNAYFTGITSSGTAVVYVTCGDGM |
| Ga0316219_11452641 | 3300031759 | Freshwater | LPGTDEIITFAPNAYFSANCTTGTATLYITPGDGD |
| Ga0315288_108917382 | 3300031772 | Sediment | VLPGTDKIIAAPPNAYFTGITASGTATVYITPGDGL |
| Ga0315900_102391241 | 3300031787 | Freshwater | LLAGTDEILSFVPNAYFSGVTASGNAVIYVSAGDGL |
| Ga0315289_110057571 | 3300032046 | Sediment | CLPLLPGTDEILTFIPNAFFSANASSSTTIYITPGDGS |
| Ga0315268_107919234 | 3300032173 | Sediment | CLPLLPGTDEILTFIPNAFFSANATSSTTIYITPGDGS |
| Ga0315268_126456072 | 3300032173 | Sediment | GTSIPLLPGTDEILSFVPNAYFTGITVSGTAAVYITCGDGM |
| Ga0315273_119673072 | 3300032516 | Sediment | SSQKGYPVLPGTDKIIAAPPNAYFTGITASGTATVYITPGDGL |
| Ga0316228_12472873 | 3300032579 | Freshwater | PLLAGTDEILTFAPNWYFSGITASGSAVVYITPGDGL |
| Ga0316221_11147554 | 3300032665 | Freshwater | ISTTGQSYPLLPGTDEILTFAPNWYFTGITSSGTSQIYITPGDGI |
| Ga0316221_11661672 | 3300032665 | Freshwater | LLPGTDEILTFVPNAYFTGTSTANAVVYITVGDGV |
| Ga0316229_11817601 | 3300032676 | Freshwater | GAAFPLLPGTDEILTFVPNAYFTGTSTANAVVYITPGDGM |
| Ga0316229_12122402 | 3300032676 | Freshwater | CLPLLPGTDEIITFMPNAYFSANCVTSTATLYITPGDGD |
| Ga0316227_11618493 | 3300032677 | Freshwater | NCLPLLPGTDEIITFAPNSYFSANATSSTATIYITPGDGD |
| Ga0334722_102544761 | 3300033233 | Sediment | TTTGNSIPLLAGTDEILSFMPNAFFTGTSTANAVCYIIPGDGV |
| Ga0316616_1000156714 | 3300033521 | Soil | RAIPLLPGTDEILTFTPDAYFTGMTASSTAIVYITPGTGS |
| Ga0310130_0147322_427_534 | 3300034073 | Fracking Water | MPGTDEILTFTPDAYFTGMTASSTAIVYITPGTGS |
| Ga0335027_0144661_161_268 | 3300034101 | Freshwater | MAGTDEILTFPPNAYFSGITSTSTAVVYITPGDGA |
| Ga0335053_0219044_1125_1238 | 3300034118 | Freshwater | PLLAGTDEILTFPPNAYFSGITSTSTAVVYITPGDGA |
| Ga0335061_0001412_1_135 | 3300034168 | Freshwater | TSTAAAIPLLAGTDEILSFAPNAYFTGITGTSSAVVHITPGDGS |
| ⦗Top⦘ |