| Basic Information | |
|---|---|
| Family ID | F054659 |
| Family Type | Metagenome |
| Number of Sequences | 139 |
| Average Sequence Length | 45 residues |
| Representative Sequence | VRRPAAEKLQAWIVTGPLGHLWSALADMTVIWARYLAHRARRG |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 139 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 31.65 % |
| % of genes near scaffold ends (potentially truncated) | 28.78 % |
| % of genes from short scaffolds (< 2000 bps) | 86.33 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.964 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (33.093 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.288 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.885 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.11% β-sheet: 0.00% Coil/Unstructured: 47.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 139 Family Scaffolds |
|---|---|---|
| PF05697 | Trigger_N | 48.92 |
| PF05698 | Trigger_C | 10.07 |
| PF06305 | LapA_dom | 9.35 |
| PF01510 | Amidase_2 | 2.88 |
| PF01364 | Peptidase_C25 | 2.16 |
| PF00654 | Voltage_CLC | 1.44 |
| PF06689 | zf-C4_ClpX | 1.44 |
| PF01612 | DNA_pol_A_exo1 | 0.72 |
| PF01594 | AI-2E_transport | 0.72 |
| PF00573 | Ribosomal_L4 | 0.72 |
| PF02535 | Zip | 0.72 |
| PF10589 | NADH_4Fe-4S | 0.72 |
| PF00133 | tRNA-synt_1 | 0.72 |
| PF03781 | FGE-sulfatase | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 139 Family Scaffolds |
|---|---|---|---|
| COG0544 | FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) | Posttranslational modification, protein turnover, chaperones [O] | 58.99 |
| COG3771 | Lipopolysaccharide assembly protein YciS/LapA, DUF1049 family | Cell wall/membrane/envelope biogenesis [M] | 9.35 |
| COG0038 | H+/Cl- antiporter ClcA | Inorganic ion transport and metabolism [P] | 1.44 |
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG0088 | Ribosomal protein L4 | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG0428 | Zinc transporter ZupT | Inorganic ion transport and metabolism [P] | 0.72 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.72 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.96 % |
| Unclassified | root | N/A | 5.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_105315751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 808 | Open in IMG/M |
| 3300003267|soilL1_10095627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1456 | Open in IMG/M |
| 3300003987|Ga0055471_10025267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1466 | Open in IMG/M |
| 3300003996|Ga0055467_10148593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 700 | Open in IMG/M |
| 3300003997|Ga0055466_10184830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 609 | Open in IMG/M |
| 3300003998|Ga0055472_10036339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1182 | Open in IMG/M |
| 3300004081|Ga0063454_100246202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1066 | Open in IMG/M |
| 3300004114|Ga0062593_101035606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 845 | Open in IMG/M |
| 3300004157|Ga0062590_101709849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 641 | Open in IMG/M |
| 3300004463|Ga0063356_100555465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1537 | Open in IMG/M |
| 3300004479|Ga0062595_100986740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 722 | Open in IMG/M |
| 3300004480|Ga0062592_101042213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 751 | Open in IMG/M |
| 3300004643|Ga0062591_100121657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1747 | Open in IMG/M |
| 3300005093|Ga0062594_100028271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2519 | Open in IMG/M |
| 3300005093|Ga0062594_100695913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 916 | Open in IMG/M |
| 3300005438|Ga0070701_10850662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 626 | Open in IMG/M |
| 3300005441|Ga0070700_100038516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2914 | Open in IMG/M |
| 3300005549|Ga0070704_102190862 | Not Available | 514 | Open in IMG/M |
| 3300005578|Ga0068854_100287058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1327 | Open in IMG/M |
| 3300005981|Ga0081538_10000758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 35238 | Open in IMG/M |
| 3300006844|Ga0075428_100008251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 11548 | Open in IMG/M |
| 3300006845|Ga0075421_100396688 | All Organisms → cellular organisms → Bacteria | 1658 | Open in IMG/M |
| 3300006846|Ga0075430_100603288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 906 | Open in IMG/M |
| 3300006847|Ga0075431_100310193 | All Organisms → cellular organisms → Bacteria | 1593 | Open in IMG/M |
| 3300006847|Ga0075431_101005272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 801 | Open in IMG/M |
| 3300006880|Ga0075429_101396508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 610 | Open in IMG/M |
| 3300006894|Ga0079215_10085512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1344 | Open in IMG/M |
| 3300006894|Ga0079215_11079718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 599 | Open in IMG/M |
| 3300006918|Ga0079216_11747279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 532 | Open in IMG/M |
| 3300007004|Ga0079218_11352923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 755 | Open in IMG/M |
| 3300009094|Ga0111539_10165526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2585 | Open in IMG/M |
| 3300009094|Ga0111539_10351506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1715 | Open in IMG/M |
| 3300009094|Ga0111539_11203406 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300009094|Ga0111539_12436746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 607 | Open in IMG/M |
| 3300009100|Ga0075418_11357949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 771 | Open in IMG/M |
| 3300009148|Ga0105243_11428144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 713 | Open in IMG/M |
| 3300009156|Ga0111538_12911339 | Not Available | 599 | Open in IMG/M |
| 3300009789|Ga0126307_10043601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3490 | Open in IMG/M |
| 3300009789|Ga0126307_10077081 | All Organisms → cellular organisms → Bacteria | 2629 | Open in IMG/M |
| 3300009789|Ga0126307_10174424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1723 | Open in IMG/M |
| 3300009840|Ga0126313_10111407 | All Organisms → cellular organisms → Bacteria | 2026 | Open in IMG/M |
| 3300009840|Ga0126313_10703266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 819 | Open in IMG/M |
| 3300010036|Ga0126305_10756843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 659 | Open in IMG/M |
| 3300010037|Ga0126304_10127819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1628 | Open in IMG/M |
| 3300010038|Ga0126315_10002249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 7939 | Open in IMG/M |
| 3300010039|Ga0126309_10043377 | All Organisms → cellular organisms → Bacteria | 2116 | Open in IMG/M |
| 3300010039|Ga0126309_10686456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 656 | Open in IMG/M |
| 3300010040|Ga0126308_10137606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1532 | Open in IMG/M |
| 3300010040|Ga0126308_10379972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 940 | Open in IMG/M |
| 3300010040|Ga0126308_11324769 | Not Available | 511 | Open in IMG/M |
| 3300010041|Ga0126312_10666016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 750 | Open in IMG/M |
| 3300010042|Ga0126314_10016396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4389 | Open in IMG/M |
| 3300010044|Ga0126310_10030309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2831 | Open in IMG/M |
| 3300010044|Ga0126310_10962158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 670 | Open in IMG/M |
| 3300010045|Ga0126311_11390316 | Not Available | 585 | Open in IMG/M |
| 3300010166|Ga0126306_10111165 | Not Available | 1994 | Open in IMG/M |
| 3300010399|Ga0134127_10177141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1963 | Open in IMG/M |
| 3300010399|Ga0134127_13534018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 512 | Open in IMG/M |
| 3300010400|Ga0134122_11433230 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300010403|Ga0134123_12472130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 585 | Open in IMG/M |
| 3300012204|Ga0137374_10024698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 6717 | Open in IMG/M |
| 3300012905|Ga0157296_10203690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 633 | Open in IMG/M |
| 3300012915|Ga0157302_10171697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 755 | Open in IMG/M |
| 3300014487|Ga0182000_10350788 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300015077|Ga0173483_10089135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1262 | Open in IMG/M |
| 3300015077|Ga0173483_10924473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
| 3300015371|Ga0132258_10412182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3359 | Open in IMG/M |
| 3300018422|Ga0190265_10018596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 5484 | Open in IMG/M |
| 3300018422|Ga0190265_10288949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1705 | Open in IMG/M |
| 3300018422|Ga0190265_11123442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 906 | Open in IMG/M |
| 3300018422|Ga0190265_11216260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 872 | Open in IMG/M |
| 3300018422|Ga0190265_13056078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Janibacter → Janibacter limosus | 559 | Open in IMG/M |
| 3300018422|Ga0190265_13279008 | Not Available | 540 | Open in IMG/M |
| 3300018422|Ga0190265_13407972 | Not Available | 530 | Open in IMG/M |
| 3300018429|Ga0190272_10273244 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
| 3300018429|Ga0190272_11278984 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300018429|Ga0190272_11494127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 686 | Open in IMG/M |
| 3300018429|Ga0190272_11568960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 673 | Open in IMG/M |
| 3300018429|Ga0190272_12191430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Janibacter → Janibacter limosus | 592 | Open in IMG/M |
| 3300018432|Ga0190275_10560367 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
| 3300018432|Ga0190275_12079004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Janibacter → Janibacter limosus | 647 | Open in IMG/M |
| 3300018466|Ga0190268_10616159 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300018466|Ga0190268_12174159 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300018466|Ga0190268_12378979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Janibacter → Janibacter limosus | 502 | Open in IMG/M |
| 3300018469|Ga0190270_10012231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 4928 | Open in IMG/M |
| 3300018476|Ga0190274_11205630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Janibacter → Janibacter limosus | 841 | Open in IMG/M |
| 3300018920|Ga0190273_12114857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 526 | Open in IMG/M |
| 3300019361|Ga0173482_10123919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 972 | Open in IMG/M |
| 3300019767|Ga0190267_10597756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 682 | Open in IMG/M |
| 3300019867|Ga0193704_1042438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 903 | Open in IMG/M |
| 3300021078|Ga0210381_10412213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
| 3300022883|Ga0247786_1031547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1033 | Open in IMG/M |
| 3300022898|Ga0247745_1033114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 777 | Open in IMG/M |
| 3300025901|Ga0207688_10030219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2987 | Open in IMG/M |
| 3300025919|Ga0207657_11460063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 512 | Open in IMG/M |
| 3300025937|Ga0207669_10505070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 968 | Open in IMG/M |
| 3300025945|Ga0207679_11823704 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300026041|Ga0207639_12212164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 511 | Open in IMG/M |
| 3300026075|Ga0207708_10637745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 906 | Open in IMG/M |
| 3300026121|Ga0207683_10532023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1086 | Open in IMG/M |
| 3300027873|Ga0209814_10065306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1526 | Open in IMG/M |
| 3300027880|Ga0209481_10191416 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300027907|Ga0207428_11144840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
| 3300028587|Ga0247828_10123335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1262 | Open in IMG/M |
| 3300028705|Ga0307276_10018405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. CPCC 204708 | 1343 | Open in IMG/M |
| 3300028705|Ga0307276_10079891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 767 | Open in IMG/M |
| 3300028707|Ga0307291_1090908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 757 | Open in IMG/M |
| 3300028717|Ga0307298_10236147 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300028719|Ga0307301_10054712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1232 | Open in IMG/M |
| 3300028721|Ga0307315_10136159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 740 | Open in IMG/M |
| 3300028722|Ga0307319_10022601 | All Organisms → cellular organisms → Bacteria | 1929 | Open in IMG/M |
| 3300028722|Ga0307319_10070263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1108 | Open in IMG/M |
| 3300028755|Ga0307316_10356617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 539 | Open in IMG/M |
| 3300028755|Ga0307316_10402850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Janibacter → Janibacter limosus | 507 | Open in IMG/M |
| 3300028778|Ga0307288_10374985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Janibacter → Janibacter limosus | 576 | Open in IMG/M |
| 3300028811|Ga0307292_10225647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 774 | Open in IMG/M |
| 3300028812|Ga0247825_10048958 | All Organisms → cellular organisms → Bacteria | 2808 | Open in IMG/M |
| 3300028878|Ga0307278_10182899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 936 | Open in IMG/M |
| 3300028880|Ga0307300_10162518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 708 | Open in IMG/M |
| 3300028881|Ga0307277_10170925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 947 | Open in IMG/M |
| 3300030336|Ga0247826_11342446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 577 | Open in IMG/M |
| 3300031152|Ga0307501_10011654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1488 | Open in IMG/M |
| 3300031152|Ga0307501_10088723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 763 | Open in IMG/M |
| 3300031152|Ga0307501_10199100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 572 | Open in IMG/M |
| 3300031548|Ga0307408_101263119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 691 | Open in IMG/M |
| 3300031548|Ga0307408_102432668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 509 | Open in IMG/M |
| 3300031731|Ga0307405_12003954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 518 | Open in IMG/M |
| 3300031824|Ga0307413_10448804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1023 | Open in IMG/M |
| 3300031852|Ga0307410_10261132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1351 | Open in IMG/M |
| 3300031852|Ga0307410_10726127 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300031901|Ga0307406_10062969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2401 | Open in IMG/M |
| 3300031901|Ga0307406_12017899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Janibacter → Janibacter limosus | 516 | Open in IMG/M |
| 3300031995|Ga0307409_101214429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 778 | Open in IMG/M |
| 3300032002|Ga0307416_101266294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 843 | Open in IMG/M |
| 3300032002|Ga0307416_102748498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 588 | Open in IMG/M |
| 3300032080|Ga0326721_10328230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 863 | Open in IMG/M |
| 3300032126|Ga0307415_102397875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neworleansense | 519 | Open in IMG/M |
| 3300033550|Ga0247829_11295224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 603 | Open in IMG/M |
| 3300034176|Ga0364931_0329480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 509 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 33.09% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 13.67% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.79% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 8.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.04% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.88% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.88% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.44% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.44% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.44% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.72% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.72% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.72% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
| 3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
| 3300003997 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 | Environmental | Open in IMG/M |
| 3300003998 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
| 3300022898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5 | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032080 | Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1053157512 | 3300000364 | Soil | VRRPLTEKLQAWIVTGPLGHLWSALADMTLIWARYLAHRAKRS* |
| soilL1_100956272 | 3300003267 | Sugarcane Root And Bulk Soil | LAAVRRPATERLQAWIVTGPLGHLWSALTDMVLIWARYLAYRARGRA* |
| Ga0055471_100252674 | 3300003987 | Natural And Restored Wetlands | RRTAAERLQAWIVTGPLGHLWSALTDMVLIWARYLLHRARGRA* |
| Ga0055467_101485931 | 3300003996 | Natural And Restored Wetlands | KAHERFTAWVVTGPAGHLWSALADMAIIWARWLARRARRGLSRGAG* |
| Ga0055466_101848302 | 3300003997 | Natural And Restored Wetlands | VKARDSATAWIVTGPIGHLWSALADMTLIWVRYLAHRARGGAR* |
| Ga0055472_100363392 | 3300003998 | Natural And Restored Wetlands | VKARDSATAWIVTGPLGHLWSALADMTLIWVRYLAHRARGGAR* |
| Ga0063454_1002462021 | 3300004081 | Soil | AEQLRAWIVTGPIGHLWSAIADITLLWARYLANRARGRV* |
| Ga0062593_1010356062 | 3300004114 | Soil | LPPVLRRPAAEKLQAWIVTGPLGHLWSALADVTIIWARYVMNRARGRV* |
| Ga0062590_1017098492 | 3300004157 | Soil | LPQVLRRPASEKLHAWIVTGPLGHLWSALTDMILIWARYLAHRARGRA* |
| Ga0063356_1005554652 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VAPVRRPVAEKLRAWIVTGPIGHLWSALADMALIWARYLAHRARRG* |
| Ga0062595_1009867403 | 3300004479 | Soil | LAPVSRPAAEKLHAWVITGPLGHLWSAGADITLIWARYLAHRARMRGAR* |
| Ga0062592_1010422132 | 3300004480 | Soil | VRRPVTEKLQAWIVTGPLGHLWSALADMTLIWVRYLAHRARRS* |
| Ga0062591_1001216572 | 3300004643 | Soil | MRGASLPSVRRPAAEKLQAWIVTGPLGHLWSALADMTVIWARYLAHRARRG* |
| Ga0062594_1000282712 | 3300005093 | Soil | LPPVRRPAAEKLHAWIVTGPLGHLWSALADMSIIWARYLANRARGRV* |
| Ga0062594_1006959132 | 3300005093 | Soil | LPLVRRPLAEKLQAWVVTGPLGHLWSAMADIVLLWARYFANRARGRA* |
| Ga0070701_108506621 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | VRRPAAEKLHAWIVTGPLGHLWSALADMSIIWARYLANRARGR |
| Ga0070700_1000385162 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | LPRVLRRTASEKLQAWIVTGPLGHLWSALADMILIWARYLAHRARGRA* |
| Ga0070704_1021908621 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VAPVRRPAAEKLHAWIVTGPIGHLWSALTDMALIWARYLAR |
| Ga0068854_1002870582 | 3300005578 | Corn Rhizosphere | LPPVRRPPAEKLQAWIVTGPLGHLWSALADMSIIWARYLANRARGRV* |
| Ga0081538_1000075825 | 3300005981 | Tabebuia Heterophylla Rhizosphere | VRRRPPEQLKAWFVTGPIGHLWSVLADITVLLVRYGVWRLRGRRA* |
| Ga0075428_1000082514 | 3300006844 | Populus Rhizosphere | LPRVRRPAAEKLQAWIVTGPLGHLWSALADMAVIWARYLAHRARRG* |
| Ga0075421_1003966882 | 3300006845 | Populus Rhizosphere | VRRRPAAEQLQAWIVTGPIGHFWSAMADITLIWARYLANRMRGRV* |
| Ga0075430_1006032882 | 3300006846 | Populus Rhizosphere | VRRTAAERLQAWIVTGPLGHLWSALADMVLIWARYLPHRARGRA* |
| Ga0075431_1003101932 | 3300006847 | Populus Rhizosphere | VRRRPAAEQLQAWIVTGPIGHFWSAMTDITLLWARYLANRLRGRV* |
| Ga0075431_1010052722 | 3300006847 | Populus Rhizosphere | VRRTAAERLQAWIVTGPLGHLWSALADMVLIWARYLVHRARGRA* |
| Ga0075429_1013965082 | 3300006880 | Populus Rhizosphere | LVKAQERFSAWLVTGPLGHLWSALTDMILIWARYLAHRARGRA* |
| Ga0079215_100855122 | 3300006894 | Agricultural Soil | VRRTAAERLQAWIVTGPLGHLWSALTDMVLIWARYLAHRARRRV* |
| Ga0079215_110797182 | 3300006894 | Agricultural Soil | MRRPATERLQAWIVTGPLGHLWSALADMTAIWARWLVNRARGRA* |
| Ga0079216_117472792 | 3300006918 | Agricultural Soil | VRRTAAERLHAWILTGPLGHLWSALTDMVLIWARYLANRARGRV* |
| Ga0079218_113529232 | 3300007004 | Agricultural Soil | VRRTAAERLQAWIVTGPLGHLWSALTDMVLIWARYLAHRAR |
| Ga0111539_101655263 | 3300009094 | Populus Rhizosphere | LRAVRRRPVAEQLRAWIVTGPIGHLWSAMADITLLWTRYLANRVRGRV* |
| Ga0111539_103515063 | 3300009094 | Populus Rhizosphere | VLRRPASEKLQAWIVTGPLGHLWSSLTDMVLIWMRYLAHRARGRA* |
| Ga0111539_112034062 | 3300009094 | Populus Rhizosphere | VRRRLAAEQLQAWIVTGPIGHFWSAMTDITLLWARYLANRLRGRV* |
| Ga0111539_124367462 | 3300009094 | Populus Rhizosphere | VRRTAVERLQAWIVTGPLGHLWSALTDMILIWARYLAHRARGRV* |
| Ga0075418_113579492 | 3300009100 | Populus Rhizosphere | VLRRPASEKLQAWIVTGPLGHLWSALADIAVALARYGFSRLR |
| Ga0105243_114281442 | 3300009148 | Miscanthus Rhizosphere | LTSVRRPVTEKLQAWIVTGPLGHLWSALADMTLIWVRYLAHRARRG* |
| Ga0111538_129113392 | 3300009156 | Populus Rhizosphere | RPVTEKLQAWIITGPLGHLWSALADMTLIWVRYLAHRARRS* |
| Ga0126307_100436015 | 3300009789 | Serpentine Soil | LVRVRRPAAEKFQAWIVTGPLGHLWSALADMTRIWVRYLAHRARRG* |
| Ga0126307_100770812 | 3300009789 | Serpentine Soil | LVRVRRPAAEKLQAWIVTGPLGHLWSALADMTLIWARYLAHRARRG* |
| Ga0126307_101744242 | 3300009789 | Serpentine Soil | MTYASRVRRRPGERLQAWIVTGPLGHLWSALADMTLIWVRYLAHRARGG* |
| Ga0126313_101114074 | 3300009840 | Serpentine Soil | VRRPAAEKLQAWIVTGPIGHLWSALADMALIWARYLAHRARRG* |
| Ga0126313_107032662 | 3300009840 | Serpentine Soil | VRRPAAEKLQAWIVTGPLGHLWSALADMAVIWARYLARRARRG* |
| Ga0126305_107568432 | 3300010036 | Serpentine Soil | LVRVRRPAAEKFQAWIVTGPLGHLWSALVDMTRIWVRYLAHRARRG* |
| Ga0126304_101278193 | 3300010037 | Serpentine Soil | MTYASRVRRRPGERLQAWIVTGPLGHLWSALADMTPIWVRYLAHRA |
| Ga0126315_100022495 | 3300010038 | Serpentine Soil | VRRRPAAEQLQAWIVTGPIGHLWSAMVDITLIWARYLANRVRGRA* |
| Ga0126309_100433772 | 3300010039 | Serpentine Soil | VRRPAAEQLQAWIVTGPLGHLWSAGADITLIWARYVANRARGRT* |
| Ga0126309_106864562 | 3300010039 | Serpentine Soil | VRRPVTEKLQAWIVTGPLGHLWSALADMTLIWVRYLAHRARRG* |
| Ga0126308_101376064 | 3300010040 | Serpentine Soil | SLRAVRRRPAAEQLQAWIVTGPIGHFWSAMTDITLIWARYLANRVRGRV* |
| Ga0126308_103799722 | 3300010040 | Serpentine Soil | VRRAAAERLQAWIVTGPLGHLWSALADMVLIWARYLAHRARRRV* |
| Ga0126308_113247692 | 3300010040 | Serpentine Soil | VRRAASDRVQAWIVTGPIGHLWSAGADITLIWARYFANRARRRA* |
| Ga0126312_106660162 | 3300010041 | Serpentine Soil | VRRPAAEKLQAWIVTGPLGHLWSALADMAAIWARYLARRARRG* |
| Ga0126314_100163962 | 3300010042 | Serpentine Soil | VRRRPAAEQLQAWIVTGPIGHLWSAMVDITLIWARYLAKRVRGRA* |
| Ga0126310_100303093 | 3300010044 | Serpentine Soil | VRRRPPAEQVQAWIVTGPLGHLWSALADMTIIWARYIANRARGRV* |
| Ga0126310_109621581 | 3300010044 | Serpentine Soil | VAPVRRPAAEKLQAWIVTGPIGHLWSALADMALIWARYLA |
| Ga0126311_113903162 | 3300010045 | Serpentine Soil | LRAVRRRPAAEQLQAWIVTGPIGHFWSAMTDITLIWARYLANRVRGRV* |
| Ga0126306_101111652 | 3300010166 | Serpentine Soil | VRRRPAAEQLQAWIVTGPIGHLWSAMLDITLIWARYLANRVRGRV* |
| Ga0134127_101771413 | 3300010399 | Terrestrial Soil | LPLVRRPLAEKLQAWVVTGPLGHLWSAMADIVLLWARYFTNRARGCA* |
| Ga0134127_135340181 | 3300010399 | Terrestrial Soil | VRRPVTEKLQAWIVTGPLGHLWSALADMTLIWARYLAHRARRG* |
| Ga0134122_114332302 | 3300010400 | Terrestrial Soil | LPWVRRRPAAERLQAWIVTGPLGHLWSALADVTIIWTRYLVNRARGRAQ* |
| Ga0134123_124721302 | 3300010403 | Terrestrial Soil | LPFVRRPITEKLQAWIVTGPLGHLWSALADMTLIWVRYLAHRARRS* |
| Ga0137374_100246984 | 3300012204 | Vadose Zone Soil | VAPVRRPAAEKLEAWIVTGPIGHLWSAVADMAVIWVRYLAHRARRG* |
| Ga0157296_102036902 | 3300012905 | Soil | VRRPAAEKLQAWIVTGPLGHLWSALADMTVIWARYLAHRARRG* |
| Ga0157302_101716972 | 3300012915 | Soil | LPPVRRPPAEKLQAWIVTGPLGHLWSALADMSIIWARYLANRARGRG* |
| Ga0182000_103507882 | 3300014487 | Soil | CSGVSVAPVRRPAAEKLQAWIVTGPIGHLWSALADMALIWARYLAHRARRG* |
| Ga0173483_100891352 | 3300015077 | Soil | LPPVRRPAAEKLQAWIVTGPLGHLWSALADMSIIWARYLANRARGRV* |
| Ga0173483_109244732 | 3300015077 | Soil | LPPVLRRPAAEKLQAWIVTGPLGHLWSALADVTIIWARYVMNR |
| Ga0132258_104121823 | 3300015371 | Arabidopsis Rhizosphere | VRRRPVAEQLRAWIVTGPIGHLWSAMADITLLWTRYLANRVRGRV* |
| Ga0190265_100185963 | 3300018422 | Soil | LVRVRRPAAEKLQAWIVTGPLGHLWSALADMTLIWVRYLAHRARRS |
| Ga0190265_102889492 | 3300018422 | Soil | MTYASRVRRPPGERLQAWIVTGPLGHLWSALADMTLIWVRYLAHRARGG |
| Ga0190265_111234422 | 3300018422 | Soil | MRRPATERLQAWIVTGPLGHLWSALADMTAIWTRWLVHRARGRA |
| Ga0190265_112162603 | 3300018422 | Soil | VRRSPAEKLRAWIVTGPLGHLWSALADMALLWARYLAHRARRRISRGAG |
| Ga0190265_130560781 | 3300018422 | Soil | VRRPAAEKLKAWIVTGPLGHLWSALADMTLIWVRYLAHRARGG |
| Ga0190265_132790081 | 3300018422 | Soil | RPAAEKAVAWIVTGPLGHLWSALADMTAIWARYLVNRARGRA |
| Ga0190265_134079721 | 3300018422 | Soil | VRRPATEKLQAWVVTGPLGHLWSALADMALLWARYLAHRARRRISRGAG |
| Ga0190272_102732441 | 3300018429 | Soil | MGLMTYASRVRRRPGERLRAWVLTGPLGHLWSALADMTLIWVRYLAHRARRG |
| Ga0190272_112789841 | 3300018429 | Soil | LVRVRRPAAEKLQAWIVTGPLGHLWSALADMTLIWVRYL |
| Ga0190272_114941272 | 3300018429 | Soil | LARVRRPVAEKLQAWIVTGPLGHLWSALADMAVIWARYLAHRARRG |
| Ga0190272_115689602 | 3300018429 | Soil | MGLMAYASRVRRRPGERLRAWVLTGPLGHLWSALADMTLIWVRYLAHRARRG |
| Ga0190272_121914302 | 3300018429 | Soil | GRVMTYASRVRRPPGERLQAWIVTGPLGHLWSALADMTLIWVRYLAHRARGG |
| Ga0190275_105603671 | 3300018432 | Soil | VRRPAAEKLQAWMVTGPLGHLWSALADMTVLWVRYLAQRARRG |
| Ga0190275_120790041 | 3300018432 | Soil | LLRVHRPAVEKLQAWIVTGPLGHLWSALADMTLIWVRYLAHRARGG |
| Ga0190268_106161591 | 3300018466 | Soil | RLQAWIVTGPIGHLWSALADMILIWARYLVHRARGRA |
| Ga0190268_121741593 | 3300018466 | Soil | VRRPSAERLQAWIVTGPLGHLWSALADMALIWARYLAHRARRG |
| Ga0190268_123789791 | 3300018466 | Soil | VKAHERFTAWVVTGPLGHFWSAAADMATIWARWLAHRARGRA |
| Ga0190270_100122315 | 3300018469 | Soil | VKPLDRARAWLVTGPLGHLWSALVDMTLIWARYLAHRARAGAR |
| Ga0190274_112056301 | 3300018476 | Soil | VRRPAAEKLHAWIVTGPLGHLWSALADMTVIWARYLAHRARRG |
| Ga0190273_121148572 | 3300018920 | Soil | LVRVRRPAAEKLQAWIVTGPLGHLWSALADMTLIWVRYLAHRARRD |
| Ga0173482_101239192 | 3300019361 | Soil | LPPVRRPAAEKLHAWIVTGPLGHLWSALADMSIIWARYLANRARGRV |
| Ga0190267_105977561 | 3300019767 | Soil | LPRVLRRTASEKLQAWIVTGPLGHLWSALADMTLIWTRWLANRARGRV |
| Ga0193704_10424382 | 3300019867 | Soil | VAPVRRPVAEKLHAWIVTGPIGHLWSALADMTLIWARYLVHRARRG |
| Ga0210381_104122131 | 3300021078 | Groundwater Sediment | LPPVRRPATEKLHAWIVTGPLGHLWSALADMAVIWARYLAHRARRG |
| Ga0247786_10315471 | 3300022883 | Soil | LPPVRRPAAEKLHAWIVTGPLGHLWSALADMSIIWAR |
| Ga0247745_10331142 | 3300022898 | Soil | LPPVRRPAAEKLQAWIVTGPLGHLWSALADMSIIWARYLANRARGRV |
| Ga0207688_100302194 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | LPRVLRRTASEKLQAWIVTGPLGHLWSALADMILIWARYLAHRARGRA |
| Ga0207657_114600632 | 3300025919 | Corn Rhizosphere | LPRVLRRPASEKLQAWIVTGPLGHLWSSLTDVVLIWARYLANRARGRV |
| Ga0207669_105050702 | 3300025937 | Miscanthus Rhizosphere | LPLVRRPLAEKLQAWVVTGPLGHLWSAMADIVLLWARYFANRARGRA |
| Ga0207679_118237041 | 3300025945 | Corn Rhizosphere | ASEKLQAWIVTGPLGHLWSSLTDVVLIWARYLANRARGRV |
| Ga0207639_122121641 | 3300026041 | Corn Rhizosphere | VRRPAAEKLHAWIVTGPLGHLWSALADMSIIWARY |
| Ga0207708_106377451 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | LPFVRRPITEKLQAWIVTGPLGHLWSALADMTLIWVR |
| Ga0207683_105320231 | 3300026121 | Miscanthus Rhizosphere | LPLVRRPLAEKLQAWVVTGPLGHLWSAMADIVLLWA |
| Ga0209814_100653062 | 3300027873 | Populus Rhizosphere | LPRVRRPAAEKLQAWIVTGPLGHLWSALADMAVIWARYLAHRARRG |
| Ga0209481_101914162 | 3300027880 | Populus Rhizosphere | VRRRPAAEQLQAWIVTGPIGHFWSAMADITLIWARYLANRMRGRV |
| Ga0207428_111448402 | 3300027907 | Populus Rhizosphere | VRRRPVAEQLRAWIVTGPIGHLWSAMADITLLWTRYLANRV |
| Ga0247828_101233352 | 3300028587 | Soil | LPRVLRRTASEKLQAWIVTGPLGHLWSALTDMILIWARYLAHRARGRA |
| Ga0307276_100184053 | 3300028705 | Soil | LRAVPRRPAAERLQAWIVTGPIGHLWSALADMTLIWSRYLANRARGRV |
| Ga0307276_100798912 | 3300028705 | Soil | VRRPVTEKLQAWIVTGPLGHLWSALADMTLIWVRYLAHRARRG |
| Ga0307291_10909081 | 3300028707 | Soil | VAPVRRPVAEKLHAWIVTGPIGHLWSALADMTLIWARYLVHRAR |
| Ga0307298_102361472 | 3300028717 | Soil | RRPVTEKLQAWIVTGPLGHLWSALADMTLIWVRYLAHRARRG |
| Ga0307301_100547122 | 3300028719 | Soil | VAPVRRPVAEKLHAWIVTGPIGHLWSALADMTLIWVRYLAHRARRG |
| Ga0307315_101361592 | 3300028721 | Soil | VRRPVTEKLQAWIVTGPLGHLWSALADMTLIWARYLA |
| Ga0307319_100226014 | 3300028722 | Soil | VIAYASNVRRGPGERLQAWIVTGPLGHLWSALADMTLIWVRYLAHRARRG |
| Ga0307319_100702632 | 3300028722 | Soil | LPQVLRRPASEKLHAWIVTGPLGHLWSALTDMILIWARYLAHRARGRA |
| Ga0307316_103566172 | 3300028755 | Soil | MRGASLPSVRRPAAEKLQAWIVTGPLGHLWSALADMTVIWA |
| Ga0307316_104028502 | 3300028755 | Soil | LPQVLRRPASEKLHAWIVTGPLGHLWSALTDMILIWARYLVHRARGRA |
| Ga0307288_103749851 | 3300028778 | Soil | RRPVAEQLQAWIVTGPVGHLWSATADITLIWTRYLANRARGRV |
| Ga0307292_102256472 | 3300028811 | Soil | LPPVRRRPVAEQLQAWIVTGPVGHLWSATADITLIWTRYLANRARGRV |
| Ga0247825_100489585 | 3300028812 | Soil | VAEQLRAWIVTGPIGHLWSAMADITLLWTRYLANRVRGRV |
| Ga0307278_101828992 | 3300028878 | Soil | VAPVRRPAAEKLHAWIVTGPLGHLWSALADMALIWARYLAHRARRGQS |
| Ga0307300_101625182 | 3300028880 | Soil | VAPVRRPVAEKLHAWIVTGPIGHLWSALADMTLIWARYL |
| Ga0307277_101709251 | 3300028881 | Soil | VAPVRRPAAEKLQAWIVTGPIGHLWSALADMALIWARYLAHRARRG |
| Ga0247826_113424462 | 3300030336 | Soil | LTSVRRPVTEKLQAWIVTGPLGHLWSALADMTLIWVRYLAHRARRS |
| Ga0307501_100116542 | 3300031152 | Soil | VRRRPAAEQLQGWIVTGPLGHLWSALADMTLIWARYLANRARGRV |
| Ga0307501_100887232 | 3300031152 | Soil | LRRVRRSAAEKLQAWIVTGPLGHLWSALADMTLIWVRYLAHRARRS |
| Ga0307501_101991001 | 3300031152 | Soil | VRRPVTEKLQAWIVTGPLGHLWSALADMTLIWVRYLVHRARRG |
| Ga0307408_1012631191 | 3300031548 | Rhizosphere | VRRPVTEKLQAWIVTGPLGHLWSALADMTLIWVRYLA |
| Ga0307408_1024326682 | 3300031548 | Rhizosphere | VRRAAAERLQAWIVTGPLGHLWSALADMVLIWARYLAHRARRRV |
| Ga0307405_120039542 | 3300031731 | Rhizosphere | LPYVRRPAAEKLQAWIVTGPLGHLWSALADMAVIWARY |
| Ga0307413_104488042 | 3300031824 | Rhizosphere | VRRPVTEKLQAWIVTGPLGHLWSALADITLIWVRYLAHRARRG |
| Ga0307410_102611321 | 3300031852 | Rhizosphere | LPYVRRPAAEKLQAWIVTGPLGHLWSALADMAVIWARYLAHRARRG |
| Ga0307410_107261272 | 3300031852 | Rhizosphere | EKLQAWIVTGPLGHLWSALADMAVIWARYLAHRARRG |
| Ga0307406_100629692 | 3300031901 | Rhizosphere | VRRTAAERLQAWIVTGPLGHLWSALADMVLIWVRYLAHRARGRA |
| Ga0307406_120178992 | 3300031901 | Rhizosphere | VRRPAAEKLEAWIVTGPLGHLWSALADMAVIWARYLAHRARRG |
| Ga0307409_1012144292 | 3300031995 | Rhizosphere | VPPVRRPAAEKLQAWIVTGPIGHLWSALADMALIWARYLARRARRG |
| Ga0307416_1012662942 | 3300032002 | Rhizosphere | VRRAAAERLQAWIVTGPLGHLWSALADMVLIWARYLA |
| Ga0307416_1027484981 | 3300032002 | Rhizosphere | MRGASLPSVRRPAAEKLEAWIVTGPLGHLWSALADMAVIWARYLAHRARRG |
| Ga0326721_103282302 | 3300032080 | Soil | VRRTAAERLQAWILTGPLGHLWSALADMVLIWARYLANRARGRV |
| Ga0307415_1023978752 | 3300032126 | Rhizosphere | GVSLPSVRRPVTEKLQAWIVTGPLGHRWSALADMTLIWVRYLAHRARRG |
| Ga0247829_112952242 | 3300033550 | Soil | VLRRTASEKLQAWIVTGPLGHLWSALTDMILIWVRYLAHRA |
| Ga0364931_0329480_252_383 | 3300034176 | Sediment | VRRPAAEKLQAWIVTGPLGHLWSALADMTVIWARYLAHRARRG |
| ⦗Top⦘ |