| Basic Information | |
|---|---|
| Family ID | F054635 |
| Family Type | Metagenome |
| Number of Sequences | 139 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MTLTAKDVAEITRLLEDSSFDELHLEIDGLKLHLKRGAA |
| Number of Associated Samples | 122 |
| Number of Associated Scaffolds | 139 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.24 % |
| % of genes near scaffold ends (potentially truncated) | 93.53 % |
| % of genes from short scaffolds (< 2000 bps) | 87.05 % |
| Associated GOLD sequencing projects | 120 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.245 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (24.460 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.058 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.568 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.40% β-sheet: 17.91% Coil/Unstructured: 62.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 139 Family Scaffolds |
|---|---|---|
| PF01326 | PPDK_N | 90.65 |
| PF00391 | PEP-utilizers | 8.63 |
| PF16177 | ACAS_N | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 139 Family Scaffolds |
|---|---|---|---|
| COG0574 | Phosphoenolpyruvate synthase/pyruvate phosphate dikinase | Carbohydrate transport and metabolism [G] | 90.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.24 % |
| Unclassified | root | N/A | 5.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000881|JGI10215J12807_1127967 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300001471|JGI12712J15308_10053821 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101406040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. SYK-6 | 591 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10038441 | All Organisms → cellular organisms → Bacteria | 1775 | Open in IMG/M |
| 3300003999|Ga0055469_10099561 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300004145|Ga0055489_10218692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. SYK-6 | 597 | Open in IMG/M |
| 3300004463|Ga0063356_103612920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. SYK-6 | 666 | Open in IMG/M |
| 3300005179|Ga0066684_10919258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 570 | Open in IMG/M |
| 3300005340|Ga0070689_102082857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. SYK-6 | 519 | Open in IMG/M |
| 3300005365|Ga0070688_101429532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. SYK-6 | 561 | Open in IMG/M |
| 3300005367|Ga0070667_100515986 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300005466|Ga0070685_11561245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. SYK-6 | 510 | Open in IMG/M |
| 3300005529|Ga0070741_11489914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. SYK-6 | 558 | Open in IMG/M |
| 3300005529|Ga0070741_11542175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. SYK-6 | 546 | Open in IMG/M |
| 3300005538|Ga0070731_10611820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 725 | Open in IMG/M |
| 3300005541|Ga0070733_10355625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. SYK-6 | 972 | Open in IMG/M |
| 3300005591|Ga0070761_10113829 | All Organisms → cellular organisms → Bacteria | 1567 | Open in IMG/M |
| 3300005610|Ga0070763_10670697 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300005764|Ga0066903_103719084 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300005842|Ga0068858_100819558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. SYK-6 | 908 | Open in IMG/M |
| 3300005842|Ga0068858_102400823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. SYK-6 | 521 | Open in IMG/M |
| 3300005844|Ga0068862_101545711 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300006102|Ga0075015_100704709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. SYK-6 | 599 | Open in IMG/M |
| 3300006876|Ga0079217_10912305 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300009147|Ga0114129_10358063 | All Organisms → cellular organisms → Bacteria | 1931 | Open in IMG/M |
| 3300009147|Ga0114129_13458439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300009700|Ga0116217_10535108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 734 | Open in IMG/M |
| 3300009792|Ga0126374_10666449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 778 | Open in IMG/M |
| 3300010048|Ga0126373_10105205 | All Organisms → cellular organisms → Bacteria | 2617 | Open in IMG/M |
| 3300010361|Ga0126378_11945075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 670 | Open in IMG/M |
| 3300010371|Ga0134125_12312160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 584 | Open in IMG/M |
| 3300010376|Ga0126381_100766429 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
| 3300010376|Ga0126381_104731037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300010376|Ga0126381_104897216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300010398|Ga0126383_12155854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 644 | Open in IMG/M |
| 3300012207|Ga0137381_10401902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1195 | Open in IMG/M |
| 3300012209|Ga0137379_11595002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 551 | Open in IMG/M |
| 3300012362|Ga0137361_10854616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 826 | Open in IMG/M |
| 3300012931|Ga0153915_12642009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 587 | Open in IMG/M |
| 3300012971|Ga0126369_10227628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Erythrobacter/Porphyrobacter group → Erythrobacter → unclassified Erythrobacter → Erythrobacter sp. SG61-1L | 1819 | Open in IMG/M |
| 3300012977|Ga0134087_10770834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300014839|Ga0182027_11491982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. SYK-6 | 665 | Open in IMG/M |
| 3300015356|Ga0134073_10133276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 769 | Open in IMG/M |
| 3300017959|Ga0187779_10051936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Erythrobacter/Porphyrobacter group → Erythrobacter → unclassified Erythrobacter → Erythrobacter sp. SG61-1L | 2392 | Open in IMG/M |
| 3300017961|Ga0187778_10195681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. SYK-6 | 1287 | Open in IMG/M |
| 3300017973|Ga0187780_11179467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 561 | Open in IMG/M |
| 3300017975|Ga0187782_10812052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 723 | Open in IMG/M |
| 3300018009|Ga0187884_10332475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 613 | Open in IMG/M |
| 3300018058|Ga0187766_10405603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 902 | Open in IMG/M |
| 3300018062|Ga0187784_10794395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 755 | Open in IMG/M |
| 3300018086|Ga0187769_10029157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 3732 | Open in IMG/M |
| 3300018433|Ga0066667_10871532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 772 | Open in IMG/M |
| 3300018481|Ga0190271_11879213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 710 | Open in IMG/M |
| 3300020582|Ga0210395_10883952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. SYK-6 | 664 | Open in IMG/M |
| 3300021178|Ga0210408_10559142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 908 | Open in IMG/M |
| 3300021560|Ga0126371_11433387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 821 | Open in IMG/M |
| 3300025911|Ga0207654_10397248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 958 | Open in IMG/M |
| 3300025920|Ga0207649_10710358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 780 | Open in IMG/M |
| 3300025920|Ga0207649_11373304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300025923|Ga0207681_11825247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300025931|Ga0207644_10000984 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 18201 | Open in IMG/M |
| 3300025940|Ga0207691_10473867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1064 | Open in IMG/M |
| 3300026316|Ga0209155_1001815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 9927 | Open in IMG/M |
| 3300026322|Ga0209687_1195430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 626 | Open in IMG/M |
| 3300026332|Ga0209803_1219641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 675 | Open in IMG/M |
| 3300026547|Ga0209156_10255992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 809 | Open in IMG/M |
| 3300027676|Ga0209333_1088568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 846 | Open in IMG/M |
| 3300027842|Ga0209580_10280780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 829 | Open in IMG/M |
| 3300027867|Ga0209167_10237664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 976 | Open in IMG/M |
| 3300027965|Ga0209062_1090166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Erythrobacter/Porphyrobacter group → Erythrobacter → unclassified Erythrobacter → Erythrobacter sp. SG61-1L | 1316 | Open in IMG/M |
| 3300028381|Ga0268264_12304911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300029910|Ga0311369_10148739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2260 | Open in IMG/M |
| 3300031170|Ga0307498_10423856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300031226|Ga0307497_10136675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1002 | Open in IMG/M |
| 3300031236|Ga0302324_102400703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 647 | Open in IMG/M |
| 3300031543|Ga0318516_10463568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 728 | Open in IMG/M |
| 3300031544|Ga0318534_10234299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1059 | Open in IMG/M |
| 3300031546|Ga0318538_10541191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 631 | Open in IMG/M |
| 3300031564|Ga0318573_10721577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300031713|Ga0318496_10208835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1074 | Open in IMG/M |
| 3300031719|Ga0306917_10302629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1235 | Open in IMG/M |
| 3300031724|Ga0318500_10516549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 601 | Open in IMG/M |
| 3300031747|Ga0318502_10031450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2684 | Open in IMG/M |
| 3300031751|Ga0318494_10670357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300031768|Ga0318509_10122508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Parvularculales → Parvularculaceae → Marinicaulis → Marinicaulis flavus | 1419 | Open in IMG/M |
| 3300031769|Ga0318526_10356335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300031770|Ga0318521_10171212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1242 | Open in IMG/M |
| 3300031770|Ga0318521_10384213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 835 | Open in IMG/M |
| 3300031779|Ga0318566_10106833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Parvularculales → Parvularculaceae → Marinicaulis → Marinicaulis flavus | 1376 | Open in IMG/M |
| 3300031781|Ga0318547_10452329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 791 | Open in IMG/M |
| 3300031781|Ga0318547_10823631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 578 | Open in IMG/M |
| 3300031792|Ga0318529_10020987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Erythrobacter/Porphyrobacter group → Erythrobacter → unclassified Erythrobacter → Erythrobacter sp. SG61-1L | 2606 | Open in IMG/M |
| 3300031798|Ga0318523_10570126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300031821|Ga0318567_10393098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 785 | Open in IMG/M |
| 3300031846|Ga0318512_10038228 | All Organisms → cellular organisms → Bacteria | 2093 | Open in IMG/M |
| 3300031846|Ga0318512_10289143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 813 | Open in IMG/M |
| 3300031854|Ga0310904_10704382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 699 | Open in IMG/M |
| 3300031858|Ga0310892_11177729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300031912|Ga0306921_10418092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1564 | Open in IMG/M |
| 3300031918|Ga0311367_12173947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 533 | Open in IMG/M |
| 3300031947|Ga0310909_10286500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Parvularculales → Parvularculaceae → Marinicaulis → Marinicaulis flavus | 1379 | Open in IMG/M |
| 3300031947|Ga0310909_10920622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 717 | Open in IMG/M |
| 3300031954|Ga0306926_10364387 | All Organisms → cellular organisms → Bacteria | 1786 | Open in IMG/M |
| 3300032001|Ga0306922_11272592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 745 | Open in IMG/M |
| 3300032005|Ga0307411_10366006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1181 | Open in IMG/M |
| 3300032017|Ga0310899_10238548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 821 | Open in IMG/M |
| 3300032041|Ga0318549_10142604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1064 | Open in IMG/M |
| 3300032043|Ga0318556_10243968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 938 | Open in IMG/M |
| 3300032043|Ga0318556_10707666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300032044|Ga0318558_10704835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300032052|Ga0318506_10191133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 902 | Open in IMG/M |
| 3300032055|Ga0318575_10322962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 781 | Open in IMG/M |
| 3300032059|Ga0318533_10358762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1062 | Open in IMG/M |
| 3300032067|Ga0318524_10030867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2472 | Open in IMG/M |
| 3300032075|Ga0310890_10595440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 855 | Open in IMG/M |
| 3300032076|Ga0306924_10277103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1926 | Open in IMG/M |
| 3300032076|Ga0306924_11510029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. SYK-6 | 712 | Open in IMG/M |
| 3300032091|Ga0318577_10296717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 773 | Open in IMG/M |
| 3300032094|Ga0318540_10203068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 955 | Open in IMG/M |
| 3300032261|Ga0306920_102607725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 693 | Open in IMG/M |
| 3300032783|Ga0335079_11053498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 826 | Open in IMG/M |
| 3300032805|Ga0335078_10660329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1305 | Open in IMG/M |
| 3300032805|Ga0335078_10997067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 992 | Open in IMG/M |
| 3300032805|Ga0335078_12068125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 606 | Open in IMG/M |
| 3300032892|Ga0335081_11987631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. SYK-6 | 621 | Open in IMG/M |
| 3300032896|Ga0335075_10643803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1035 | Open in IMG/M |
| 3300032955|Ga0335076_10470526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1140 | Open in IMG/M |
| 3300033134|Ga0335073_10909633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 925 | Open in IMG/M |
| 3300033158|Ga0335077_10593398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1157 | Open in IMG/M |
| 3300034115|Ga0364945_0113612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 799 | Open in IMG/M |
| 3300034151|Ga0364935_0093953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 916 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.46% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.47% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.47% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.76% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.16% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.16% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.16% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.16% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.44% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.44% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.44% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.44% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.44% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.44% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.44% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.44% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.72% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.72% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.72% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.72% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.72% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.72% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.72% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.72% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004145 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015258 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1Da | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027965 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
| 3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10215J12807_11279671 | 3300000881 | Soil | VTLTAREIAEITRLLEDSSFDELHLEIDGLKLHLRRGS |
| JGI12712J15308_100538212 | 3300001471 | Forest Soil | VSLTAKDVAEITRLLEASHFDELYLELDGLKLSLTRGSPANA |
| JGIcombinedJ26739_1014060402 | 3300002245 | Forest Soil | MTLTAKDVAEIMRLLEQSSFDTLSLEIDGVKLNLQRGSPAPLR |
| JGIcombinedJ51221_100384411 | 3300003505 | Forest Soil | VTLTAKDVAEITRLLEESDFDELYLELDGMTLSLRRTGSAELADETAS |
| Ga0055469_100995613 | 3300003999 | Natural And Restored Wetlands | VTLTAREVAEITRLLEDSNFDELHLEIDGLKLHLKRGNAASTEPLPG |
| Ga0055489_102186922 | 3300004145 | Natural And Restored Wetlands | VTLTARDVAEIERLLEESTFDELHLEIDGLKLSLKRHGTGPTAAAA |
| Ga0063356_1036129202 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTLTARDVAEITRLLEDSSFDELELEIDGLKIHLRRGSGNGDIP |
| Ga0066684_109192581 | 3300005179 | Soil | VPLTAEDVAEITRLLEESQFDELHLEHAGFKLTLKRGAAL |
| Ga0070689_1020828571 | 3300005340 | Switchgrass Rhizosphere | MSLTARDIAEITRLLEDSSFDELQLEIDGLKIHLRRSGAP |
| Ga0070688_1014295321 | 3300005365 | Switchgrass Rhizosphere | MSLTARDVAEITKLLEDSSFDELDLEIDGLKIHLRRSGAP |
| Ga0070667_1005159861 | 3300005367 | Switchgrass Rhizosphere | VTLTAKDVAEITRLLEESTFDELYLELDGVKLSLKRNGAA |
| Ga0070685_115612452 | 3300005466 | Switchgrass Rhizosphere | MTLTARDIAEITRLLEDSSFDELELEIDGLKIHLRRNGDI |
| Ga0070741_114899142 | 3300005529 | Surface Soil | VTLTAKEVAEITRLLEESSFDEMDLELDGLRLTLRRHG |
| Ga0070741_115421752 | 3300005529 | Surface Soil | VTLTAKDVAQITRLLEDSSFDEMILELDGLKLTLRRQGA |
| Ga0070731_106118202 | 3300005538 | Surface Soil | LSLTSKDVAEITRILEESSFDELYLEINGFKLTLKRT |
| Ga0070733_103556252 | 3300005541 | Surface Soil | VTLTSKDVAEITRLLEQSAFTELQLEIDGLKISLKRDAAG |
| Ga0070761_101138291 | 3300005591 | Soil | VSLTSKDVAEITRILEESSFDELYLEINGFKLTLKRSGAASSN |
| Ga0070763_106706972 | 3300005610 | Soil | VSLTAKDVAEITRLLEASHFDELYLELDGLKLSLTRGSPANAP |
| Ga0066903_1037190842 | 3300005764 | Tropical Forest Soil | VPLTAQDVAEITRLLEESEFDELHIEHEGLKLTLRRHA |
| Ga0068858_1008195582 | 3300005842 | Switchgrass Rhizosphere | MTLTARDIAEITRLLEDSSFDELELEIDGLKIHLR |
| Ga0068858_1024008231 | 3300005842 | Switchgrass Rhizosphere | MTLTARDIAEITRLLEDSSFDELELEIDGLKIHLRRNGDIPRFL |
| Ga0068862_1015457112 | 3300005844 | Switchgrass Rhizosphere | VSLTSKDIAEITRLLEDSSFDELELEIAGLKVHLRRGASAL |
| Ga0075019_108569432 | 3300006086 | Watersheds | VSLTSADVAEIMRLVEQSVFDELHLEIDGIKLNLRRGAASSGPATLVAASPPT |
| Ga0075015_1007047091 | 3300006102 | Watersheds | MTLTAKDVAEIMRLLEESNFDSLALEINGIKLNLQRGSAAPVSPAPE |
| Ga0079217_109123052 | 3300006876 | Agricultural Soil | VTLTAREIAEITRLLEESSFDELHLEIDGLKLHLKRGST |
| Ga0114129_103580631 | 3300009147 | Populus Rhizosphere | VTLTAREIAEITRLLEDSSFDELHLEIDGLKLHLRRGSPAP |
| Ga0114129_134584391 | 3300009147 | Populus Rhizosphere | VTLTAREIAEITRLLEDSNFDELRLEIDGLKLHLKR |
| Ga0105092_102996091 | 3300009157 | Freshwater Sediment | VTITARDVAEITRLLEDSSFDELHLEIDGLKLHLKRGAAVPGQPTTDSAA |
| Ga0116217_105351081 | 3300009700 | Peatlands Soil | LTLTAKDVAEIMRILEESSFDQLTLEMDGVKLSLQRGSALPQV |
| Ga0126374_106664491 | 3300009792 | Tropical Forest Soil | VPLTAQDVAEITRLLEESDFLELRIEHEGFKLTLKRAAPAGGE |
| Ga0126373_101052051 | 3300010048 | Tropical Forest Soil | LTLTSKDVAEIIRILEESSFDELTLEIDGVKLSLQRGSGLRPTPN |
| Ga0126378_119450752 | 3300010361 | Tropical Forest Soil | MTLTAKDVAEIMRLLEESSFDSLSLEINGIKLNLQRG |
| Ga0134125_123121602 | 3300010371 | Terrestrial Soil | VPLTAQDVAEILRLLEESDFLELRIEHEGLKLTLRRAGARDADTA |
| Ga0126381_1007664291 | 3300010376 | Tropical Forest Soil | LTLTAKDVAEIIRILEESSFDELTLEIDGVKLSLQRGSG |
| Ga0126381_1047310372 | 3300010376 | Tropical Forest Soil | VPLTAQDVAEITRLLEESEFDELHIEHEGLKLTLKRNAAR |
| Ga0126381_1048972161 | 3300010376 | Tropical Forest Soil | LTLTAKDVAEILRLLEESSFDELSLELEGVKLKLQRGSGRP |
| Ga0126383_121558542 | 3300010398 | Tropical Forest Soil | VPLTAQDVAEIMRLLEESDFLELRIEHEGLKLTLRR |
| Ga0137381_104019022 | 3300012207 | Vadose Zone Soil | VTLTAKDVAEITRLLEESNFDELYLELDGLKLSLRRGSAADIQPL |
| Ga0137379_115950022 | 3300012209 | Vadose Zone Soil | VTLTAQDVAQITRLLEESNFDELYLEIDGLKLSLR |
| Ga0137361_108546162 | 3300012362 | Vadose Zone Soil | VPLTAGDVAEIVRLLEESEFDELHIEQDGLKLTLKRGSAPTAPGA |
| Ga0153915_126420092 | 3300012931 | Freshwater Wetlands | VSLTAKDVAEIMRLLEDSSFDTLDLEVGDMRLSLRRGEGGIAA |
| Ga0126369_102276281 | 3300012971 | Tropical Forest Soil | VPLTAKDVAEITRLLEQSDFLELRLEHEGFKLTLRRAGARTQG |
| Ga0134087_107708342 | 3300012977 | Grasslands Soil | VPLSAQDVAEITRLLEESEFDELHLEHEGFKLTLKRGAAARN |
| Ga0182027_114919822 | 3300014839 | Fen | VTLTAKDVQEIMRLLESSSFDSLSLEMNGVKLHLERGSTAAPAQQ |
| Ga0180093_10763211 | 3300015258 | Soil | VTLTAKDVAEITRLLEDSSFDELHLEIDGLKLDLKRGAPVPAQPATDSAAV |
| Ga0134073_101332762 | 3300015356 | Grasslands Soil | VPLSAQDVAEITRLLEESEFDELHLEHEGFKLTLKRGAAARNTA |
| Ga0187779_100519363 | 3300017959 | Tropical Peatland | VPLTAKDVAEITRLLEESDFLELRLEHEGFKLTLKRAGAR |
| Ga0187778_101956812 | 3300017961 | Tropical Peatland | MTLTAKDVAEIMRLLESSGFDSLSLEINGVKLNLQRGSAAPVRQTTPVAIAPP |
| Ga0187780_111794671 | 3300017973 | Tropical Peatland | VTLTAKDVAEITRLLEESSFDELYLELDGLKLSLRRGGGAGST |
| Ga0187782_108120521 | 3300017975 | Tropical Peatland | VSLTSKEVAEITRLLEDSSFDELHLEIDGLTLKLRRAAAASPA |
| Ga0187782_110039131 | 3300017975 | Tropical Peatland | VPLTAQDVAEITRLLEQSDFLELRIEHEGFKLILRRRGARTDLSAVTSAAAAADA |
| Ga0187884_103324752 | 3300018009 | Peatland | LTLTAKDVAEIMRLLEDSSFDSLSLEIDGMKLHLQ |
| Ga0187766_104056032 | 3300018058 | Tropical Peatland | VTLTAKDVAEIMRLLEESSFDSLSLEIGGVKLNLQRGSAAPVRQVSAPAAA |
| Ga0187784_107943951 | 3300018062 | Tropical Peatland | MTLTAKDVAEIMRLLEQSSFDSLSLEIDGVKLHLQRGSAAPA |
| Ga0187769_100291574 | 3300018086 | Tropical Peatland | MTLTAKDVAEIMRLLEQSSFDSLSLEIDGVKLNLQRGSAVPVHQAPAAAAPQ |
| Ga0066667_108715322 | 3300018433 | Grasslands Soil | VPLSAQDVAEITRLLEESEFDELHLEHEGFKLTLKRG |
| Ga0190271_118792131 | 3300018481 | Soil | VSLTARDIAEITRLLEDSSFDELELEIDGLKIHLVRS |
| Ga0210395_108839521 | 3300020582 | Soil | VTLTAKDVAEIMRLLEQSSFDSLSIEIDGVKLNLQRGSAAPVQRAVVAAPS |
| Ga0210408_105591421 | 3300021178 | Soil | VTLTARDVAEITRLLEESDFDELHLEHEGFRLTLRRGAGGARAP |
| Ga0126371_114333871 | 3300021560 | Tropical Forest Soil | VPLTAQDVAEITRLLEESDFLELRIEHEGFKLTLKRAAPAGGEA |
| Ga0207654_103972482 | 3300025911 | Corn Rhizosphere | VPLSAADVAEIARLLEESDFEELHVEQDGLKLTLRRGA |
| Ga0207649_107103582 | 3300025920 | Corn Rhizosphere | MTLTARDVAEITRLLEDSSFDELELEIDGLKIHLRRGSGNGDI |
| Ga0207649_113733042 | 3300025920 | Corn Rhizosphere | VTLTAKDVAEIMRLLEDSSFDELDLQVGDLKLNLRRGSPLPRPTGGPP |
| Ga0207681_118252471 | 3300025923 | Switchgrass Rhizosphere | MTLTARDVAEITRLLEDSSFDELELEIDGLKIHLRRGSGNG |
| Ga0207650_104895631 | 3300025925 | Switchgrass Rhizosphere | VTLTAKDVAEITRLLEESNFDELYLELDGLKLSLRHGSAGAAQPLGNSDGP |
| Ga0207644_100009841 | 3300025931 | Switchgrass Rhizosphere | VTLTAKDVAEITRLLEESNFDELYLELDGLKLSLRRGSA |
| Ga0207691_104738672 | 3300025940 | Miscanthus Rhizosphere | VTLTAREIAEITRLLEESSFDELHLEIDGLKLHLRRGSPAP |
| Ga0207691_115954542 | 3300025940 | Miscanthus Rhizosphere | MTLTARDIAEITRLLEDSSFDELELEIDGLKIHLRRNGDIPRFLA |
| Ga0209155_10018151 | 3300026316 | Soil | VPLSAQDVAEITRLLEESEFDELHLEHEGFKLTLKRGAAVRREG |
| Ga0209687_11954301 | 3300026322 | Soil | VPLSAQDVAEITRLLEESEFDELHLEHEGFKLTLKR |
| Ga0209803_12196411 | 3300026332 | Soil | VPLTAGDVAEIVRLLEGSEFDELHIEQDGLKLTLKRGSAP |
| Ga0209156_102559921 | 3300026547 | Soil | VPLTAGDVAEILRLLEESEFDELHIEQDGLKLTLKRGSAPRGKGAET |
| Ga0209333_10885682 | 3300027676 | Forest Soil | VSLTSKEVAEITRLLEDSSFDELYLELGDLKLSLKRSAAAPDSTDALV |
| Ga0209998_100051274 | 3300027717 | Arabidopsis Thaliana Rhizosphere | VTLTAREIAEITRLLEDSSFDELHLEIDGLKLHLRRRSTAPPQMVDDSAVAGV |
| Ga0209580_102807802 | 3300027842 | Surface Soil | MPLTAQDVAEITRLLEESEFDELYLEQDGLKLFTRHDR |
| Ga0209167_102376641 | 3300027867 | Surface Soil | VTLTSKDVAEITRLLEQSAFTELQLEIDGLKISLKRDAA |
| Ga0209062_10901663 | 3300027965 | Surface Soil | MTLTAKDVAEILRLLDSSSFDTLSLEMNGVKLNLQRGSAAPVRQSAAPAP |
| Ga0268264_123049112 | 3300028381 | Switchgrass Rhizosphere | VTLTAREIAEITRLLEESSFDELHLEIDGLKLHLRRGSPAPPQMVD |
| Ga0311369_101487391 | 3300029910 | Palsa | VTLTSKDVAEITRLLEESTFTELQLEVDGLKISLRRGAA |
| Ga0307498_104238562 | 3300031170 | Soil | MSLTARDIAEITRLLEDSSFDELDLEIDGLKIHLVRS |
| Ga0307497_101366751 | 3300031226 | Soil | MSLTARDIAEITRLLEDSSFDELDLEIDGLKIHLR |
| Ga0302324_1012809562 | 3300031236 | Palsa | VTLTSKDVAEITRLLEDSTFTELHLEIDGLKISLRRGAPPPSTPTATGAERAETRP |
| Ga0302324_1024007031 | 3300031236 | Palsa | VTLTSKDVAEITRLLEESTFTELHLEIDGLKISLRRGAPSSSGPST |
| Ga0318516_104635682 | 3300031543 | Soil | VPLTAQDVAEITRLLEESDFLELRLEHEGFKLTLKRAAVA |
| Ga0318534_102342992 | 3300031544 | Soil | VPLTAQDVAEITRLLEESDFLELRLEHEGFKLTLKRAAVASEAGA |
| Ga0318538_105411911 | 3300031546 | Soil | VPLTAKDVAEIMRLLEESDFLELRLEHEGFKLTLKRAVVG |
| Ga0318573_107215771 | 3300031564 | Soil | VPLTAKDVAEIMRLLEESDFLELRLEHEGFKLTLKRAGARNAGTDD |
| Ga0318496_102088352 | 3300031713 | Soil | VPLTAQDVAEITRLLEESDFLELRLEHEGFKLTLKRAA |
| Ga0306917_103026291 | 3300031719 | Soil | VPLTAKDVAEITRLLEESDFIELRLEHEGFKLTLKRAG |
| Ga0318500_105165492 | 3300031724 | Soil | VPLTAQDVAEIVRLLEKSDFLELRIEHEGLKLTLKRAGARDADTA |
| Ga0318502_100314503 | 3300031747 | Soil | VPLTAQDVAEITRLLEESDFLELRIEHEGFKLTLKRAP |
| Ga0318494_106703572 | 3300031751 | Soil | VPLTARDVAEIARLLEESDFEELHIEHEGFKLTLKRGAAARSESA |
| Ga0318509_101225083 | 3300031768 | Soil | VPLTAQDVAEITRLLEESDFLELRIEHEGFKLTLKRAGARGARTD |
| Ga0318526_103563352 | 3300031769 | Soil | VPLTAQDVAEILRLLEESDFLELRIEHEGLKLTLR |
| Ga0318521_101712122 | 3300031770 | Soil | VPLTAQDVAEITRLLEESDFLELRIEHEGFKLTLK |
| Ga0318521_103842132 | 3300031770 | Soil | VPLTAKDVAEIMRLLEESDFLELRLEHEGFKLTLKRAG |
| Ga0318566_101068333 | 3300031779 | Soil | VPLTAKDVAEIMRLLEESDFLELRLEHEGFKLTLKRAGAR |
| Ga0318547_104523292 | 3300031781 | Soil | VPLTAKDVAEITRLLEGSDFLELRLEHEGFKLTLKRAGSSLP |
| Ga0318547_108236312 | 3300031781 | Soil | VPLTAQDVAEITRLLEESDFLELRIEHEGMKLTLKRAGARGAL |
| Ga0318529_100209871 | 3300031792 | Soil | VPLTAKDVAEITRLLEESDFIELRLEHEGFKLTLKRAGAPRS |
| Ga0318523_105701261 | 3300031798 | Soil | VPLTAQDVAEITRLLEESDFLELRIEHEGMKLTLKRAGA |
| Ga0318567_103930981 | 3300031821 | Soil | VPLTAQDVAEITRLLEESDFLELRIEHEGFKLTLKRAGARG |
| Ga0318512_100382283 | 3300031846 | Soil | VPLTAQDVAEITRLLEESDFLELRIEHEGMKLTLK |
| Ga0318512_102891431 | 3300031846 | Soil | VPLTAQDVAEITRLLEESDFLELRIEHEGFKLTLKR |
| Ga0310904_107043822 | 3300031854 | Soil | VTLTAREIAEITRLLEESSFDELHLEIDGLKLHLRRGSPAPPQMVDDS |
| Ga0310892_111777292 | 3300031858 | Soil | MTLTARDIAEITRLLEDSSFDELELELDGLKIHLRRNGDIPDLPAKG |
| Ga0306921_104180921 | 3300031912 | Soil | VPLTAKDVAEIMRLLEESDFLELRLEHEGFKLTLKRAGARNAGTDDRAT |
| Ga0311367_121739472 | 3300031918 | Fen | VSLTAKDVAEILKLLEDSSFNELTLDMNGVKIELR |
| Ga0310909_102865001 | 3300031947 | Soil | VPLTAQDVAEITRLLEESDFLELRIEHEGFKLTLKRAPAA |
| Ga0310909_109206222 | 3300031947 | Soil | LTLTAKDVAEILRILEESSFDQLSLEIDGVKLNLQRTSAV |
| Ga0306926_103643871 | 3300031954 | Soil | LTLTAKDVAEILRILEESSFDQLSLEIDGMKLNLQRTSAVPQAPEAPR |
| Ga0306922_112725921 | 3300032001 | Soil | VPLTAQDVAEILRLLEESDFLELRIEHEGLKLTLRRAG |
| Ga0307411_103660062 | 3300032005 | Rhizosphere | MTLTARDIAEITRLLEDSSFDELELEIDGLKVHLK |
| Ga0310899_102385482 | 3300032017 | Soil | VTLTAREIAEITRLLEESSFDELHLEIDGLKLHLRRGSPAPPQMVDDSA |
| Ga0318549_101426041 | 3300032041 | Soil | VPLTAQDVAEIVRLLEKSDFLELRIEHEGLKLTLKRAGARDADTAG |
| Ga0318556_102439681 | 3300032043 | Soil | VPLTAQDVAEITRLLEESDFLELRLEHEGFKLTLKRAAVASEA |
| Ga0318556_107076662 | 3300032043 | Soil | LTLTAKDVAEILRILEESSFDQLSLEIDGMKLNLQRTSAVPQ |
| Ga0318558_107048352 | 3300032044 | Soil | VPLTAKDVAEIMRLLEESDFLELRLEHEGFKLTLK |
| Ga0318506_101911332 | 3300032052 | Soil | VPLTAKDVAEIMRLLEESDFLELRLEHEGFKLTLKRAGARNAG |
| Ga0318575_103229621 | 3300032055 | Soil | VPLTAQDVAEITRLLEESDFLELRIEHEGFKLTLKRA |
| Ga0318533_103587621 | 3300032059 | Soil | VPLTAQDVAEITRLLEESDFLELRLEHEGFKLTLK |
| Ga0318524_100308673 | 3300032067 | Soil | VPLTAKDVAEIMRLLEESDFLELRLEHEGFKLTLKRAGAQN |
| Ga0310890_105954401 | 3300032075 | Soil | MTLTARDIAEITRLLEDSSFDELELEIDGLKIHLRR |
| Ga0306924_102771031 | 3300032076 | Soil | VPLTAKDVAEIMRLLEESDFLELRLEHEGFKLTLKRAGARNAGTDDRA |
| Ga0306924_115100292 | 3300032076 | Soil | MTLTAKDVAEIMRLLEQSSFDSLSLEMNGVKLNLRRGAAVP |
| Ga0318577_102967172 | 3300032091 | Soil | VPLTAQDVAEITRLLEESDFLELRLEHEGFKLTLKR |
| Ga0318540_102030681 | 3300032094 | Soil | VPLTAQDVAEITRLLEESEFDELHIEHEGLKLTLRRRAAHY |
| Ga0306920_1026077251 | 3300032261 | Soil | LTLTAKDVAEILRILEESSFDQLSLEIDGVKLNLQRTSAVPQAPGH |
| Ga0335079_110534981 | 3300032783 | Soil | VTLTAKDVAEITRLLEDSSFDELHLEIDGLKLSLRRSGAPPTRAALGTPA |
| Ga0335078_106603293 | 3300032805 | Soil | VTLTAKDVQEIMRLLESSSFDSLSLEMNGVKLHLE |
| Ga0335078_109970671 | 3300032805 | Soil | MTFTAKDVAEIMRLLESSTFDSLSLEIDGVKLNLQRGSTSPVQPPAAAQ |
| Ga0335078_120681252 | 3300032805 | Soil | VTLTAKDVAEITRLLEDSSFDELHLEIDGLKLSLRRSGAPPTRAA |
| Ga0335081_119876311 | 3300032892 | Soil | VTLTAKDVAEIMRLLEESSFDSLSLEMGGVKLNLQRGSAAPVRQASAPAT |
| Ga0335075_106438032 | 3300032896 | Soil | VTLTAKDVAEITKLLEESSFDELSLEIDGVKLSLRRGGA |
| Ga0335076_104705261 | 3300032955 | Soil | VSLTAKDVLEITRLLEASDFTELNLEIDGLKLNLRRGSAPSEPTVAVAS |
| Ga0335073_109096331 | 3300033134 | Soil | VTLTAKDVAEIMRLLETSSFNSLSLEIDGVKLNLQRGSAVP |
| Ga0335077_105933982 | 3300033158 | Soil | MTLTAKEVAEITRLLEESSFDELNLEMEGLKLTLRR |
| Ga0364945_0113612_3_119 | 3300034115 | Sediment | MTLTAKDVAEITRLLEDSSFDELHLEIDGLKLHLKRGAA |
| Ga0364935_0093953_767_916 | 3300034151 | Sediment | MTLTAKDVAEITRLLEDSSFDELHLEIDGLKLDLKRGAPVPAQPATDSAA |
| ⦗Top⦘ |