NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F054511

Metagenome / Metatranscriptome Family F054511

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F054511
Family Type Metagenome / Metatranscriptome
Number of Sequences 139
Average Sequence Length 47 residues
Representative Sequence YGTWPWMREFVNASRLGLPAIKLWAYDHLCLFGWPVPLPTSDDRSFIY
Number of Associated Samples 92
Number of Associated Scaffolds 139

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 4.32 %
% of genes near scaffold ends (potentially truncated) 79.14 %
% of genes from short scaffolds (< 2000 bps) 79.86 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.25

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.403 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(17.986 % of family members)
Environment Ontology (ENVO) Unclassified
(58.993 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(41.007 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 35.53%    β-sheet: 0.00%    Coil/Unstructured: 64.47%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.25
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 139 Family Scaffolds
PF01832Glucosaminidase 28.78
PF12728HTH_17 2.16
PF00294PfkB 1.44
PF09369MZB 1.44
PF13361UvrD_C 1.44
PF02321OEP 1.44
PF13649Methyltransf_25 1.44
PF05014Nuc_deoxyrib_tr 0.72
PF01425Amidase 0.72
PF13614AAA_31 0.72
PF12543DUF3738 0.72
PF14534DUF4440 0.72
PF00437T2SSE 0.72
PF02518HATPase_c 0.72
PF12704MacB_PCD 0.72
PF07883Cupin_2 0.72
PF02026RyR 0.72
PF02899Phage_int_SAM_1 0.72
PF03465eRF1_3 0.72
PF13378MR_MLE_C 0.72
PF03952Enolase_N 0.72
PF00144Beta-lactamase 0.72
PF00005ABC_tran 0.72
PF00589Phage_integrase 0.72
PF00113Enolase_C 0.72
PF02954HTH_8 0.72
PF13604AAA_30 0.72
PF01966HD 0.72
PF00586AIRS 0.72
PF05598DUF772 0.72
PF05977MFS_3 0.72
PF13578Methyltransf_24 0.72
PF05362Lon_C 0.72
PF13458Peripla_BP_6 0.72
PF04471Mrr_cat 0.72
PF13091PLDc_2 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 139 Family Scaffolds
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 2.88
COG0148EnolaseCarbohydrate transport and metabolism [G] 1.44
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.72
COG0466ATP-dependent Lon protease, bacterial typePosttranslational modification, protein turnover, chaperones [O] 0.72
COG1067Predicted ATP-dependent proteasePosttranslational modification, protein turnover, chaperones [O] 0.72
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.72
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.72
COG1750Predicted archaeal serine protease, S18 familyGeneral function prediction only [R] 0.72
COG2367Beta-lactamase class ADefense mechanisms [V] 0.72
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 0.72
COG3480Predicted secreted protein YlbL, contains PDZ domainSignal transduction mechanisms [T] 0.72
COG3613Nucleoside 2-deoxyribosyltransferaseNucleotide transport and metabolism [F] 0.72
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 0.72
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 0.72


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.40 %
UnclassifiedrootN/A3.60 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000567|JGI12270J11330_10279058All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6527Open in IMG/M
3300003218|JGI26339J46600_10002925All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia5141Open in IMG/M
3300005524|Ga0070737_10043090All Organisms → cellular organisms → Bacteria2572Open in IMG/M
3300005529|Ga0070741_11696492All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6514Open in IMG/M
3300005532|Ga0070739_10328980All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6727Open in IMG/M
3300006059|Ga0075017_100116960All Organisms → cellular organisms → Bacteria1871Open in IMG/M
3300009519|Ga0116108_1255014All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6512Open in IMG/M
3300009521|Ga0116222_1450912All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6561Open in IMG/M
3300009547|Ga0116136_1049751All Organisms → cellular organisms → Bacteria1183Open in IMG/M
3300009616|Ga0116111_1002350All Organisms → cellular organisms → Bacteria11610Open in IMG/M
3300009628|Ga0116125_1236807All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6527Open in IMG/M
3300009641|Ga0116120_1112293All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium893Open in IMG/M
3300009645|Ga0116106_1218483All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6606Open in IMG/M
3300009764|Ga0116134_1128307All Organisms → cellular organisms → Bacteria → Acidobacteria903Open in IMG/M
3300009839|Ga0116223_10010900All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA66925Open in IMG/M
3300010339|Ga0074046_10040978All Organisms → cellular organisms → Bacteria → Acidobacteria3113Open in IMG/M
3300010379|Ga0136449_100926683All Organisms → cellular organisms → Bacteria1415Open in IMG/M
3300014151|Ga0181539_1197160All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3776Open in IMG/M
3300014151|Ga0181539_1307338All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6580Open in IMG/M
3300014151|Ga0181539_1327520All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6557Open in IMG/M
3300014152|Ga0181533_1009488All Organisms → cellular organisms → Bacteria → Acidobacteria7831Open in IMG/M
3300014152|Ga0181533_1049543All Organisms → cellular organisms → Bacteria2183Open in IMG/M
3300014152|Ga0181533_1309474All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6572Open in IMG/M
3300014153|Ga0181527_1021574All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales4111Open in IMG/M
3300014153|Ga0181527_1039554All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA62668Open in IMG/M
3300014153|Ga0181527_1200333Not Available834Open in IMG/M
3300014156|Ga0181518_10101821All Organisms → cellular organisms → Bacteria → Acidobacteria1603Open in IMG/M
3300014156|Ga0181518_10548242All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6543Open in IMG/M
3300014159|Ga0181530_10017176All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus5738Open in IMG/M
3300014161|Ga0181529_10238474All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA61044Open in IMG/M
3300014161|Ga0181529_10741962All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6505Open in IMG/M
3300014162|Ga0181538_10101400All Organisms → cellular organisms → Bacteria1695Open in IMG/M
3300014162|Ga0181538_10480110All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6656Open in IMG/M
3300014164|Ga0181532_10074875All Organisms → cellular organisms → Bacteria2161Open in IMG/M
3300014200|Ga0181526_10829852All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae → Hymenobacter → unclassified Hymenobacter → Hymenobacter sp. CRA2582Open in IMG/M
3300014489|Ga0182018_10182836All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA61181Open in IMG/M
3300014491|Ga0182014_10026426All Organisms → cellular organisms → Bacteria4651Open in IMG/M
3300014491|Ga0182014_10149749All Organisms → cellular organisms → Bacteria1317Open in IMG/M
3300014491|Ga0182014_10343186All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6756Open in IMG/M
3300014491|Ga0182014_10524150All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6579Open in IMG/M
3300014494|Ga0182017_10541108All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6712Open in IMG/M
3300014496|Ga0182011_10635550All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6677Open in IMG/M
3300014501|Ga0182024_10411140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea cavernae1747Open in IMG/M
3300014638|Ga0181536_10261241All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae → Hymenobacter → unclassified Hymenobacter → Hymenobacter sp. CRA2823Open in IMG/M
3300014638|Ga0181536_10377608All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6639Open in IMG/M
3300014838|Ga0182030_10232919All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium2137Open in IMG/M
3300014838|Ga0182030_10268813All Organisms → cellular organisms → Bacteria → Proteobacteria1923Open in IMG/M
3300014838|Ga0182030_10941000All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6768Open in IMG/M
3300014838|Ga0182030_11346163All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6599Open in IMG/M
3300014838|Ga0182030_11622687All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6528Open in IMG/M
3300014839|Ga0182027_10453256All Organisms → cellular organisms → Bacteria1412Open in IMG/M
3300014839|Ga0182027_10457801All Organisms → cellular organisms → Bacteria1403Open in IMG/M
3300014839|Ga0182027_10731609All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA61044Open in IMG/M
3300014839|Ga0182027_11013087All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae849Open in IMG/M
3300014839|Ga0182027_12072096All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6543Open in IMG/M
3300014839|Ga0182027_12290561All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6511Open in IMG/M
3300015371|Ga0132258_12580683All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1270Open in IMG/M
3300016750|Ga0181505_10347081All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6632Open in IMG/M
3300017929|Ga0187849_1218904All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium736Open in IMG/M
3300017931|Ga0187877_1412016All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6510Open in IMG/M
3300017941|Ga0187850_10384552All Organisms → cellular organisms → Bacteria → Acidobacteria613Open in IMG/M
3300017955|Ga0187817_11052985All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300017988|Ga0181520_11131847All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6512Open in IMG/M
3300018003|Ga0187876_1157257All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6790Open in IMG/M
3300018008|Ga0187888_1275443All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6651Open in IMG/M
3300018009|Ga0187884_10079361All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA61464Open in IMG/M
3300018014|Ga0187860_1253933All Organisms → cellular organisms → Bacteria → Acidobacteria697Open in IMG/M
3300018020|Ga0187861_10377827All Organisms → cellular organisms → Bacteria → Acidobacteria596Open in IMG/M
3300018023|Ga0187889_10082607All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1624Open in IMG/M
3300018024|Ga0187881_10169225All Organisms → cellular organisms → Bacteria → Acidobacteria943Open in IMG/M
3300018025|Ga0187885_10319472All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6701Open in IMG/M
3300018030|Ga0187869_10189433All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1009Open in IMG/M
3300018033|Ga0187867_10504110All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria666Open in IMG/M
3300018037|Ga0187883_10497693All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae → Hymenobacter → unclassified Hymenobacter → Hymenobacter sp. CRA2628Open in IMG/M
3300018037|Ga0187883_10691183All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6532Open in IMG/M
3300018040|Ga0187862_10897216All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6507Open in IMG/M
3300018043|Ga0187887_10354723All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6865Open in IMG/M
3300018043|Ga0187887_10443540All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6765Open in IMG/M
3300018043|Ga0187887_10673294All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6611Open in IMG/M
3300018043|Ga0187887_10722105All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6589Open in IMG/M
3300018043|Ga0187887_10798144All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6558Open in IMG/M
3300018044|Ga0187890_10530593All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium662Open in IMG/M
3300018044|Ga0187890_10690519All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6576Open in IMG/M
3300018057|Ga0187858_10485170All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6758Open in IMG/M
3300019788|Ga0182028_1172759All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA61161Open in IMG/M
3300019788|Ga0182028_1408646All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2116Open in IMG/M
3300023088|Ga0224555_1081295All Organisms → cellular organisms → Bacteria → Acidobacteria1062Open in IMG/M
3300023091|Ga0224559_1112484Not Available998Open in IMG/M
3300023258|Ga0224535_1025312Not Available1419Open in IMG/M
3300023258|Ga0224535_1078929Not Available726Open in IMG/M
3300024238|Ga0224523_1038710All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA61214Open in IMG/M
3300025496|Ga0208191_1126155All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6509Open in IMG/M
3300025507|Ga0208188_1007309All Organisms → cellular organisms → Bacteria3800Open in IMG/M
3300025576|Ga0208820_1013929All Organisms → cellular organisms → Bacteria → Proteobacteria2753Open in IMG/M
3300025878|Ga0209584_10289125All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6629Open in IMG/M
3300027641|Ga0208827_1003047All Organisms → cellular organisms → Bacteria6826Open in IMG/M
3300027745|Ga0209908_10166562All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6588Open in IMG/M
3300027773|Ga0209810_1035243All Organisms → cellular organisms → Bacteria2870Open in IMG/M
3300027854|Ga0209517_10016346All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA67354Open in IMG/M
3300029915|Ga0311358_11036884All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium560Open in IMG/M
3300029922|Ga0311363_11129864All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6670Open in IMG/M
3300029952|Ga0311346_10765865All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6822Open in IMG/M
3300030399|Ga0311353_11332801All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6587Open in IMG/M
3300031235|Ga0265330_10146218All Organisms → cellular organisms → Bacteria → Acidobacteria1005Open in IMG/M
3300031344|Ga0265316_10084409All Organisms → cellular organisms → Bacteria2432Open in IMG/M
3300031344|Ga0265316_10397790All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6992Open in IMG/M
3300031344|Ga0265316_11232986All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6517Open in IMG/M
3300031712|Ga0265342_10304826All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6838Open in IMG/M
3300031726|Ga0302321_101678267All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6735Open in IMG/M
3300031788|Ga0302319_10121005All Organisms → cellular organisms → Bacteria3639Open in IMG/M
3300031788|Ga0302319_11411221All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6626Open in IMG/M
3300032160|Ga0311301_10150566All Organisms → cellular organisms → Bacteria4211Open in IMG/M
3300032805|Ga0335078_10210953Not Available2685Open in IMG/M
3300032805|Ga0335078_10275197All Organisms → cellular organisms → Bacteria → Proteobacteria2280Open in IMG/M
3300032805|Ga0335078_10445775All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium1682Open in IMG/M
3300032805|Ga0335078_11076899All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6943Open in IMG/M
3300032805|Ga0335078_11766962All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6674Open in IMG/M
3300032805|Ga0335078_12112487All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6598Open in IMG/M
3300032828|Ga0335080_10895198All Organisms → cellular organisms → Bacteria → Acidobacteria910Open in IMG/M
3300032828|Ga0335080_11441592All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium683Open in IMG/M
3300032892|Ga0335081_10258089All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA22346Open in IMG/M
3300032892|Ga0335081_10887327All Organisms → cellular organisms → Bacteria1053Open in IMG/M
3300032892|Ga0335081_11381946All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300032892|Ga0335081_11413150All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6777Open in IMG/M
3300032892|Ga0335081_12205871All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans580Open in IMG/M
3300032892|Ga0335081_12419110All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6545Open in IMG/M
3300032892|Ga0335081_12523236All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300032893|Ga0335069_12436303All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6543Open in IMG/M
3300032954|Ga0335083_10767103All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6777Open in IMG/M
3300033402|Ga0326728_10049190All Organisms → cellular organisms → Bacteria → Proteobacteria6216Open in IMG/M
3300033402|Ga0326728_10374465All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31236Open in IMG/M
3300033823|Ga0334837_054521All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA61002Open in IMG/M
3300033824|Ga0334840_148835All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6617Open in IMG/M
3300033891|Ga0334811_186500All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6504Open in IMG/M
3300033977|Ga0314861_0342461All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6665Open in IMG/M
3300033977|Ga0314861_0358107All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6646Open in IMG/M
3300033982|Ga0371487_0365784All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300033983|Ga0371488_0002813All Organisms → cellular organisms → Bacteria18688Open in IMG/M
3300034282|Ga0370492_0012559All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA63466Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland17.99%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog15.11%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil12.23%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland7.19%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen7.19%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog6.47%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil5.76%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil5.04%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere3.60%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.88%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog2.88%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil2.88%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland1.44%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.44%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.72%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.72%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.72%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.72%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.72%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.72%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.72%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.72%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.72%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.72%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.72%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300003218Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1EnvironmentalOpen in IMG/M
3300005524Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005532Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009547Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40EnvironmentalOpen in IMG/M
3300009616Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100EnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009641Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014152Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaGEnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018003Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300023088Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34EnvironmentalOpen in IMG/M
3300023091Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34EnvironmentalOpen in IMG/M
3300023258Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 30-34EnvironmentalOpen in IMG/M
3300024238Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T50EnvironmentalOpen in IMG/M
3300025496Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025507Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025576Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025878Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027745Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2MEnvironmentalOpen in IMG/M
3300027773Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300029915III_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029952II_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300031235Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaGHost-AssociatedOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033823Peat soil microbial communities from Stordalen Mire, Sweden - 714 S3 30-34EnvironmentalOpen in IMG/M
3300033824Peat soil microbial communities from Stordalen Mire, Sweden - 714 S2 5-9EnvironmentalOpen in IMG/M
3300033891Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-DEnvironmentalOpen in IMG/M
3300033977Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75EnvironmentalOpen in IMG/M
3300033982Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fractionEnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M
3300034282Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12270J11330_1027905823300000567Peatlands SoilQAHCRYLMGLYYGTWPWMREFVNVSRLGLSSIKLWAYDHLCLFGWPVPIPTSDDRSFIY*
JGI26339J46600_1000292533300003218Bog Forest SoilMGLYYGTWAWLREFINASRLGLPAIKLWAYDHLCLFGWPFPLPTTDDRSFIY*
Ga0070737_1004309023300005524Surface SoilVNRLGLPAIELWAYDHLCLFAWPIPLPTTDDRSFIYR*
Ga0070741_1169649213300005529Surface SoilFVNVSRLGIPMIKLWAYDHLCRFGWPVPLPTADDRSFIY*
Ga0070739_1032898023300005532Surface SoilVNVNRLGLPAIELWAYDHLCLFAWPIPLPTTDDRSFIYR*
Ga0075017_10011696013300006059WatershedsYLMGLYYGTWPRLREFVNINRLGLPAIKLWAYDHLRLFGWPVPLPTTDDRSSIY*
Ga0116108_125501423300009519PeatlandYYGTWPWLREYVNASRLGLPVIKIWAYDHLCLFAWPVPLPTSDDRSFIY*
Ga0116222_145091223300009521Peatlands SoilTWPWLREFVNASRLGLPVIKIWAYDHLCLFGWPVPLPTTDDRSFIY*
Ga0116136_104975133300009547PeatlandWPWMREFVNASRLGLPAIKLWAYDHLCLFGWPVPLPTSDDRSFIY*
Ga0116111_1002350123300009616PeatlandLYYGTWPWLREYVNASRLGLPVIKIWAYDHLCLFGWPVPLATTDDRSFIY*
Ga0116125_123680723300009628PeatlandTWPWLREYVNARRLGLPAIKLWAYDHLCLFGWPVPMPTGDDRSFIY*
Ga0116120_111229313300009641PeatlandSRLGLPVIKLWAYDHLCLFAWPVPLPTSDDRSFIY*
Ga0116106_121848313300009645PeatlandLREFVNVSRLGLPAIKLWAYDHLCLFGWPVPLPTTDDRSFIY*
Ga0116134_112830733300009764PeatlandMGIYYGTWPWLREFVNASRLGLPVIKIWAYDHVCLFGWPVPMPTTDDRSFIY*
Ga0116223_1001090063300009839Peatlands SoilVNVNRLGLPVIKLWAYDHLCLFGWPIPLPTSDDRSFIY*
Ga0074046_1004097823300010339Bog Forest SoilMGLYYATLPWAREFVNVNRLGLPASKLWAYDHLCLFGWPVPVPTSDDRSFIY*
Ga0136449_10092668333300010379Peatlands SoilMGIYYGTWPWLREFVNASRLGLPTIKLWAYDHLCLFGWPVPLPTSDDRSFIH*
Ga0181539_119716013300014151BogWPWMREFVNINRLGLPTIKLWAYDHLCLFGWPVPLPTSDDRSFIY*
Ga0181539_130733813300014151BogRLGLPAIKIWAYDHLCLFAWPVPLPTSDDRSFIY*
Ga0181539_132752023300014151BogRLGLPAIKLWAYDHLCLFGWPIPLPKSDDSSFIY*
Ga0181533_100948833300014152BogMGLYYGTWPWLREFVNVNRLGLPSIKLWAYDHLCLFGRPVPLPTTDDRSFIY*
Ga0181533_104954333300014152BogMGLYYSTWLWLREFVNGNRLGLPAIKLWAYDHVCLFGWPIPLPTSDDRSFIY*
Ga0181533_130947413300014152BogCRYLMGIYYGTWPWLREFVNVNRLGLPSIKVWAYDHLCLFGWPVPLPTSDDRSFIY*
Ga0181527_102157443300014153BogRLGLPAIKLWAYDHVCLFGWPLPLPTSDDSSFIY*
Ga0181527_103955433300014153BogEFVNANRLGLPAIKLWAYDHVCLFGWPVPLPTSDDRSFIY*
Ga0181527_120033313300014153BogHCRYLMGLYYGTWPWLREFVNASRLGLPSIKLWAYDHLCLFGWPVPLPTSDDSSFIY*
Ga0181518_1010182113300014156BogLMGLYYGTWPWLREYVNASRLGLPAIKLWAYDHLCLFGWPVPLPTTDDRSFIY*
Ga0181518_1054824213300014156BogLMGLYYATWPWLREFVNVNRLSLPAIKIWAYDHVCLFGWPVPLPTTDDRSFIY*
Ga0181530_1001717643300014159BogMGLYYGTWPWLREFVNVNRLGLPSIKLWAYDHLCLFGWPVPLPTTDDRSFIY*
Ga0181529_1023847413300014161BogLYYATWPWLREFVNVNRLGLPTIKLWAYDHVCLFGWPVPLPTSDDTSFIY*
Ga0181529_1074196213300014161BogLREFVNASRLGIPVVKVWAYDHLCLFGWPVPLPTSDDSSFIY*
Ga0181538_1010140033300014162BogANRLGLPAIKLWAYDHLCLFGWPIPLPTGDDRSFIY*
Ga0181538_1048011023300014162BogRLGLPVIKLWAYDHLCLFAWPVPLPTSDDRSFIY*
Ga0181532_1007487513300014164BogFVNVNRLGLPSIKLWAYDHLCLFGWPVPLPTTDDRSFIY*
Ga0181526_1082985223300014200BogYYATWPWMREFVNVNRLGLPIIKLWAYDHVCLFGWPVPLPTSDDSSFIY*
Ga0182018_1018283613300014489PalsaCRYLMGLYYATWPWMREFVNINRLGLPVIKLWAYDHVCLFGWPAPLPTTDDSSFIY*
Ga0182014_1002642643300014491BogMREFVNASRLGLPAIKLWAYEHVCLFVWPIQVPKSDDSSFIY*
Ga0182014_1014974913300014491BogTWPWMREFVNASRLGLPAIKLWAYDHLCLFGWPIPLPKSDDSSFIY*
Ga0182014_1034318613300014491BogWDQAHCGYLMGLYYATWPWMREFVNINRLGLPIIKLWAYDHVCLFGWPVPLPTNDDSSFIY*
Ga0182014_1052415013300014491BogYYGTWPWLREFVNAGRLGIPVIKIWAYDHLCLFGWPVPLPTTDDRSFIY*
Ga0182017_1054110813300014494FenTWPWMREFVNASRLGLPVIKLWAYDHLCLFGWPLPLPTSDDRSFLY*
Ga0182011_1063555013300014496FenMREFVNVNRLGLPVIKLWAYDHVCLFGWPLPLPTSDDISFIY*
Ga0182024_1041114023300014501PermafrostFVNINRLGLPTIKLWAYDHVCLFGWPVPLPTSDDRSFIY*
Ga0181536_1026124133300014638BogYYGTWPWMREFVNASRLGLPAIKLWAYDHLCLFGWPVPLPTSDDRSFIY*
Ga0181536_1037760813300014638BogEFVNVNRLGLPTIKLWAYDHVCLFGWPVPLPTSDDTSFIY*
Ga0182030_1023291923300014838BogMGLYYGTWPWLREYVNVNRLGLPAIKLWAYDHVCLFGWPVPLPTTDDRSFIY*
Ga0182030_1026881343300014838BogWLREYVNATRLGLPAIKLWAYDHLCLFGWPIPLPKSDDSSFIY*
Ga0182030_1094100033300014838BogYLMGLYYGTWPWLREYVNASRLGLPVIKVWAYDHLCLFAWPVPLPTSDDRSFIY*
Ga0182030_1134616323300014838BogIYYATWPWLREFVNVNRLGLPAIKLWAYDHLCLYGWSIPLPTSDDRSFIY*
Ga0182030_1162268723300014838BogHCRYLMGLYYGTWPWMREFVNVNRLGLPAIKLWAYDHLCLFGWPVPLPTTDDRSFIY*
Ga0182027_1045325633300014839FenYYGTWPWLREYVNATRLGLPAIKLWAYDHLCLFGWPIPLPKSDDSSFIY*
Ga0182027_1045780133300014839FenYYGTWPWLREFVNANRLGLPAIKLWAYDHICLYGWPTPLPTSDGRSFIY*
Ga0182027_1073160913300014839FenHCRYLMGLYYATWPWMREFVNVNRLGLPAIKLWAYDHMCLFGWPLPLPASDDSSFIY*
Ga0182027_1101308713300014839FenSTWPWMREFVNASRIGPPAIKLWAYDHVCLFGWPVPLPTSDDSSFIY*
Ga0182027_1207209613300014839FenLCYGTWPWLREFVNASRLGLPAIKLWAYDHVCLFGWPLPLPTTDDRSFIY*
Ga0182027_1229056113300014839FenTWPWMREFVNASRIGPPAIKLWAYDHVCLFGWPLPLPTSDDSSFIY*
Ga0132258_1258068323300015371Arabidopsis RhizosphereMGLYYGSWPWLREFVSVNRLGLPAIKIWAYDHLCLFGWPVPLPTTDDRSFIY*
Ga0181505_1034708123300016750PeatlandGLYYATWPWMREFVNVNRLGLPIIKLWAYDHVCLFGWPVPLPTSDDSSFIY
Ga0187849_121890433300017929PeatlandGLYYGTWPWLREYVNASRLGLPVIKLWAYDHLCLFAWPVPLPTSDDRSFIY
Ga0187877_141201623300017931PeatlandEYVNASRLGLPIIKLWAYDHLCLFGLPLPLPTSDDRSFIY
Ga0187850_1038455213300017941PeatlandEFVNASRLGLPVIKIWAYDHVCLFGWPVPMPTTDDRSFIY
Ga0187817_1105298523300017955Freshwater SedimentYLMGLYYGTWPWLREFVNVNRLGLPSIKLWAYDHLCLFGWPIPLPTSDDRSFIY
Ga0181520_1113184713300017988BogMREFVNANRLGLPIIKLWAYDHVCLFGWPVPLPTSDDSSFIY
Ga0187876_115725713300018003PeatlandYSTWPWMREFVNASRIGPPAIKLWAYDHVCLFGWPVPLPASDDRSFIY
Ga0187888_127544313300018008PeatlandNRLGLPIIKLWAYDHVCLFGWPVPLPTSDDSSFIY
Ga0187884_1007936113300018009PeatlandTWPWMREFVNASRIGPPAIKLWAYDHVCLFGWPLPLPTSDDSSFIY
Ga0187860_125393323300018014PeatlandYYGTWPWLREFVNASRLGLPVIKIWAYDHVCLFGWPVPMPTTDDRSFIY
Ga0187861_1037782723300018020PeatlandYGTWPWLREFVNASRLGLPVIKIWAYDHVCLFGWPVPMPTTDDRSFIY
Ga0187889_1008260743300018023PeatlandAHCRYLMGLYYGTWPWLREFVNASRLGIPAIKLWAYDHLCLFGWPVPLPTSDDRSFIY
Ga0187881_1016922513300018024PeatlandYATWPWMREFVNINRLGLPIIKLWAYDHLCLFGWPVPLPTTDDRSFIY
Ga0187885_1031947223300018025PeatlandNRLGLPIIKLWAYDHVCLFGWSVPLPTRDDRSFIY
Ga0187869_1018943313300018030PeatlandQAHCRYLMGLYYGTWPWLREFVNVNRLRIPAIKLWAYDHLCLFGWPVPLPTSDDCSFIY
Ga0187867_1050411023300018033PeatlandCRYLMGLYYATWPWMREFVNVNRLGLPIIKLWAYDHVCLFGWPVPLPTSDDSSFIY
Ga0187883_1049769323300018037PeatlandAHCLYLMGLYYATWPWMREFVNVNRLGLPIIKLWAYDHVCLFGWPVPLPTSDDSSFIY
Ga0187883_1069118313300018037PeatlandVNRLGLPVIKLWAYDHLCLFGWPIPLPTSDDRSFIY
Ga0187862_1089721623300018040PeatlandYGTWPWLREFVNASRLGLPAIKLWAYDHLCLYGWPVPLPTSDDRSFIY
Ga0187887_1035472313300018043PeatlandLYYGTWPWQREFVNVNRPGLPVVKLWAYDHLCLFGWPFPLPTGDDRSFIY
Ga0187887_1044354023300018043PeatlandREFVNINRLGLPIIKLWAFDHVCLFGWPVPLPTSDDSSFIY
Ga0187887_1067329413300018043PeatlandWLREYVNASRLGLPVIKLWAYDHLCLFAWPVPLPTSDDRSFIY
Ga0187887_1072210523300018043PeatlandLMGIYYGTWPWMREFVNVNRLGLPAIKLWAHDHLCLYGWPIPLPTSDDRSFIY
Ga0187887_1079814413300018043PeatlandREFVNASRLGIPLIKVWAYDHLCLFAWPVPLPTTDDRSFIY
Ga0187890_1053059323300018044PeatlandMGLYYGTWPWLREFVSASRLGLPAIKLWAYDHLCLFGWPIPLPASDDRSFIY
Ga0187890_1069051913300018044PeatlandSRLGLPVIKLWAYDHVCLFGWPVPLPTSDDSSFIY
Ga0187858_1048517013300018057PeatlandLYYGTWPWTREFVNISGLGLPIIKLWAYDHVCLFGWPVPLPTTDDRSFIY
Ga0182028_117275913300019788FenPWLREFVNANRLGLPAIKLWAYDHLCLFGWPVPLPTSDDSSLIY
Ga0182028_140864623300019788FenVPWLREFVNVNRLGLPAIKLWAYDHVCLFGWPVPLPTSDDRSFIY
Ga0224555_108129513300023088SoilLYYGTWPWLREFVNAGRLGIPVIKIWAYDHLCLFGWPVPLPTTDDRSFIY
Ga0224559_111248433300023091SoilYLMGLYYGTWPWTREFVNASRLGVPVIKLWAYDHLCLFGWPVPLPTSDDRSFIY
Ga0224535_102531223300023258SoilRYLMGLYYATWPWMREFVNVNRLGLPAIKVWAYDHLCLFGWPIPLPTSDDRSFIY
Ga0224535_107892913300023258SoilPWMREFVNASRIGPPAIKLWAYDHVCLFGWPLPLPTSDDSSFIY
Ga0224523_103871023300024238SoilVSINRLGLPVIKLWAYDHLCLFAWPIPLPTSDDRSFIY
Ga0208191_112615523300025496PeatlandYLMGLYYSTWPWLREFVNASRLGLPAIKLWAYDHLCLFGWPVPLPMSDDSSFIY
Ga0208188_100730963300025507PeatlandHCRYLMGLYYGTWPWLREFVNASRLGIPAIKLWAYDHLCLFGWPVPLPTSDDRSFIY
Ga0208820_101392913300025576PeatlandYGTWPWMREFVNASRLGLPAIKLWAYDHLCLFGWPVPLPTSDDRSFIY
Ga0209584_1028912523300025878Arctic Peat SoilLMGLYYGTWPWLREFVNVSRLGLPAIKLWAYDHLCLFGWSLPLPTTDDRSFIY
Ga0208827_100304783300027641Peatlands SoilEFVNASRLGIPVIKIWAYDHLCLFGWPVPLPSTDDRSFIY
Ga0209908_1016656223300027745Thawing PermafrostPANRLGLPAIKLWAYDHLCLFGWPVPLPTTDDRSFIY
Ga0209810_103524333300027773Surface SoilVNRLGLPAIELWAYDHLCLFAWPIPLPTTDDRSFIYR
Ga0209517_1001634693300027854Peatlands SoilVNVNRLGLPVIKLWAYDHLCLFGWPIPLPTSDDRSFIY
Ga0311358_1103688413300029915BogMGLYYGTWSWLREFVNVSRLGLPAIKLWAYDHLCLFGWPVPLPTTDDRSFIY
Ga0311363_1112986423300029922FenQPHCRYLMGLYYGTWPWLREYVNASRLGLPAIKIWAYDHLCLFGRPVPLPTTDDRSFIY
Ga0311346_1076586513300029952BogEYVNASRLGLPAIKIWAYDHLCLFGWPVPLPTTDDRSFIY
Ga0311353_1133280113300030399PalsaREFVDASRLGLPIIKLWAYDHVCLFGWPVPLPTSDDRSFIY
Ga0265330_1014621833300031235RhizosphereWLREYVNASRLGIPAIKLWAYDHLCLFGWPVPLPTTDDRSFIY
Ga0265316_1008440923300031344RhizosphereMALSRLRLGIPVIKIWAYDHLCLFAWPVPLPTTDDRSFIY
Ga0265316_1039779023300031344RhizosphereMGLYSGAWPWLPEFVNVNRLGLPAIELWAYDDLCLFGWPVPLPTTDDRSFID
Ga0265316_1123298613300031344RhizosphereWPWLREYVNASRLGLPAIKIWAYDHLCLFAWPVPLPTSDDRSFIY
Ga0265342_1030482623300031712RhizosphereSRIGPPAIKLWAYDHVCLFGWPLPLPTSDDSSFIY
Ga0302321_10167826723300031726FenLAWDQAHCRYLMGLYYGTWPWLREFVNVTPLGVPAIKIWAYDHLCLFGWPVPLPTTDDRSFIY
Ga0302319_1012100553300031788BogCRYLMGLSYGTWPGLREFVNVNRLGLPIIKLWAYDHLCLFGWPIPLPTSDDRSFIY
Ga0302319_1141122113300031788BogLYYGTWPWLREFVNANRLGLPAIKLWAYDHLCLFGWPVPLPTSDDSSLIY
Ga0311301_1015056653300032160Peatlands SoilMGIYYGTWPWLREFVNASRLGLPTIKLWAYDHLCLFGWPVPLPTSDDRSFIH
Ga0335078_1021095313300032805SoilEFVNVSRLALPAIKLWAYDHLCLFGWPVPLPSSDDRSFIY
Ga0335078_1027519743300032805SoilNRLGLPMIKLWAYDHLCLFGWPVPLPTTDDRSFLY
Ga0335078_1044577513300032805SoilMGLYDGTWPWMREFVNASRLGLPAIKLWAYDHACLFGWPLPLPTSDDRSFIH
Ga0335078_1107689933300032805SoilSRLGLPMIKLWAYDHLCLFGWPVPLPTTDDHSFIY
Ga0335078_1176696223300032805SoilMGLYYGTWPWSRELVNVCRLGLPAIKLWAYDHLCLFGWPIPLPSSDDRSFIY
Ga0335078_1211248713300032805SoilYLMGLYYATWPWVREFVNVNRLGLPEIKLWAYDHLCLFGWPLPLPTSDDRSFIY
Ga0335080_1089519813300032828SoilGLYYATWPWLREFVNVNRLGLPAVKIWAYDHLCLFAWPVPLPTTDDRSFIY
Ga0335080_1144159213300032828SoilYLMGLYYGTWPWLREFVNVNRLGLPAIKIWAYDHLCLFGWPVPLPTTDDRSFIY
Ga0335081_1025808923300032892SoilMREFVNVDRLGLPAIKLWAYDHLCLFAWPIPLPTSDDRSFIY
Ga0335081_1088732723300032892SoilRYLMGLYYATWPWLREFVNVNRLGLPAIKIWAYDHLCLFGWPLPLPTTDDRSFIY
Ga0335081_1138194613300032892SoilDQAHSHYLMGLYYATWPWVREFVNVNRLGLPEIKLWAYDHLCLFGWPLPLPTTDDRSLIY
Ga0335081_1141315013300032892SoilYLMGLYYATWPWLREFVNVTRLGVPVIKLWAYDHVCLFAWPLPLPTSDDRSFIY
Ga0335081_1220587113300032892SoilLYYGTWPWLREFVNANRLGLPAIKLWAYDHLCLFGWTVPLPTSDDRSFIY
Ga0335081_1241911013300032892SoilGLFYATWPWMREFVNVNRLGLPAIKLWAYDHVCLFGWPLPLPTTDDRSFIY
Ga0335081_1252323613300032892SoilRYLMGLYYATWPWLREFVNVNRLGLPAIKLWAYDHLCLFGWPVPLPITDDRSFIY
Ga0335069_1243630323300032893SoilVNANRLGLPAIKMWAYDHICLFGWPLPLPTTDDRSFIY
Ga0335083_1076710323300032954SoilREFVNVNRLGLPAIKIWAYDHLCLFAWPVPLPTTDDRSFIY
Ga0326728_1004919063300033402Peat SoilMGLYYSTWLWLREFVNGNRLGLPAIKLWAYDHVCLFGWPIPLPTSDDRSFIY
Ga0326728_1037446513300033402Peat SoilVNINRLGLLTIKLWAYDHLCLFGWPVPLPTSDDRSFIY
Ga0334837_054521_3_1313300033823SoilLREFVNANRLGLPAIKLWAYDHVCLFGWPVPLPESDDRSFIY
Ga0334840_148835_29_1573300033824SoilMREFVNASRIGPPAIKLWAYDHVCLFGWPLPLPTSDDSSFIY
Ga0334811_186500_395_5023300033891SoilSRLGLPVIKLWAYDHLCLFGWPIPRPASDDRSFIY
Ga0314861_0342461_512_6403300033977PeatlandMREFVNVNRLGLPAIKLWAYDHVCLFGWPVPLPTSDDSSFIY
Ga0314861_0358107_155_3133300033977PeatlandMGLYYGTWPWMREFVNISRLGLPMVKLWAYDHLCLFGWPLPLPTVDDRSLIY
Ga0371487_0365784_473_6313300033982Peat SoilMGLYYATWPWMREFVNVNRLGLPAIKLWAYDHICLFAWPVPLPTSDDSSFIY
Ga0371488_0002813_18521_186793300033983Peat SoilMGIYYGTWPWLREFVNASRLGLPVIKIWAYDHVCLFGWPVPMPTTDDRSFIY
Ga0370492_0012559_3321_34643300034282Untreated Peat SoilRRGRGYGEFVNASRLGLPAIKFWAYDRLCLHGWPIPLATSDDRSFVY


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.