| Basic Information | |
|---|---|
| Family ID | F054380 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 140 |
| Average Sequence Length | 37 residues |
| Representative Sequence | VAQKLSEYKRKRDPKQTPEPFGSKKGKAKEPIFVVQRH |
| Number of Associated Samples | 126 |
| Number of Associated Scaffolds | 140 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 57.55 % |
| % of genes near scaffold ends (potentially truncated) | 99.29 % |
| % of genes from short scaffolds (< 2000 bps) | 97.86 % |
| Associated GOLD sequencing projects | 125 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.25 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.429 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (18.571 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.429 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.143 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.15% β-sheet: 0.00% Coil/Unstructured: 84.85% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 140 Family Scaffolds |
|---|---|---|
| PF02735 | Ku | 27.86 |
| PF03255 | ACCA | 12.86 |
| PF01039 | Carboxyl_trans | 12.14 |
| PF00296 | Bac_luciferase | 0.71 |
| PF01168 | Ala_racemase_N | 0.71 |
| PF00583 | Acetyltransf_1 | 0.71 |
| PF01068 | DNA_ligase_A_M | 0.71 |
| PF01255 | Prenyltransf | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 140 Family Scaffolds |
|---|---|---|---|
| COG1273 | Non-homologous end joining protein Ku, dsDNA break repair | Replication, recombination and repair [L] | 27.86 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 25.00 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 12.14 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 12.14 |
| COG0020 | Undecaprenyl pyrophosphate synthase | Lipid transport and metabolism [I] | 0.71 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.71 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.71 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.43 % |
| Unclassified | root | N/A | 28.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459003|FZ032L002HVJYS | Not Available | 508 | Open in IMG/M |
| 2228664021|ICCgaii200_c0857464 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300000886|AL3A1W_1022437 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300001686|C688J18823_10787259 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300003321|soilH1_10128400 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300005180|Ga0066685_10390481 | Not Available | 967 | Open in IMG/M |
| 3300005181|Ga0066678_10579402 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300005186|Ga0066676_11151478 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300005450|Ga0066682_10568408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 716 | Open in IMG/M |
| 3300005451|Ga0066681_10612065 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300005543|Ga0070672_100782656 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300005546|Ga0070696_100927476 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300005549|Ga0070704_100558947 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300005553|Ga0066695_10472564 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300005554|Ga0066661_10463249 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300005556|Ga0066707_10426069 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300005558|Ga0066698_10065433 | All Organisms → cellular organisms → Bacteria | 2332 | Open in IMG/M |
| 3300005558|Ga0066698_10842263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 591 | Open in IMG/M |
| 3300005560|Ga0066670_10950682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 524 | Open in IMG/M |
| 3300005561|Ga0066699_10809266 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300005562|Ga0058697_10493002 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300005569|Ga0066705_10751567 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300005574|Ga0066694_10484121 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300005575|Ga0066702_10291010 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300005576|Ga0066708_10535380 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300005576|Ga0066708_10616549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 694 | Open in IMG/M |
| 3300005578|Ga0068854_101873546 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300005764|Ga0066903_100773536 | All Organisms → cellular organisms → Bacteria | 1711 | Open in IMG/M |
| 3300005897|Ga0075281_1036591 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300005901|Ga0075274_1086167 | Not Available | 521 | Open in IMG/M |
| 3300006028|Ga0070717_11362407 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300006031|Ga0066651_10667367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 556 | Open in IMG/M |
| 3300006163|Ga0070715_10436563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 736 | Open in IMG/M |
| 3300006804|Ga0079221_11202998 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300006854|Ga0075425_102742730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 543 | Open in IMG/M |
| 3300006871|Ga0075434_100393340 | All Organisms → cellular organisms → Bacteria | 1407 | Open in IMG/M |
| 3300006881|Ga0068865_100889284 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300006954|Ga0079219_11001277 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300006954|Ga0079219_11941509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 557 | Open in IMG/M |
| 3300007764|Ga0102950_1285227 | Not Available | 514 | Open in IMG/M |
| 3300009012|Ga0066710_102569216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 734 | Open in IMG/M |
| 3300009098|Ga0105245_10241824 | All Organisms → cellular organisms → Bacteria | 1750 | Open in IMG/M |
| 3300009156|Ga0111538_10577851 | All Organisms → cellular organisms → Bacteria | 1425 | Open in IMG/M |
| 3300009174|Ga0105241_11180310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 724 | Open in IMG/M |
| 3300009174|Ga0105241_11621461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 626 | Open in IMG/M |
| 3300009176|Ga0105242_10604998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1059 | Open in IMG/M |
| 3300009177|Ga0105248_13292747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 514 | Open in IMG/M |
| 3300009551|Ga0105238_12047322 | Not Available | 606 | Open in IMG/M |
| 3300010036|Ga0126305_10261207 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300010040|Ga0126308_10543802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 788 | Open in IMG/M |
| 3300010321|Ga0134067_10024119 | All Organisms → cellular organisms → Bacteria | 1849 | Open in IMG/M |
| 3300010323|Ga0134086_10449281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 526 | Open in IMG/M |
| 3300010336|Ga0134071_10293120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 816 | Open in IMG/M |
| 3300010366|Ga0126379_11280635 | Not Available | 839 | Open in IMG/M |
| 3300010397|Ga0134124_10236118 | All Organisms → cellular organisms → Bacteria | 1676 | Open in IMG/M |
| 3300010398|Ga0126383_13668043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 502 | Open in IMG/M |
| 3300011003|Ga0138514_100045613 | Not Available | 873 | Open in IMG/M |
| 3300012001|Ga0120167_1078889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 688 | Open in IMG/M |
| 3300012189|Ga0137388_11849994 | Not Available | 535 | Open in IMG/M |
| 3300012198|Ga0137364_10492944 | Not Available | 921 | Open in IMG/M |
| 3300012200|Ga0137382_10026066 | All Organisms → cellular organisms → Bacteria | 3433 | Open in IMG/M |
| 3300012207|Ga0137381_10793708 | Not Available | 821 | Open in IMG/M |
| 3300012210|Ga0137378_11093761 | Not Available | 712 | Open in IMG/M |
| 3300012211|Ga0137377_11817254 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300012349|Ga0137387_11281987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
| 3300012351|Ga0137386_10651339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 758 | Open in IMG/M |
| 3300012351|Ga0137386_11084662 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300012362|Ga0137361_10792647 | Not Available | 862 | Open in IMG/M |
| 3300012476|Ga0157344_1020316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
| 3300012913|Ga0157298_10385355 | Not Available | 528 | Open in IMG/M |
| 3300012915|Ga0157302_10383154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
| 3300012930|Ga0137407_11130050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 743 | Open in IMG/M |
| 3300012951|Ga0164300_10775107 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300012955|Ga0164298_11602582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
| 3300012977|Ga0134087_10134717 | Not Available | 1063 | Open in IMG/M |
| 3300012977|Ga0134087_10813778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
| 3300012987|Ga0164307_11139506 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300012987|Ga0164307_11645791 | Not Available | 544 | Open in IMG/M |
| 3300012988|Ga0164306_10166374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 1518 | Open in IMG/M |
| 3300012988|Ga0164306_11151403 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300012989|Ga0164305_10218110 | Not Available | 1355 | Open in IMG/M |
| 3300013102|Ga0157371_10219251 | Not Available | 1366 | Open in IMG/M |
| 3300013297|Ga0157378_10488253 | Not Available | 1228 | Open in IMG/M |
| 3300014311|Ga0075322_1177531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 535 | Open in IMG/M |
| 3300015077|Ga0173483_10841475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 534 | Open in IMG/M |
| 3300015077|Ga0173483_10933352 | Not Available | 514 | Open in IMG/M |
| 3300015262|Ga0182007_10433116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| 3300015373|Ga0132257_104439129 | Not Available | 510 | Open in IMG/M |
| 3300017659|Ga0134083_10232419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 768 | Open in IMG/M |
| 3300017792|Ga0163161_10497053 | Not Available | 993 | Open in IMG/M |
| 3300018078|Ga0184612_10258801 | Not Available | 898 | Open in IMG/M |
| 3300018433|Ga0066667_10611042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 910 | Open in IMG/M |
| 3300018482|Ga0066669_10377355 | Not Available | 1190 | Open in IMG/M |
| 3300018482|Ga0066669_11422684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 628 | Open in IMG/M |
| 3300018482|Ga0066669_11811219 | Not Available | 564 | Open in IMG/M |
| 3300019269|Ga0184644_1804371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| 3300019875|Ga0193701_1085491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 605 | Open in IMG/M |
| 3300021441|Ga0213871_10296334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 521 | Open in IMG/M |
| 3300021445|Ga0182009_10621031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 580 | Open in IMG/M |
| 3300022694|Ga0222623_10051375 | All Organisms → cellular organisms → Bacteria | 1586 | Open in IMG/M |
| 3300024323|Ga0247666_1011815 | All Organisms → cellular organisms → Bacteria | 1914 | Open in IMG/M |
| 3300025885|Ga0207653_10115549 | Not Available | 962 | Open in IMG/M |
| 3300025913|Ga0207695_10390546 | Not Available | 1276 | Open in IMG/M |
| 3300025924|Ga0207694_11427370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 585 | Open in IMG/M |
| 3300025931|Ga0207644_11752826 | Not Available | 520 | Open in IMG/M |
| 3300025945|Ga0207679_10913329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 803 | Open in IMG/M |
| 3300025949|Ga0207667_11734827 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300025960|Ga0207651_11509153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 605 | Open in IMG/M |
| 3300025990|Ga0208527_1027780 | Not Available | 685 | Open in IMG/M |
| 3300026075|Ga0207708_10965756 | Not Available | 739 | Open in IMG/M |
| 3300026078|Ga0207702_10882021 | Not Available | 886 | Open in IMG/M |
| 3300027869|Ga0209579_10620473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 586 | Open in IMG/M |
| 3300028712|Ga0307285_10041098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1134 | Open in IMG/M |
| 3300028716|Ga0307311_10229667 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300028718|Ga0307307_10028333 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
| 3300028722|Ga0307319_10068390 | Not Available | 1123 | Open in IMG/M |
| 3300028755|Ga0307316_10232158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 668 | Open in IMG/M |
| 3300028755|Ga0307316_10260496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 631 | Open in IMG/M |
| 3300028768|Ga0307280_10098486 | Not Available | 970 | Open in IMG/M |
| 3300028771|Ga0307320_10118842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1012 | Open in IMG/M |
| 3300028807|Ga0307305_10102756 | Not Available | 1320 | Open in IMG/M |
| 3300028811|Ga0307292_10101687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1130 | Open in IMG/M |
| 3300028824|Ga0307310_10532318 | Not Available | 594 | Open in IMG/M |
| 3300028881|Ga0307277_10452750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 575 | Open in IMG/M |
| 3300028885|Ga0307304_10390459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 627 | Open in IMG/M |
| 3300030336|Ga0247826_10462312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 951 | Open in IMG/M |
| 3300031057|Ga0170834_111556803 | Not Available | 606 | Open in IMG/M |
| 3300031231|Ga0170824_107089235 | Not Available | 867 | Open in IMG/M |
| 3300031455|Ga0307505_10532548 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300031548|Ga0307408_100573169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 999 | Open in IMG/M |
| 3300031740|Ga0307468_100716702 | Not Available | 839 | Open in IMG/M |
| 3300031740|Ga0307468_100941584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 753 | Open in IMG/M |
| 3300031793|Ga0318548_10480277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 608 | Open in IMG/M |
| 3300031912|Ga0306921_10761728 | Not Available | 1108 | Open in IMG/M |
| 3300031996|Ga0308176_11990379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
| 3300032002|Ga0307416_103049242 | Not Available | 560 | Open in IMG/M |
| 3300032010|Ga0318569_10481760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 578 | Open in IMG/M |
| 3300033550|Ga0247829_10737593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 820 | Open in IMG/M |
| 3300034026|Ga0334946_030853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → unclassified Frankiales → Frankiales bacterium | 890 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 18.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.57% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.29% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.29% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.57% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.57% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.14% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 2.14% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.14% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.14% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.43% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.43% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.43% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.43% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.43% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.43% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.71% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.71% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.71% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.71% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.71% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.71% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.71% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.71% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.71% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.71% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.71% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.71% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000886 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-65cm-3A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005897 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_103 | Environmental | Open in IMG/M |
| 3300005901 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_201 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007764 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_D2_MG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300012001 | Permafrost microbial communities from Nunavut, Canada - A24_80cm_12M | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014311 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Host-Associated | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025990 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034026 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 42SMS | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4A_10785470 | 2170459003 | Grass Soil | VADKLREYERKRDPKQTPEPFTSSRSGSKAPIFVV |
| ICCgaii200_08574642 | 2228664021 | Soil | MASLRDYERKRDQKKTPEPFGGRKKRAKSPIFVVQRH |
| AL3A1W_10224371 | 3300000886 | Permafrost | VAAPRLREYRRKRDAAGTPEPFTGKKKGKQPIFVVQRH |
| C688J18823_107872592 | 3300001686 | Soil | MAQKLSEYRRKRDPKQTPEPFGAKRGREKDPIFVVQRHD |
| soilH1_101284003 | 3300003321 | Sugarcane Root And Bulk Soil | VSKKLSEYERKRDRKQTPEPFGGKRGRAKEPIFVVQRHDA |
| Ga0066685_103904812 | 3300005180 | Soil | VASQNLKEYRRKRDPKKTSEPFGKGKKRGKQPIFVVQRHD |
| Ga0066678_105794022 | 3300005181 | Soil | VSLREYERKRDPKKTKEPFPSKRRGRKAKGPIFVVQRHDARRL |
| Ga0066676_111514782 | 3300005186 | Soil | MSSKSQKRLSEYRGKRDPNKTPEPFGSRKRRAAPLFVVQRHQ |
| Ga0066682_105684081 | 3300005450 | Soil | MAEKLSEYRRRRDPKQTPEPFGAKGAKPKEPIFVVQRHDA |
| Ga0066681_106120651 | 3300005451 | Soil | VARLTEYERKRDPKKTPEPFTGKRGKTKQPIFVVQRHDAR |
| Ga0070672_1007826562 | 3300005543 | Miscanthus Rhizosphere | MATLRDYERKRDRKKTPEPFGGREGRKKGPIFVVQRHDAR |
| Ga0070696_1009274762 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQKLSEYRRKRDPKKTPEPGLKGREVSPAEAERPIFVVQRHDA |
| Ga0070704_1005589471 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKEKLSEYRRKRDPKQTPEPFAGKRGKTKEPIFVVQRHDA |
| Ga0066695_104725641 | 3300005553 | Soil | VSGSELGEYKRKRDPKQTPEPFSSRRKRTKDPIFV |
| Ga0066661_104632492 | 3300005554 | Soil | VAKSELREYRRKRDPKKTPEPFGGKKRGKQPIFVVQ |
| Ga0066707_104260692 | 3300005556 | Soil | MTEKLSEYRRKRDPKATPEPFAAAKRRAKEPIFVVQRH |
| Ga0066698_100654334 | 3300005558 | Soil | VSGSELGEYKRKRDPKQTPEPFSSRRKRTKNPIFVVQRHDA |
| Ga0066698_108422631 | 3300005558 | Soil | VASQNLKEYRRKRDPKKTSEPFGKGKKRGKQPIFVVQRH |
| Ga0066670_109506822 | 3300005560 | Soil | VPRAKLTEYERKRDRKKTPEPFGAKRGKTKEPIFVVQRHDA |
| Ga0066699_108092662 | 3300005561 | Soil | VAGRKLAEYERKRTRGKTPEPFGAGERGRAQPIFVVQR |
| Ga0058697_104930021 | 3300005562 | Agave | VARLREYERKRDRKKTPEPFGGSGRRGKKPIFVVQR |
| Ga0066705_107515672 | 3300005569 | Soil | VASRRLTEYRRKRDPKKTSEPFGGRKRRPKDPIFVVQRHDA |
| Ga0066694_104841212 | 3300005574 | Soil | VSLSEYERKRNRKKTPEPFSGKRKRKEPIFVVQRH |
| Ga0066702_102910101 | 3300005575 | Soil | VATQKLTEYRRKRDPKQTSEPFGKGKKKGKQPIFVVQ |
| Ga0066708_105353802 | 3300005576 | Soil | VSLREYERKRDPKKTPEPFKGKRKSKQPTFVVQRHDA |
| Ga0066708_106165492 | 3300005576 | Soil | VARPRLSEYERKRDPGKTPEPFSGRRGRRKQPIFVVQRH |
| Ga0068854_1018735461 | 3300005578 | Corn Rhizosphere | VPKAKLAEYKRKRDPKKTPEPFGSKKGGKEPIFVVQ |
| Ga0066903_1007735363 | 3300005764 | Tropical Forest Soil | VPEKLTEYERKRDPKRTPEPFGAKKRRAKEPIFVIQRHDAR |
| Ga0066903_1091060681 | 3300005764 | Tropical Forest Soil | VSLSDYRRKRTPGKTPEPFEDGGATDGAPIFVVQRHDAR |
| Ga0075281_10365913 | 3300005897 | Rice Paddy Soil | VNLREYEHKRKPKQTPEPFESHDGGDGDGAPIFVVQRHD |
| Ga0075274_10861671 | 3300005901 | Rice Paddy Soil | VSRKLSEYERRRDRKQTPEPFGLPGREPKANRASLD |
| Ga0070717_113624072 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VSKKLSEYERKRNRRQTPEPFGGRRTKAKAPIFVVQRH |
| Ga0066651_106673671 | 3300006031 | Soil | VAKAKLADYKKKRDPRKTPEPFGSSKRGKKPIFVI |
| Ga0070715_104365631 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VTVENLTEYRRKRDRTKTSEPFSSKRKRGKQPIFVVQ |
| Ga0079221_112029982 | 3300006804 | Agricultural Soil | VSKKLSEYERKRSRKQTPEPFGGKRGKAKELTFVVQRHDA |
| Ga0075425_1027427302 | 3300006854 | Populus Rhizosphere | VSAEKLGEYKRKRDPKQTPEPFSSKRGGKKDPIFVVQRHDA |
| Ga0075434_1003933403 | 3300006871 | Populus Rhizosphere | MSDRLREYRRKRDPKQTSEPFRSEKSRKDGSPIFV |
| Ga0068865_1008892841 | 3300006881 | Miscanthus Rhizosphere | VAEKLSEYKRKRDPGKTPEPFGAKKGKTKDPIFVVQRH |
| Ga0079219_110012774 | 3300006954 | Agricultural Soil | MAKLAAYKRKRDPAKTPEPFGGKLRGGAPTFVIQR |
| Ga0079219_119415091 | 3300006954 | Agricultural Soil | VPRAKLTDYERKRDPKKTPEPFGGKRDRAKAPIFVVQRHD |
| Ga0102950_12852272 | 3300007764 | Soil | VSLREYERKRNRKQTPEPFEGRGGDGAPVFVVQRHDA |
| Ga0066710_1025692162 | 3300009012 | Grasslands Soil | VASQKLEEYRRKRDPKETSEPFGTGKRRGKQPIFVIQRH |
| Ga0105245_102418241 | 3300009098 | Miscanthus Rhizosphere | MASLRDYERKRDRKKTPEPFSGRKKRAKSPIFVVQRH |
| Ga0111538_105778511 | 3300009156 | Populus Rhizosphere | VSLREYRRKRDPKKTSEPFAEPRRGKRKEPIFVVQRHD |
| Ga0105241_111803102 | 3300009174 | Corn Rhizosphere | VSLKEYRRKRDPKKTGEPFTGKRKGKKPIFVVQRHD |
| Ga0105241_116214611 | 3300009174 | Corn Rhizosphere | VPEDRLSDYRRKRDPKATPEPFGAGKRGKQPTFVL |
| Ga0105242_106049981 | 3300009176 | Miscanthus Rhizosphere | VAQKLSEYKRKRDPKQTPEPFGSKKGKAKDPIFVVQ |
| Ga0105248_132927471 | 3300009177 | Switchgrass Rhizosphere | VSKKLSEYERKRDRKKTPEPFGSRARNKDPIFVVQRH |
| Ga0105238_120473221 | 3300009551 | Corn Rhizosphere | VAPPLESYKKKRDPKKTPEPFGRRRGKAKGKPIFVVQR |
| Ga0126305_102612072 | 3300010036 | Serpentine Soil | VAKAKLADYKRKRDPKKTPEPFGGKKGGKQPSFVVQRH |
| Ga0126308_105438022 | 3300010040 | Serpentine Soil | VSLPEYRRKRDPKVTPEPVEGHGKRGKKPIFVVQRHDAR |
| Ga0134067_100241191 | 3300010321 | Grasslands Soil | VASRNLTQYRRKRDPKKTSEPFGKAKKRGKQPIFVVQRHDA |
| Ga0134086_104492811 | 3300010323 | Grasslands Soil | VSLREYERKRNRKKTPEPFSARAQAKGAPIFVVQRQDARR |
| Ga0134071_102931201 | 3300010336 | Grasslands Soil | VSPEKLREYNRKRDPKQTPEPFSSTRRGPKAPIFVVQRHDARR |
| Ga0126379_112806352 | 3300010366 | Tropical Forest Soil | MSRKLSEYERKRNRRGTPEPFGGKRGKAKGPIFVVQRH |
| Ga0134124_102361183 | 3300010397 | Terrestrial Soil | VSQKLQEYRRKRDPEKTAEPFGSKKKRGKQPIFVVQR |
| Ga0126383_136680431 | 3300010398 | Tropical Forest Soil | VSKKLSEYERKRDRKQTPEPFGGTRGTATAPTFVVQRHD |
| Ga0138514_1000456131 | 3300011003 | Soil | VSQKLQEYRRKRDPKKTSEPFGTKKKRGKEPIFVIQP |
| Ga0120167_10788891 | 3300012001 | Permafrost | VSPSKLGEYNRKRDPKQTPEPFTSKRKGTKDPIFVVQRHDAR |
| Ga0137388_118499942 | 3300012189 | Vadose Zone Soil | MPRNLTEYKKKRDPSKTSEPFGNGRPGKEPIFVVQRHDA |
| Ga0137364_104929442 | 3300012198 | Vadose Zone Soil | VATQRLKEYRRKRDPKQTSEPFGKAKKRGKQPIFVVQRHD |
| Ga0137382_100260665 | 3300012200 | Vadose Zone Soil | VAKAKLAEYKKKRDPKKTPEPFGSKKSAKDPIFVV |
| Ga0137381_107937082 | 3300012207 | Vadose Zone Soil | VSKKLSEYERKRKREQTPEPFGGKRGKAKAPIFVI |
| Ga0137378_110937611 | 3300012210 | Vadose Zone Soil | VASQKLKEYRRKRDPKQTSEPFDTRKKRGKQPIFVVQRHDAR |
| Ga0137377_118172541 | 3300012211 | Vadose Zone Soil | VARQLTEYKRKRDPKKTPEPFGGKGRKTKAPIFVVQRHD |
| Ga0137387_112819871 | 3300012349 | Vadose Zone Soil | VAEKLSEYKRKRDPKQTPEPFGGKKEKTKEPIFVVQ |
| Ga0137386_106513392 | 3300012351 | Vadose Zone Soil | MAQKQLSEYKRKRDPRQTPEPFGAKGGKTKEPTFVV |
| Ga0137386_110846622 | 3300012351 | Vadose Zone Soil | VSPRKLAEYERKRDPKTTPEPFRGKRRKTKEPIFVVQRH |
| Ga0137361_107926471 | 3300012362 | Vadose Zone Soil | VAEELREYKRKRDPKETPEPFTSKRPRAKVPIFVVQRHDA |
| Ga0157344_10203162 | 3300012476 | Arabidopsis Rhizosphere | VPEPKLREYRRKRDPKKTSEPFTGKRKTKEPLFVV |
| Ga0157298_103853552 | 3300012913 | Soil | LVDKHTTVATLRDYERKRDRRKTPEPFGGKPKRERRPIFV |
| Ga0157302_103831542 | 3300012915 | Soil | VSKKLSEYERKRKRKQTPEPFGGRHAKAKGPIFVV |
| Ga0137407_111300502 | 3300012930 | Vadose Zone Soil | VATQKLSEYKRRRDPKATPEPFGSRKGKTKDTIFVVQ |
| Ga0164300_107751072 | 3300012951 | Soil | VAQKLSEYKRKRDPKQTPEPFGSKKGKAKDPIFVVQRHDAR |
| Ga0164298_116025822 | 3300012955 | Soil | MNQKLRDYERKRKRRETPEPFTSSRARKKHDPIFVVQR |
| Ga0134087_101347171 | 3300012977 | Grasslands Soil | VASRNLTEYRRKRDPKKTSEPFGKAKKRGKQPIFVVQ |
| Ga0134087_108137782 | 3300012977 | Grasslands Soil | MTEKLSEYRRKRDPKATPEPFESPRKRTGEPIFVVQR |
| Ga0164307_111395061 | 3300012987 | Soil | VPKAKLAEYKRKRDPKKTPEPFGSSKRGEEPIFVIQRH |
| Ga0164307_116457912 | 3300012987 | Soil | VDYYFVVAKLEDYKRKRNPKQTPEPFGGAKRGGKPI |
| Ga0164306_101663743 | 3300012988 | Soil | VAQKLSEYKRKRDPKQTPEPFGSKKGKAKDPIFVVQR |
| Ga0164306_111514032 | 3300012988 | Soil | VATQKLQEYRRKRDEKQTPEPFGKGKKRSKQPIFVIQRH |
| Ga0164305_102181103 | 3300012989 | Soil | VGSSELGEYRRKRDPKQTPEPFSSRRKRTKDPIFVV |
| Ga0157371_102192513 | 3300013102 | Corn Rhizosphere | MAEKLREYERKRHRGATPEPFTSKRKGREKQPIFVVQRH |
| Ga0157378_104882532 | 3300013297 | Miscanthus Rhizosphere | VSQKLQEYRRKRDPEKTAEPFGGQKKRGKQPIFVVQRHQA |
| Ga0075322_11775311 | 3300014311 | Natural And Restored Wetlands | VVPPLESYRRKRDPKKTPEPFGGRRRKTGGPIFVI |
| Ga0173483_108414752 | 3300015077 | Soil | VSLREYERKRDRKKTPEPFSGKRRGKQPTFVVQRH |
| Ga0173483_109333522 | 3300015077 | Soil | MAQKLSEYRRKRDPKKTPEPFGAKQGEPKEPIFVVQR |
| Ga0182007_104331162 | 3300015262 | Rhizosphere | VPEPRLSEYRRKRDPEITPEPFGSAKRGSRPIFVVQR |
| Ga0132257_1044391292 | 3300015373 | Arabidopsis Rhizosphere | VSPKLSEYERKRNRKKTPEPFGGKRGKEKSPVFVVQRH |
| Ga0134083_102324192 | 3300017659 | Grasslands Soil | VAKLTEYERKRDPKRTPEPFGGKRAKTKEPIFVVQR |
| Ga0163161_104970531 | 3300017792 | Switchgrass Rhizosphere | VATLRDYERKRDRKKTPEPFGARKGRKKGPIFVVQRHD |
| Ga0184612_102588012 | 3300018078 | Groundwater Sediment | LAKLAEYKRKRDPKKTPEPFGGKKRGKEPIFVVQR |
| Ga0066667_106110421 | 3300018433 | Grasslands Soil | VETQKLKEYRRKRDPKQTAEPFDSRRGGKRAKGPIFV |
| Ga0066669_103773551 | 3300018482 | Grasslands Soil | VASRRLTEYRRKRDPKKTSEPFAGQKRRAKQPIFV |
| Ga0066669_114226841 | 3300018482 | Grasslands Soil | VSLREYERKRDPKKTPEPFKGKRKSKDPIFVVQRHD |
| Ga0066669_118112192 | 3300018482 | Grasslands Soil | MSLKEYRRKRDPKETPEPFAGGKARRKKQPIFVVQRHDARR |
| Ga0184644_18043712 | 3300019269 | Groundwater Sediment | VAKQKLAEYRKKRDPKKTPEPFGDKKRGQEATFVVQ |
| Ga0193701_10854911 | 3300019875 | Soil | VTVENLTEYRRKRDRKKTSEPFSSKRKRGKQPIFVVQRHD |
| Ga0213871_102963342 | 3300021441 | Rhizosphere | MAKLSEYRAKRDPKKTPEPFGGARDGSAPVFVVQR |
| Ga0182009_106210312 | 3300021445 | Soil | VSPKLDEYHRKRDPKQTPEPFTSKGRKAKLPIFVVQ |
| Ga0222623_100513753 | 3300022694 | Groundwater Sediment | VAEKLSEYKRKRDPKKTPEPFGGKKDKTKEPIFVVQRHD |
| Ga0247666_10118153 | 3300024323 | Soil | VSKKLSEYERKRNRKQTPEPFGGKQTKAKAPTFVVQR |
| Ga0207653_101155492 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | VSLREYERKRDRKQTPEPFTGRRKGKQPIFVVQRH |
| Ga0207695_103905461 | 3300025913 | Corn Rhizosphere | VPPKLRDYERKRDPKATPEPFTSTRKGRENEPIFVV |
| Ga0207694_114273702 | 3300025924 | Corn Rhizosphere | VAEKLREYNAKRDPEQTPEPFTSKRGGRTKAPIFVVQRHDAR |
| Ga0207644_117528262 | 3300025931 | Switchgrass Rhizosphere | MASLRDYERKRDQKKTPEPFGRRTKRAKSPIFVVQR |
| Ga0207679_109133292 | 3300025945 | Corn Rhizosphere | VPPLESYKKKRDPKKTPEPFGGKRGRGKAKDKPIFVVQRHDA |
| Ga0207667_117348272 | 3300025949 | Corn Rhizosphere | VPPLESYKKKRDPKKTPEPFGGKRGRGKARDKPIFVVQRHDA |
| Ga0207651_115091531 | 3300025960 | Switchgrass Rhizosphere | VAEKLSEYKRKRDPGKTPEPFGAKKGKTKDPIFVV |
| Ga0208527_10277801 | 3300025990 | Rice Paddy Soil | VSSLSEYRRKRDPRATPEPFGKGKRGKKQPIFVVQR |
| Ga0207708_109657562 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MATLRDYERKRDRKKTPEPFGGRKGRKKGPIFVVQ |
| Ga0207702_108820211 | 3300026078 | Corn Rhizosphere | VSKKLSEYERKRHRKQTPEPFGGRRAKAKAPVFVVQ |
| Ga0209579_106204732 | 3300027869 | Surface Soil | VSKKLSEYERKRDRTQTPEPFGGKRNKKKAPIFVVQRHDAR |
| Ga0307285_100410981 | 3300028712 | Soil | VAQKLSDYNRKRDPKQTPEPFGSTKGTAKEPIFVVQRHDA |
| Ga0307311_102296671 | 3300028716 | Soil | VATQKLSEYKRKRDPKETPEPFGSRKGKTKEPIFVVQ |
| Ga0307307_100283331 | 3300028718 | Soil | VAQKLTEYKRKRDPKATPEPGLKAPARAKRSKEKEPIFVVQRH |
| Ga0307319_100683901 | 3300028722 | Soil | MARLRDYERKRDHKKTPEPFGGRKKRAKSPIFVVQRHDAR |
| Ga0307316_102321581 | 3300028755 | Soil | MGVARLSEYERKRKKAKTPEPFGGKKRGKAPIFVV |
| Ga0307316_102604961 | 3300028755 | Soil | VPKAKLAEYKRKRDRKKTPEPFGDKKRGKDPIFVVQR |
| Ga0307280_100984861 | 3300028768 | Soil | VAQKLTEYKRKRDPKATPEPGLKAPARAKHGKEKEPIFVVQRHDARR |
| Ga0307320_101188421 | 3300028771 | Soil | VAEKLSEYKRKRDPKKTPEPFGGKKDKTKEPIFVV |
| Ga0307305_101027562 | 3300028807 | Soil | VAQKLTEYKRKRDPKATPEPGLKAPVRAKRGEGKEPIFVVQR |
| Ga0307292_101016871 | 3300028811 | Soil | VAEKLSEYKRKRDAKKTPEPFGGKKGKTKDPIFVV |
| Ga0307310_105323182 | 3300028824 | Soil | LVSLREYEQKRDPKKTPEPFAGKRETKEPIFVVQRH |
| Ga0307277_104527502 | 3300028881 | Soil | VASQNLKEYRRKRDPKKTAEPFGKGKKRGKQPIFV |
| Ga0307304_103904591 | 3300028885 | Soil | VAKLAEYRKKRDPKKTPEPFTGKKGAKEPIFVIQR |
| Ga0247826_104623121 | 3300030336 | Soil | VAQLDEYRRKRDPKQTPEPFSGRGHSARQPIFVVQRH |
| Ga0170834_1115568032 | 3300031057 | Forest Soil | VSKKLSEYERNRNRTKTPEPFGGKRGKKKAPIFVVQR |
| Ga0170824_1070892352 | 3300031231 | Forest Soil | MATEKLQEYRRKRDEKQTPEPFGKGKKRGKEPIFVIQR |
| Ga0307505_105325481 | 3300031455 | Soil | VAQKLSEYKRKRDPKQTPEPFGSKKGKAKEPIFVV |
| Ga0307408_1005731692 | 3300031548 | Rhizosphere | VTERLGEYRKKRDPKKTPEPFGGRKRGKQPIFVVQ |
| Ga0307468_1007167021 | 3300031740 | Hardwood Forest Soil | MATLRDYERKRDRRKTPEPFGARKGRRKGPIFVVQRHDA |
| Ga0307468_1009415841 | 3300031740 | Hardwood Forest Soil | VAQKLSEYKRKRDPKQTPEPFGSKKGKAKEPIFVVQRH |
| Ga0318548_104802772 | 3300031793 | Soil | VSLGEYRRKRDPAKTPEPFPRKRGRSKEPIFVVQRHD |
| Ga0306921_107617281 | 3300031912 | Soil | VSKKLSEYERKRNRKQTPEPFGGKPGRAKAPIFVV |
| Ga0308176_119903792 | 3300031996 | Soil | VATQRLKEYRRKRDPKQTSEPFGKAKKRGKQPIFVVQR |
| Ga0307416_1030492421 | 3300032002 | Rhizosphere | VARLREYERKRDPKKTPEPFGKGKRREKEPIFVVQRHD |
| Ga0318569_104817601 | 3300032010 | Soil | VSKKLSEYERKRNRKQTPEPFGGKPGRAKAPIFVVQ |
| Ga0247829_107375932 | 3300033550 | Soil | VAEPKLREYRRKRDPKKTPEPFTGKRKTKDPIFVI |
| Ga0334946_030853_2_112 | 3300034026 | Sub-Biocrust Soil | MPSKLRTYERMRDPKATPEPFGAKKRRPRKKEPRFVV |
| ⦗Top⦘ |