NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F054365

Metagenome / Metatranscriptome Family F054365

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F054365
Family Type Metagenome / Metatranscriptome
Number of Sequences 140
Average Sequence Length 47 residues
Representative Sequence MLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAAKRKYPFAE
Number of Associated Samples 119
Number of Associated Scaffolds 140

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 77.14 %
% of genes near scaffold ends (potentially truncated) 34.29 %
% of genes from short scaffolds (< 2000 bps) 95.71 %
Associated GOLD sequencing projects 108
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (64.286 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(15.714 % of family members)
Environment Ontology (ENVO) Unclassified
(40.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(59.286 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 52.63%    β-sheet: 0.00%    Coil/Unstructured: 47.37%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 140 Family Scaffolds
PF01557FAA_hydrolase 19.29
PF00497SBP_bac_3 3.57
PF13450NAD_binding_8 2.14
PF00842Ala_racemase_C 0.71
PF01494FAD_binding_3 0.71
PF07687M20_dimer 0.71

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 140 Family Scaffolds
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.43
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.71
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.71
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.71
COG0787Alanine racemaseCell wall/membrane/envelope biogenesis [M] 0.71


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms64.29 %
UnclassifiedrootN/A35.71 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002155|JGI24033J26618_1046472Not Available615Open in IMG/M
3300002568|C688J35102_120910222All Organisms → cellular organisms → Bacteria → Proteobacteria2232Open in IMG/M
3300004081|Ga0063454_101609929All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium561Open in IMG/M
3300004114|Ga0062593_100812030All Organisms → cellular organisms → Bacteria932Open in IMG/M
3300004114|Ga0062593_101422515Not Available742Open in IMG/M
3300004479|Ga0062595_100189766All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1256Open in IMG/M
3300004479|Ga0062595_100988901Not Available721Open in IMG/M
3300004480|Ga0062592_100495636All Organisms → cellular organisms → Bacteria1007Open in IMG/M
3300004480|Ga0062592_102673485Not Available504Open in IMG/M
3300004643|Ga0062591_101283596Not Available719Open in IMG/M
3300005093|Ga0062594_101154334All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300005093|Ga0062594_102790238Not Available543Open in IMG/M
3300005148|Ga0066819_1010665Not Available658Open in IMG/M
3300005328|Ga0070676_10954838Not Available641Open in IMG/M
3300005328|Ga0070676_11146915All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium589Open in IMG/M
3300005329|Ga0070683_102342033All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300005331|Ga0070670_101440164Not Available632Open in IMG/M
3300005333|Ga0070677_10165543All Organisms → cellular organisms → Bacteria1041Open in IMG/M
3300005334|Ga0068869_100842017All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium791Open in IMG/M
3300005338|Ga0068868_101925246All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium560Open in IMG/M
3300005353|Ga0070669_101442967Not Available598Open in IMG/M
3300005356|Ga0070674_100074266All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2413Open in IMG/M
3300005438|Ga0070701_10553634All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium755Open in IMG/M
3300005441|Ga0070700_100488381All Organisms → cellular organisms → Bacteria945Open in IMG/M
3300005441|Ga0070700_101703117All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium541Open in IMG/M
3300005441|Ga0070700_102021462Not Available500Open in IMG/M
3300005456|Ga0070678_102125686All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300005459|Ga0068867_101062451Not Available737Open in IMG/M
3300005518|Ga0070699_100543512Not Available1057Open in IMG/M
3300005545|Ga0070695_101137644All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium640Open in IMG/M
3300005546|Ga0070696_100671669All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium842Open in IMG/M
3300005616|Ga0068852_102271280All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium564Open in IMG/M
3300005616|Ga0068852_102582079Not Available528Open in IMG/M
3300005841|Ga0068863_100662360Not Available1036Open in IMG/M
3300005842|Ga0068858_101215365Not Available741Open in IMG/M
3300006028|Ga0070717_10584514All Organisms → cellular organisms → Bacteria1013Open in IMG/M
3300006048|Ga0075363_100467876All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300006050|Ga0075028_100304051All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium890Open in IMG/M
3300006051|Ga0075364_10306768Not Available1081Open in IMG/M
3300006163|Ga0070715_11102500Not Available500Open in IMG/M
3300006173|Ga0070716_101385895All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300006177|Ga0075362_10181516All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300006178|Ga0075367_10364282All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300006186|Ga0075369_10155065Not Available1048Open in IMG/M
3300006237|Ga0097621_102164584All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium532Open in IMG/M
3300006358|Ga0068871_100861854Not Available838Open in IMG/M
3300006638|Ga0075522_10040762All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2752Open in IMG/M
3300006642|Ga0075521_10235809All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium873Open in IMG/M
3300006881|Ga0068865_101199558All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium672Open in IMG/M
3300006931|Ga0097620_101493834All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium746Open in IMG/M
3300009093|Ga0105240_12541511Not Available529Open in IMG/M
3300009098|Ga0105245_11655112All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium692Open in IMG/M
3300009137|Ga0066709_101417498Not Available1009Open in IMG/M
3300009148|Ga0105243_10406745All Organisms → cellular organisms → Bacteria1266Open in IMG/M
3300009148|Ga0105243_11895530All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300009156|Ga0111538_11233545All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales945Open in IMG/M
3300009174|Ga0105241_10826981Not Available855Open in IMG/M
3300009174|Ga0105241_12355659All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium531Open in IMG/M
3300009176|Ga0105242_11862347All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium641Open in IMG/M
3300009660|Ga0105854_1366569Not Available517Open in IMG/M
3300009661|Ga0105858_1242286Not Available546Open in IMG/M
3300010042|Ga0126314_11460106Not Available514Open in IMG/M
3300010044|Ga0126310_10037098All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2610Open in IMG/M
3300010159|Ga0099796_10272843Not Available709Open in IMG/M
3300010166|Ga0126306_10243489All Organisms → cellular organisms → Bacteria1370Open in IMG/M
3300010364|Ga0134066_10189296Not Available675Open in IMG/M
3300010371|Ga0134125_11981006All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300010400|Ga0134122_10416766All Organisms → cellular organisms → Bacteria1191Open in IMG/M
3300010880|Ga0126350_12136685All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300011119|Ga0105246_11065883Not Available736Open in IMG/M
3300012203|Ga0137399_11165185Not Available649Open in IMG/M
3300012212|Ga0150985_113962691All Organisms → cellular organisms → Bacteria1206Open in IMG/M
3300012683|Ga0137398_10607049All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium757Open in IMG/M
3300012905|Ga0157296_10070182Not Available882Open in IMG/M
3300012908|Ga0157286_10085054All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300012911|Ga0157301_10320433All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300012927|Ga0137416_11844183All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium553Open in IMG/M
3300012929|Ga0137404_10111507All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2222Open in IMG/M
3300012955|Ga0164298_10532465Not Available792Open in IMG/M
3300012955|Ga0164298_10634876Not Available739Open in IMG/M
3300012955|Ga0164298_10962959All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium627Open in IMG/M
3300012989|Ga0164305_10458541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium992Open in IMG/M
3300012989|Ga0164305_11797627All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium553Open in IMG/M
3300013306|Ga0163162_11722452Not Available716Open in IMG/M
3300014326|Ga0157380_10254558All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes1591Open in IMG/M
3300014326|Ga0157380_12471846Not Available585Open in IMG/M
3300014326|Ga0157380_12577019Not Available575Open in IMG/M
3300014969|Ga0157376_11483100All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium711Open in IMG/M
3300015077|Ga0173483_10207852Not Available906Open in IMG/M
3300015201|Ga0173478_10436939Not Available638Open in IMG/M
3300015264|Ga0137403_10203318All Organisms → cellular organisms → Bacteria1912Open in IMG/M
3300015374|Ga0132255_104584457All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300018469|Ga0190270_10515650All Organisms → cellular organisms → Bacteria1143Open in IMG/M
3300018476|Ga0190274_11397757Not Available789Open in IMG/M
3300018476|Ga0190274_11729564All Organisms → cellular organisms → Bacteria → Acidobacteria720Open in IMG/M
3300018476|Ga0190274_11924435All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300018482|Ga0066669_12218244Not Available521Open in IMG/M
3300019356|Ga0173481_10037336All Organisms → cellular organisms → Bacteria1600Open in IMG/M
3300019361|Ga0173482_10618653All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium547Open in IMG/M
3300019362|Ga0173479_10025447All Organisms → cellular organisms → Bacteria1737Open in IMG/M
3300019767|Ga0190267_10497518All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium719Open in IMG/M
3300020060|Ga0193717_1044756All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1607Open in IMG/M
3300021470|Ga0194051_1060210All Organisms → cellular organisms → Bacteria1391Open in IMG/M
3300025315|Ga0207697_10041688All Organisms → cellular organisms → Bacteria1885Open in IMG/M
3300025862|Ga0209483_1074837All Organisms → cellular organisms → Bacteria1530Open in IMG/M
3300025899|Ga0207642_10018147All Organisms → cellular organisms → Bacteria2694Open in IMG/M
3300025903|Ga0207680_11381095All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300025905|Ga0207685_10135721All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1097Open in IMG/M
3300025905|Ga0207685_10446368All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium672Open in IMG/M
3300025923|Ga0207681_10358485All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1169Open in IMG/M
3300025927|Ga0207687_11689766Not Available543Open in IMG/M
3300025930|Ga0207701_10485149All Organisms → cellular organisms → Bacteria1059Open in IMG/M
3300025931|Ga0207644_10203879All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1561Open in IMG/M
3300025931|Ga0207644_10344513All Organisms → cellular organisms → Bacteria1209Open in IMG/M
3300025933|Ga0207706_11601346All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300025935|Ga0207709_11635853All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium535Open in IMG/M
3300025942|Ga0207689_10160554All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1852Open in IMG/M
3300025945|Ga0207679_10618224All Organisms → cellular organisms → Bacteria978Open in IMG/M
3300026023|Ga0207677_10931833Not Available784Open in IMG/M
3300026023|Ga0207677_11145995Not Available710Open in IMG/M
3300026023|Ga0207677_12287835Not Available503Open in IMG/M
3300026075|Ga0207708_10716510All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium856Open in IMG/M
3300027894|Ga0209068_10681043All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium602Open in IMG/M
3300027903|Ga0209488_10302181All Organisms → cellular organisms → Bacteria1195Open in IMG/M
3300027915|Ga0209069_10248510All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium925Open in IMG/M
3300028379|Ga0268266_10477720All Organisms → cellular organisms → Bacteria1188Open in IMG/M
3300028381|Ga0268264_11944546Not Available598Open in IMG/M
3300028802|Ga0307503_10049032All Organisms → cellular organisms → Bacteria1600Open in IMG/M
3300028810|Ga0307294_10198717Not Available691Open in IMG/M
3300030968|Ga0075376_11211790All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300031003|Ga0074003_13702830Not Available889Open in IMG/M
3300031200|Ga0307496_10077328Not Available612Open in IMG/M
3300031232|Ga0302323_103402413All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium506Open in IMG/M
3300031247|Ga0265340_10145045All Organisms → cellular organisms → Bacteria1084Open in IMG/M
3300031847|Ga0310907_10055200All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1559Open in IMG/M
3300031908|Ga0310900_10442271All Organisms → cellular organisms → Bacteria998Open in IMG/M
3300031938|Ga0308175_101653962All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300032013|Ga0310906_10259914Not Available1088Open in IMG/M
3300032205|Ga0307472_101368197Not Available685Open in IMG/M
3300034268|Ga0372943_0655685All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium691Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil15.71%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere9.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil6.43%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere6.43%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere5.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.00%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere3.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.86%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.14%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.14%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil2.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.14%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.14%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.14%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.43%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.43%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil1.43%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.43%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.43%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.43%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.43%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.43%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.71%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.71%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.71%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.71%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.71%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.71%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.71%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.71%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.71%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.71%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.71%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.71%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002155Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7Host-AssociatedOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005148Soil and rhizosphere microbial communities from Laval, Canada - mgLMAEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006048Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3Host-AssociatedOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006051Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006177Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2Host-AssociatedOpen in IMG/M
3300006178Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2Host-AssociatedOpen in IMG/M
3300006186Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006638Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-AEnvironmentalOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2)Host-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009660Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058EnvironmentalOpen in IMG/M
3300009661Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300020060Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2EnvironmentalOpen in IMG/M
3300021470Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L239-20mEnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025862Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300030968Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031003Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter GP-3A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031200Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_SEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI24033J26618_104647213300002155Corn, Switchgrass And Miscanthus RhizosphereMLPTVIYLLETLRRALKKSGRGLFIVADAFREAMHDWRAAKRKYPF
C688J35102_12091022233300002568SoilMLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAARRKYPFAE*
Ga0063454_10160992923300004081SoilLLEALRRALKKSGRGLFIVADAFREAMHDWRAARRKYPFAE*
Ga0062593_10081203013300004114SoilMLPIIVFLLDALRRALNKSGRGVLLLIDVFGEAMQDWRNAGRKYPYAE*
Ga0062593_10142251513300004114SoilMLPTVIYLLETLRRALKKSGRGLFIVADAFREAMHDWRAAKRKYPFAE*
Ga0062595_10018976613300004479SoilMLPTVVYLLEAIRRALKKIRRGMFIVADAFQEAMHDWRAAKRKYPFAE*
Ga0062595_10098890123300004479SoilMLPTVILLIDAIRRALKKSGRGLSMIVDVFREAMGEWRAAQRKYPFAE*
Ga0062592_10049563623300004480SoilMLPTVVYLLEAIRRALKKSRRGMFIVADAFQEAMHDWRAAKRKYPFAE*
Ga0062592_10267348523300004480SoilMLPIIIHLLEALRRALNKSGRGLSLIADAFQEAMQDWRKAHRRYPFSE*
Ga0062591_10128359623300004643SoilMLPTVIVLIDAIRRALKKSGRGLFMIVDVFREAMGQWRAAQRKYPFAE*
Ga0062594_10115433423300005093SoilMLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAAKQKYPFAE*
Ga0062594_10279023813300005093SoilMLPTVVYLLEALRRALEKSGRGLFMVADAFREAMHDWRAAKRKYPFAE*
Ga0066819_101066523300005148SoilMLPTVIYLLEALRRALKKSGRGLFIVAEAFREAMHDWRAA
Ga0070676_1095483813300005328Miscanthus RhizosphereMLPTVIYLIEAIRRALKKSGRGLSMIVDVFREAMGEWRAAQRKYPFAE*
Ga0070676_1114691523300005328Miscanthus RhizosphereMLPTLIYLLENLRRALKKSGRGLFIVADAFQEAMQDWRDAKRKYPFSE*
Ga0070683_10234203323300005329Corn RhizosphereMLPTVVYLLEALRRALKRAGRGLFIVAEAFGEARDAARHYPFAE*
Ga0070670_10144016423300005331Switchgrass RhizosphereMLPTVIYLIEAIRRALKKSGRGVFMLVDVFGEAMEDWRKAKRKYPFAE*
Ga0070677_1016554313300005333Miscanthus RhizosphereYPMLPTVIYLIEAIRRALKKSGRGVFMLVDVFGEAMEDWRKAKRKYPFAE*
Ga0068869_10084201713300005334Miscanthus RhizosphereMLPTVIYLIEAIRRALKKSSRGVFMLVDVFGEAMEDWRKARRKYPFAE*
Ga0068868_10192524623300005338Miscanthus RhizosphereDDPMLPTVIYLIEAIRRALKKSGRGASMLVDVFGEAMEDWRKAKRKYPFAE*
Ga0070669_10144296733300005353Switchgrass RhizosphereMLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAAK
Ga0070674_10007426633300005356Miscanthus RhizosphereMLPTVIYLIEAIRRALKKSGRGVFMLIDVFGEAMEDWRKAKRKYPFAE*
Ga0070701_1055363413300005438Corn, Switchgrass And Miscanthus RhizosphereMLPTVIYLIEAIRRALKKSSRGVFMLVDVFGEAMEDWRKAKRKYPFAE*
Ga0070700_10048838123300005441Corn, Switchgrass And Miscanthus RhizosphereQEDYPMLPTVIYLIEAIRRALKKSGRGVFMLVDVFGEAMEDWRKAKRKYPFAE*
Ga0070700_10170311713300005441Corn, Switchgrass And Miscanthus RhizosphereLIDAIRRALKKSGRGLFMMVDVFQEAMGQWRAAQRKYPFAE*
Ga0070700_10202146223300005441Corn, Switchgrass And Miscanthus RhizosphereMLPTVIYLLETLRRALKKSGRGLFIVADAFREAMHDWRAA
Ga0070678_10212568623300005456Miscanthus RhizosphereISPMLPIIVFLLDALRRALNKSGRGVLLLIDVFGEAMQDWRNAGREYPYAE*
Ga0068867_10106245123300005459Miscanthus RhizosphereMLPTVIYLIEALRRALRKSTRGMFIVADAFQVAMHDWREAKRKYPFAE*
Ga0070699_10054351213300005518Corn, Switchgrass And Miscanthus RhizosphereMLPTVIYLLDAIRRALKKSGRGLSMVAGAFHEAMADWRAAGRKYPFAE*
Ga0070695_10113764423300005545Corn, Switchgrass And Miscanthus RhizosphereMLPAVIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAAKRKYPFAE*
Ga0070696_10067166923300005546Corn, Switchgrass And Miscanthus RhizosphereMLPTVIYLLDAIRRALKKSGRGLSMIVDVFREAMGEWRAAQRKYPFAE*
Ga0068852_10227128023300005616Corn RhizosphereTVIYLIEAIRRALKKSGRGVFMLVDVFGEAMEDWRKAKRKYPFAE*
Ga0068852_10258207923300005616Corn RhizosphereMLPTVIYLLETLRRALKKSGRGLFIVADAFREAMHDWRAARRKYPFAE*
Ga0068863_10066236013300005841Switchgrass RhizosphereMLPTVIYLIEAIRRALKKSGRGVFMLIDVFGEAMDDWRKAKRKYPFAE*
Ga0068858_10121536523300005842Switchgrass RhizosphereMLPTVILLIDAIRRALKKSGRGLSMIVDVFREAMGQWRAAQRKYPFAE*
Ga0070717_1058451423300006028Corn, Switchgrass And Miscanthus RhizosphereMLPVVIYLLEALRRALKKSGRGLFIVADAFREAMQDWRAAGRKYPFAE*
Ga0075363_10046787623300006048Populus EndosphereMLPTVIYLLEALRRALKKSGRGLFMLADVFGEAMQDWRNAKRKYPFGE*
Ga0075028_10030405123300006050WatershedsMLPTVIYLLEALRRAFKKSGRGLFILADSFREAMHDWRAAGRKYPFAE*
Ga0075364_1030676823300006051Populus EndosphereMLPTLIYLLASLGRALRKSGRGLFMLSDVLSEAMQDWRDMKRKYPFGE*
Ga0070715_1110250023300006163Corn, Switchgrass And Miscanthus RhizosphereMLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAA
Ga0070716_10138589523300006173Corn, Switchgrass And Miscanthus RhizosphereRRALKKSGRGLFIVADASREAMHDWRAARHKYPFAE*
Ga0075362_1018151623300006177Populus EndosphereMLPTVIYLLEALRRALKKSGRGLFIVAEAFREAMNDWRAAKRKYPFAE*
Ga0075367_1036428223300006178Populus EndosphereMLPTLIYLLEHLRRALKKSGRGLFIVADAFQEAMHDWRAAKRKYPFGE*
Ga0075369_1015506513300006186Populus EndosphereMLPTLIYLLENLRRALKKSGRGLFIVTDAFQEAMQDWRDAKRKYPFSE*
Ga0097621_10216458413300006237Miscanthus RhizosphereTTTQEQEDYPMLPTVIYLIEAIRRALKKSGRGVFMLVDVFGEAMEDWRKAKRKYPFAE*
Ga0068871_10086185413300006358Miscanthus RhizosphereMLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAARRK
Ga0075522_1004076223300006638Arctic Peat SoilMATLPVLIHLLDIIRRTVKKSGRGLFVVADAFGEAMRDWREAGRKYPFAE*
Ga0075521_1023580913300006642Arctic Peat SoilMLPTVIYLLEAIRRALKKSGRGIFMLVDVFGEAMDDWRKAKRKYPFAE*
Ga0068865_10119955813300006881Miscanthus RhizosphereMLPTVIYLIEAIRRALEKSGRGVFMLVDVFGEAMEDWRKAKRKYPFAE*
Ga0097620_10149383423300006931Switchgrass RhizosphereAIRRALKKSGRGVFMLVDVFGEAMEDWRKAKRKYPFAE*
Ga0105240_1254151123300009093Corn RhizosphereMLPTVIYLLEALRRALKKSGRGLSMIVDVFREAMGEWRAAQRKYPFAE*
Ga0105245_1165511213300009098Miscanthus RhizosphereMLPTLIYLFEILRRALKKSGRGLFMLSDVLSEAMQDWRNAARKYPFGE*
Ga0066709_10141749823300009137Grasslands SoilMLPTVIYLLEALRRALKKSSRGLFIVADAFGEAMHDWRAAKRKYPFAE*
Ga0105243_1040674523300009148Miscanthus RhizosphereMLPTVIYLLETLRRALKKSGRGLFMVADAFREAMHDWRAAKRKYPFAE*
Ga0105243_1189553013300009148Miscanthus RhizosphereIRRALKKSGRGVFMLIDVFGEAMDDWRKAKRKYPFAE*
Ga0111538_1123354513300009156Populus RhizosphereMLPTVIVLIDAIRRALKKSGRGLFMIVDVFQEAMSHWRAAQRKYPFAE*
Ga0105241_1082698123300009174Corn RhizosphereMLPTVILLIDVIRRALKKSGRGLSMIVDVFREAMGEWRAAQRKYPFAE*
Ga0105241_1235565913300009174Corn RhizosphereTQEQEDYPMLPTVIYLIEAIRRALKKSGRGVFMLVDVFGEAMEDWRKAKRKYPFAE*
Ga0105242_1186234713300009176Miscanthus RhizosphereRALKKSSRGVFMLVDVFGEAMEDWRKARRKYPFAE*
Ga0105854_136656923300009660Permafrost SoilMLPTVIYLLEALRRAFKKSGRGLFIVAESFREAMHDWRAARRKYPFAE*
Ga0105858_124228613300009661Permafrost SoilMLPTVIYLFKALRRAFKKSGRGLFIVAESFREAMHDWRAARRKYPFAE
Ga0126314_1146010613300010042Serpentine SoilMLPTVIYLIQAIRRALKKSGRGASMLVDVFGEAMEDWRKAKRKYPFAE*
Ga0126310_1003709833300010044Serpentine SoilMLPTVIYLLKALRRALKKSGRGLFIVADAFREAMHDWRAAKRKYPFAE*
Ga0099796_1027284323300010159Vadose Zone SoilMLPTVMYLLEALRRALKKSGRGLFMLADVFREAMHDWREAKRKYPFAE*
Ga0126306_1024348913300010166Serpentine SoilLIEAIRRALKKSRRGMFIVADAFQEAMHDWRAAKRKYPFAE*
Ga0134066_1018929623300010364Grasslands SoilMLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAARRKYPFVE*
Ga0134125_1198100623300010371Terrestrial SoilMLPTIVYLLEALRRALKRAGRGLFIVAEAFGEARDAARHYPFAE*
Ga0134122_1041676623300010400Terrestrial SoilMLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAAKRKYPFAE*
Ga0126350_1213668523300010880Boreal Forest SoilRALKKSGRGLFIVADSFREAMHDWREAGRKYPFAE*
Ga0105246_1106588313300011119Miscanthus RhizosphereMLPIIIHLLEALRRALNKSGRGLSLIADAFQEAMQD
Ga0137399_1116518513300012203Vadose Zone SoilMLPTVIYLLAALRRALKKSGRGLFIVADAFREAMQDWRAARRKYPFAE*
Ga0150985_11396269123300012212Avena Fatua RhizosphereMLPTVIYVIEALRRALKKSGRGLFIVADAFGEAMHDWRAAKRKYPFAE*
Ga0137398_1060704923300012683Vadose Zone SoilMLPTVIYLLEALRRALKKSGRGLFMLADVFREAMHDWRTAKRKYPFAE*
Ga0157296_1007018233300012905SoilMLPTVVYLLEAIRRALKKSRRGMFIVADAFQEAMHDW
Ga0157286_1008505413300012908SoilTTTQEQEDDPMLPTVIYLIEAIRRALKKSGRGVFMLIDVFGEAMDDWRKAKRKYPFAE*
Ga0157301_1032043323300012911SoilMLPTVILLIDAIRRALKKSGRGLFIVADAFREAMHDWRAAKRKYPFAE*
Ga0137416_1184418323300012927Vadose Zone SoilMLPTVIYLLAALRRALKKSGRGLFMLADVFREAMHDWREAKRKYPFAE*
Ga0137404_1011150723300012929Vadose Zone SoilMLPTVIYLLEALRRALKKSGRGLFVVADVFREAMHDWRAAKRKYPFAE*
Ga0164298_1053246523300012955SoilMLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAAQRKYPFAE*
Ga0164298_1063487623300012955SoilMLPAVIYLLETLRRALKKSGRGLFIVADAFREAMHDWRAAKRKYPFAE*
Ga0164298_1096295913300012955SoilMLLTVIYLIEAIRRALQKSGRGVFMLIDVFGEAMEDWRKAKRKYPFAE*
Ga0164305_1045854123300012989SoilMLPTVIYLIEAIRRALQKSGRGVFMLIDVFGEAMEDWRKAKRKYPFAE*
Ga0164305_1179762723300012989SoilMLPIIVFLLDALRRALNKSGRGVLLLIDVFGEAMQDWRNAARKYPYAE*
Ga0163162_1172245223300013306Switchgrass RhizosphereMANTFARTKDTAMLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAAKQKYPFAE
Ga0157380_1025455813300014326Switchgrass RhizosphereLIEAIRRALEKSGRGVFMLVDVFGEAMEDWRKAKRKYPFAE*
Ga0157380_1247184623300014326Switchgrass RhizosphereMLPTVVYLLEAIRRALKKSRRGMFIVADAFQEAMQDWRKAHRRYPFSE*
Ga0157380_1257701923300014326Switchgrass RhizosphereMANTFARTKDTAMLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAAK
Ga0157376_1148310013300014969Miscanthus RhizosphereIRRALQKSGRGVFMLVDVFSEAMEDWRQAQRKYPFAE*
Ga0173483_1020785223300015077SoilMLPTIIYLIEAIRRALKKSGRGVFMLIDVFGEAMDDWRKAKRKYPFAE*
Ga0173478_1043693923300015201SoilMLPTVVYLLEAIRRALKKSRRGMFIVADAFQEAMHDWRAAKRK
Ga0137403_1020331843300015264Vadose Zone SoilMLPTVIYLLEALRRALKKSGRGLFVVADAFREAMHDWRAAKRKYPFAE*
Ga0132255_10458445713300015374Arabidopsis RhizosphereVIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAAKQKYPFAE*
Ga0190270_1051565023300018469SoilMLPTVVYLLEAIRRALKKSRRGMFIVADAFQEAMHDWRAAKRKYPFAE
Ga0190274_1139775733300018476SoilMLPTVVYLIEAIRRALKKSGRGLLIVADAFREAMHDWRQAKRKYPFAE
Ga0190274_1172956413300018476SoilMLPTVIFLIDAIRRALKKSGRGLFMIVDVFQEAMAQWRAAQRKYPFAE
Ga0190274_1192443523300018476SoilMLPTVIYLLEALRRAFKKSGRGLFILADSFREAMHDWRAAKRKYPFAE
Ga0066669_1221824413300018482Grasslands SoilMLPTVIYLLEALRRALKKSGRALFIVADAFREAMHDWRAARRKYPFVE
Ga0173481_1003733623300019356SoilMLPTVIYLIEAIRRALKKSGRGVFMLVDVFGEAMDDWRKAKRKYPFAE
Ga0173482_1061865323300019361SoilMLPTVIYLIEAIRRALKKSGRGVFMLIDVFGEAMDDWRKAKRKYPFAE
Ga0173479_1002544733300019362SoilMLPTVIYLIEAIRRALKKSGRGVFMLVDVFGEAMEDWRKAKRKYPFAE
Ga0190267_1049751823300019767SoilMLPTVIYLIEAIRRALEKSGRGVFMLVDVFGEAMEDWRKAKRKYPFAE
Ga0193717_104475623300020060SoilMLPIVVYLLEALRRALNKSSRGLFMLADAFREAMQHWREAKRKYPFAE
Ga0194051_106021033300021470Anoxic Zone FreshwaterMLPMMIYLLQAVRRALNKSSRGMLMLADVFQEAMQDWREAKRKYPFAE
Ga0207697_1004168823300025315Corn, Switchgrass And Miscanthus RhizosphereMLPTVIYLLETLRRALKKSGRGLFIVADAFREAMHDWRAAKRKYPFAE
Ga0209483_107483723300025862Arctic Peat SoilMATLPVLIHLLDIIRRTVKKSGRGLFVVADAFGEAMRDWREAGRKYPFAE
Ga0207642_1001814723300025899Miscanthus RhizosphereMLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAAKQKYPFAE
Ga0207680_1138109523300025903Switchgrass RhizosphereTAMLPTVIYLLETLRRALKKSGRGLFIVADAFREAMHDWRAAKRKYPFAE
Ga0207685_1013572113300025905Corn, Switchgrass And Miscanthus RhizosphereMLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAARRKYPF
Ga0207685_1044636823300025905Corn, Switchgrass And Miscanthus RhizosphereMLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHEWRVAGRKYPFAE
Ga0207681_1035848523300025923Switchgrass RhizosphereMLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAAKRKYPFAE
Ga0207687_1168976613300025927Miscanthus RhizosphereMLPTVIYLIEAIRRALKKSSRGVFMLVDVFGEAMEDWRK
Ga0207701_1048514923300025930Corn, Switchgrass And Miscanthus RhizosphereMLPTVIYLIEAIRRALQKSGRGVFMLVDVFSEAMEDWRQAQRKYPFAE
Ga0207644_1020387933300025931Switchgrass RhizosphereMLPTVIYLLEALRRALKKSGRGLFIVADAFREAMH
Ga0207644_1034451323300025931Switchgrass RhizosphereKQKDAAMLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDARRKYPFAE
Ga0207706_1160134613300025933Corn RhizosphereKPNLATTLARTKDAAMLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAAKRKYPFAE
Ga0207709_1163585313300025935Miscanthus RhizosphereNKPHKNKGRVPMLPTVILLIDAIRRALKKSGRGVFMLIDVFGEAMDDWRKAKRKYPFAE
Ga0207689_1016055413300025942Miscanthus RhizosphereMLPTVIYLIEAIRRALKKSSRGVFMLVDVFGEAMEDWRKARRKYPFAE
Ga0207679_1061822423300025945Corn RhizosphereMLPTVIYLIEAIRRALKKSGRGVFMLVDVFGEAMEDWR
Ga0207677_1093183313300026023Miscanthus RhizosphereMLPTVIYLIDAIRRALQKSGRGVFMLIDVFGEAMEDWRKAKRKYPFAE
Ga0207677_1114599533300026023Miscanthus RhizosphereMLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAAKQKYP
Ga0207677_1228783523300026023Miscanthus RhizosphereMLPILIHLLKALQRALNKSGRGLSLLADTFQEAMHDWREAKKKYPFAE
Ga0207708_1071651023300026075Corn, Switchgrass And Miscanthus RhizosphereMLPTVIVLIDAIRRALKKSGRGVFMLVDVFGEAMEDWRKAKRKYPFAE
Ga0209068_1068104323300027894WatershedsMLPTVIYLLEALRRAFKKSGRGLFILADSFREAMHDWRAAGRKYPFAE
Ga0209488_1030218123300027903Vadose Zone SoilMLPTVIYLLEALRRALKKSGRGLFMLADVFREAMHDWRTAKRKYPFAE
Ga0209069_1024851023300027915WatershedsMLPTVIYLLEALRRAFKKSGRGLFIVADAFREAMHDWRAAGRKYPFAE
Ga0268266_1047772013300028379Switchgrass RhizosphereMLPTLIYLLENLRRALKKSGRGLFMLADVFGEAMQDWRDAKRKYPFGE
Ga0268264_1194454613300028381Switchgrass RhizosphereMLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDWR
Ga0307503_1004903223300028802SoilMLPTVVYLLEAIRRALKKIRRGMFIVADAFQEAMHDWRAAKRKYPFAE
Ga0307294_1019871713300028810SoilMLPTVIYLIEAIRRALKKSGRGASMLVDVFGEAMEDWRKAKRKYPFAE
Ga0075376_1121179023300030968SoilMATLPVIIYLLEIIRRAAKKSGRGLFLVAGAFGEAMRDWREAGRKYPFAE
Ga0074003_1370283023300031003SoilMLPTVIYLIEALRRALQKSGRGLFIVADAFQEAMHDWREAKRKYPFGE
Ga0307496_1007732813300031200SoilMLPTVIYLIEAIRRALKKSGRGLFMIVDVFQEAMSHWRAAQRKYPFAE
Ga0302323_10340241313300031232FenMLPTVIYLLEALRRAFKKSGRGLFIVAASFREAMRDWRAAGRKYPFAE
Ga0265340_1014504523300031247RhizosphereTVIYLLDAIRRALKKSGRGLSMVAGAFHEAMADWRAAGRKYPFAE
Ga0310907_1005520013300031847SoilEDDPMLPTVIYLIEAIRRALKKSGRGVFMLIDVFGEAMDDWRKAKRKYPFAE
Ga0310900_1044227113300031908SoilSLTTTQEQEDDPMLPTVIYLIEAIRRALKKSGRGVFMLIDVFGEAMDDWRKAKRKYPFAE
Ga0308175_10165396213300031938SoilEALRRALNKSGRGLLLVAAAFHEAMNDWRKANRKYPFAE
Ga0310906_1025991413300032013SoilMLPTVIYLIEAIRRALKKSGRGVFMLIDVFGEAMDDWRK
Ga0307472_10136819723300032205Hardwood Forest SoilMLPTMIFLIDAIRRALKKSGRSLFMIVDVFREAMGQWRAAQRKYPFAE
Ga0372943_0655685_3_1283300034268SoilLLEALRRALKKSGRGLSIVADAFREAMHDWRAAKRKYPFAE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.