| Basic Information | |
|---|---|
| Family ID | F054365 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 140 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAAKRKYPFAE |
| Number of Associated Samples | 119 |
| Number of Associated Scaffolds | 140 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 77.14 % |
| % of genes near scaffold ends (potentially truncated) | 34.29 % |
| % of genes from short scaffolds (< 2000 bps) | 95.71 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (64.286 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.714 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (59.286 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.63% β-sheet: 0.00% Coil/Unstructured: 47.37% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 140 Family Scaffolds |
|---|---|---|
| PF01557 | FAA_hydrolase | 19.29 |
| PF00497 | SBP_bac_3 | 3.57 |
| PF13450 | NAD_binding_8 | 2.14 |
| PF00842 | Ala_racemase_C | 0.71 |
| PF01494 | FAD_binding_3 | 0.71 |
| PF07687 | M20_dimer | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 140 Family Scaffolds |
|---|---|---|---|
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.43 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.71 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.71 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.71 |
| COG0787 | Alanine racemase | Cell wall/membrane/envelope biogenesis [M] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 64.29 % |
| Unclassified | root | N/A | 35.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002155|JGI24033J26618_1046472 | Not Available | 615 | Open in IMG/M |
| 3300002568|C688J35102_120910222 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2232 | Open in IMG/M |
| 3300004081|Ga0063454_101609929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300004114|Ga0062593_100812030 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300004114|Ga0062593_101422515 | Not Available | 742 | Open in IMG/M |
| 3300004479|Ga0062595_100189766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1256 | Open in IMG/M |
| 3300004479|Ga0062595_100988901 | Not Available | 721 | Open in IMG/M |
| 3300004480|Ga0062592_100495636 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300004480|Ga0062592_102673485 | Not Available | 504 | Open in IMG/M |
| 3300004643|Ga0062591_101283596 | Not Available | 719 | Open in IMG/M |
| 3300005093|Ga0062594_101154334 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300005093|Ga0062594_102790238 | Not Available | 543 | Open in IMG/M |
| 3300005148|Ga0066819_1010665 | Not Available | 658 | Open in IMG/M |
| 3300005328|Ga0070676_10954838 | Not Available | 641 | Open in IMG/M |
| 3300005328|Ga0070676_11146915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300005329|Ga0070683_102342033 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300005331|Ga0070670_101440164 | Not Available | 632 | Open in IMG/M |
| 3300005333|Ga0070677_10165543 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300005334|Ga0068869_100842017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 791 | Open in IMG/M |
| 3300005338|Ga0068868_101925246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300005353|Ga0070669_101442967 | Not Available | 598 | Open in IMG/M |
| 3300005356|Ga0070674_100074266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2413 | Open in IMG/M |
| 3300005438|Ga0070701_10553634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 755 | Open in IMG/M |
| 3300005441|Ga0070700_100488381 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300005441|Ga0070700_101703117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300005441|Ga0070700_102021462 | Not Available | 500 | Open in IMG/M |
| 3300005456|Ga0070678_102125686 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300005459|Ga0068867_101062451 | Not Available | 737 | Open in IMG/M |
| 3300005518|Ga0070699_100543512 | Not Available | 1057 | Open in IMG/M |
| 3300005545|Ga0070695_101137644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300005546|Ga0070696_100671669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 842 | Open in IMG/M |
| 3300005616|Ga0068852_102271280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 564 | Open in IMG/M |
| 3300005616|Ga0068852_102582079 | Not Available | 528 | Open in IMG/M |
| 3300005841|Ga0068863_100662360 | Not Available | 1036 | Open in IMG/M |
| 3300005842|Ga0068858_101215365 | Not Available | 741 | Open in IMG/M |
| 3300006028|Ga0070717_10584514 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300006048|Ga0075363_100467876 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300006050|Ga0075028_100304051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 890 | Open in IMG/M |
| 3300006051|Ga0075364_10306768 | Not Available | 1081 | Open in IMG/M |
| 3300006163|Ga0070715_11102500 | Not Available | 500 | Open in IMG/M |
| 3300006173|Ga0070716_101385895 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300006177|Ga0075362_10181516 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300006178|Ga0075367_10364282 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300006186|Ga0075369_10155065 | Not Available | 1048 | Open in IMG/M |
| 3300006237|Ga0097621_102164584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 532 | Open in IMG/M |
| 3300006358|Ga0068871_100861854 | Not Available | 838 | Open in IMG/M |
| 3300006638|Ga0075522_10040762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2752 | Open in IMG/M |
| 3300006642|Ga0075521_10235809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 873 | Open in IMG/M |
| 3300006881|Ga0068865_101199558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 672 | Open in IMG/M |
| 3300006931|Ga0097620_101493834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 746 | Open in IMG/M |
| 3300009093|Ga0105240_12541511 | Not Available | 529 | Open in IMG/M |
| 3300009098|Ga0105245_11655112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 692 | Open in IMG/M |
| 3300009137|Ga0066709_101417498 | Not Available | 1009 | Open in IMG/M |
| 3300009148|Ga0105243_10406745 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
| 3300009148|Ga0105243_11895530 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300009156|Ga0111538_11233545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 945 | Open in IMG/M |
| 3300009174|Ga0105241_10826981 | Not Available | 855 | Open in IMG/M |
| 3300009174|Ga0105241_12355659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300009176|Ga0105242_11862347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 641 | Open in IMG/M |
| 3300009660|Ga0105854_1366569 | Not Available | 517 | Open in IMG/M |
| 3300009661|Ga0105858_1242286 | Not Available | 546 | Open in IMG/M |
| 3300010042|Ga0126314_11460106 | Not Available | 514 | Open in IMG/M |
| 3300010044|Ga0126310_10037098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2610 | Open in IMG/M |
| 3300010159|Ga0099796_10272843 | Not Available | 709 | Open in IMG/M |
| 3300010166|Ga0126306_10243489 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
| 3300010364|Ga0134066_10189296 | Not Available | 675 | Open in IMG/M |
| 3300010371|Ga0134125_11981006 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300010400|Ga0134122_10416766 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300010880|Ga0126350_12136685 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300011119|Ga0105246_11065883 | Not Available | 736 | Open in IMG/M |
| 3300012203|Ga0137399_11165185 | Not Available | 649 | Open in IMG/M |
| 3300012212|Ga0150985_113962691 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300012683|Ga0137398_10607049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 757 | Open in IMG/M |
| 3300012905|Ga0157296_10070182 | Not Available | 882 | Open in IMG/M |
| 3300012908|Ga0157286_10085054 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300012911|Ga0157301_10320433 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300012927|Ga0137416_11844183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300012929|Ga0137404_10111507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2222 | Open in IMG/M |
| 3300012955|Ga0164298_10532465 | Not Available | 792 | Open in IMG/M |
| 3300012955|Ga0164298_10634876 | Not Available | 739 | Open in IMG/M |
| 3300012955|Ga0164298_10962959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 627 | Open in IMG/M |
| 3300012989|Ga0164305_10458541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 992 | Open in IMG/M |
| 3300012989|Ga0164305_11797627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300013306|Ga0163162_11722452 | Not Available | 716 | Open in IMG/M |
| 3300014326|Ga0157380_10254558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 1591 | Open in IMG/M |
| 3300014326|Ga0157380_12471846 | Not Available | 585 | Open in IMG/M |
| 3300014326|Ga0157380_12577019 | Not Available | 575 | Open in IMG/M |
| 3300014969|Ga0157376_11483100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 711 | Open in IMG/M |
| 3300015077|Ga0173483_10207852 | Not Available | 906 | Open in IMG/M |
| 3300015201|Ga0173478_10436939 | Not Available | 638 | Open in IMG/M |
| 3300015264|Ga0137403_10203318 | All Organisms → cellular organisms → Bacteria | 1912 | Open in IMG/M |
| 3300015374|Ga0132255_104584457 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300018469|Ga0190270_10515650 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300018476|Ga0190274_11397757 | Not Available | 789 | Open in IMG/M |
| 3300018476|Ga0190274_11729564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300018476|Ga0190274_11924435 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300018482|Ga0066669_12218244 | Not Available | 521 | Open in IMG/M |
| 3300019356|Ga0173481_10037336 | All Organisms → cellular organisms → Bacteria | 1600 | Open in IMG/M |
| 3300019361|Ga0173482_10618653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300019362|Ga0173479_10025447 | All Organisms → cellular organisms → Bacteria | 1737 | Open in IMG/M |
| 3300019767|Ga0190267_10497518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 719 | Open in IMG/M |
| 3300020060|Ga0193717_1044756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1607 | Open in IMG/M |
| 3300021470|Ga0194051_1060210 | All Organisms → cellular organisms → Bacteria | 1391 | Open in IMG/M |
| 3300025315|Ga0207697_10041688 | All Organisms → cellular organisms → Bacteria | 1885 | Open in IMG/M |
| 3300025862|Ga0209483_1074837 | All Organisms → cellular organisms → Bacteria | 1530 | Open in IMG/M |
| 3300025899|Ga0207642_10018147 | All Organisms → cellular organisms → Bacteria | 2694 | Open in IMG/M |
| 3300025903|Ga0207680_11381095 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300025905|Ga0207685_10135721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1097 | Open in IMG/M |
| 3300025905|Ga0207685_10446368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 672 | Open in IMG/M |
| 3300025923|Ga0207681_10358485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1169 | Open in IMG/M |
| 3300025927|Ga0207687_11689766 | Not Available | 543 | Open in IMG/M |
| 3300025930|Ga0207701_10485149 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300025931|Ga0207644_10203879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1561 | Open in IMG/M |
| 3300025931|Ga0207644_10344513 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300025933|Ga0207706_11601346 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300025935|Ga0207709_11635853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300025942|Ga0207689_10160554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1852 | Open in IMG/M |
| 3300025945|Ga0207679_10618224 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300026023|Ga0207677_10931833 | Not Available | 784 | Open in IMG/M |
| 3300026023|Ga0207677_11145995 | Not Available | 710 | Open in IMG/M |
| 3300026023|Ga0207677_12287835 | Not Available | 503 | Open in IMG/M |
| 3300026075|Ga0207708_10716510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 856 | Open in IMG/M |
| 3300027894|Ga0209068_10681043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 602 | Open in IMG/M |
| 3300027903|Ga0209488_10302181 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300027915|Ga0209069_10248510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 925 | Open in IMG/M |
| 3300028379|Ga0268266_10477720 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300028381|Ga0268264_11944546 | Not Available | 598 | Open in IMG/M |
| 3300028802|Ga0307503_10049032 | All Organisms → cellular organisms → Bacteria | 1600 | Open in IMG/M |
| 3300028810|Ga0307294_10198717 | Not Available | 691 | Open in IMG/M |
| 3300030968|Ga0075376_11211790 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300031003|Ga0074003_13702830 | Not Available | 889 | Open in IMG/M |
| 3300031200|Ga0307496_10077328 | Not Available | 612 | Open in IMG/M |
| 3300031232|Ga0302323_103402413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300031247|Ga0265340_10145045 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300031847|Ga0310907_10055200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1559 | Open in IMG/M |
| 3300031908|Ga0310900_10442271 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300031938|Ga0308175_101653962 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300032013|Ga0310906_10259914 | Not Available | 1088 | Open in IMG/M |
| 3300032205|Ga0307472_101368197 | Not Available | 685 | Open in IMG/M |
| 3300034268|Ga0372943_0655685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 691 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.71% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 6.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 6.43% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.00% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.86% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.14% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.14% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.14% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.14% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.14% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.43% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.43% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.43% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.43% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.43% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.71% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.71% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.71% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.71% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.71% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.71% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.71% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Host-Associated | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005148 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMA | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006177 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Host-Associated | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006186 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009660 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 | Environmental | Open in IMG/M |
| 3300009661 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
| 3300021470 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L239-20m | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300030968 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031003 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter GP-3A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031200 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_S | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24033J26618_10464721 | 3300002155 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPTVIYLLETLRRALKKSGRGLFIVADAFREAMHDWRAAKRKYPF |
| C688J35102_1209102223 | 3300002568 | Soil | MLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAARRKYPFAE* |
| Ga0063454_1016099292 | 3300004081 | Soil | LLEALRRALKKSGRGLFIVADAFREAMHDWRAARRKYPFAE* |
| Ga0062593_1008120301 | 3300004114 | Soil | MLPIIVFLLDALRRALNKSGRGVLLLIDVFGEAMQDWRNAGRKYPYAE* |
| Ga0062593_1014225151 | 3300004114 | Soil | MLPTVIYLLETLRRALKKSGRGLFIVADAFREAMHDWRAAKRKYPFAE* |
| Ga0062595_1001897661 | 3300004479 | Soil | MLPTVVYLLEAIRRALKKIRRGMFIVADAFQEAMHDWRAAKRKYPFAE* |
| Ga0062595_1009889012 | 3300004479 | Soil | MLPTVILLIDAIRRALKKSGRGLSMIVDVFREAMGEWRAAQRKYPFAE* |
| Ga0062592_1004956362 | 3300004480 | Soil | MLPTVVYLLEAIRRALKKSRRGMFIVADAFQEAMHDWRAAKRKYPFAE* |
| Ga0062592_1026734852 | 3300004480 | Soil | MLPIIIHLLEALRRALNKSGRGLSLIADAFQEAMQDWRKAHRRYPFSE* |
| Ga0062591_1012835962 | 3300004643 | Soil | MLPTVIVLIDAIRRALKKSGRGLFMIVDVFREAMGQWRAAQRKYPFAE* |
| Ga0062594_1011543342 | 3300005093 | Soil | MLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAAKQKYPFAE* |
| Ga0062594_1027902381 | 3300005093 | Soil | MLPTVVYLLEALRRALEKSGRGLFMVADAFREAMHDWRAAKRKYPFAE* |
| Ga0066819_10106652 | 3300005148 | Soil | MLPTVIYLLEALRRALKKSGRGLFIVAEAFREAMHDWRAA |
| Ga0070676_109548381 | 3300005328 | Miscanthus Rhizosphere | MLPTVIYLIEAIRRALKKSGRGLSMIVDVFREAMGEWRAAQRKYPFAE* |
| Ga0070676_111469152 | 3300005328 | Miscanthus Rhizosphere | MLPTLIYLLENLRRALKKSGRGLFIVADAFQEAMQDWRDAKRKYPFSE* |
| Ga0070683_1023420332 | 3300005329 | Corn Rhizosphere | MLPTVVYLLEALRRALKRAGRGLFIVAEAFGEARDAARHYPFAE* |
| Ga0070670_1014401642 | 3300005331 | Switchgrass Rhizosphere | MLPTVIYLIEAIRRALKKSGRGVFMLVDVFGEAMEDWRKAKRKYPFAE* |
| Ga0070677_101655431 | 3300005333 | Miscanthus Rhizosphere | YPMLPTVIYLIEAIRRALKKSGRGVFMLVDVFGEAMEDWRKAKRKYPFAE* |
| Ga0068869_1008420171 | 3300005334 | Miscanthus Rhizosphere | MLPTVIYLIEAIRRALKKSSRGVFMLVDVFGEAMEDWRKARRKYPFAE* |
| Ga0068868_1019252462 | 3300005338 | Miscanthus Rhizosphere | DDPMLPTVIYLIEAIRRALKKSGRGASMLVDVFGEAMEDWRKAKRKYPFAE* |
| Ga0070669_1014429673 | 3300005353 | Switchgrass Rhizosphere | MLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAAK |
| Ga0070674_1000742663 | 3300005356 | Miscanthus Rhizosphere | MLPTVIYLIEAIRRALKKSGRGVFMLIDVFGEAMEDWRKAKRKYPFAE* |
| Ga0070701_105536341 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPTVIYLIEAIRRALKKSSRGVFMLVDVFGEAMEDWRKAKRKYPFAE* |
| Ga0070700_1004883812 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | QEDYPMLPTVIYLIEAIRRALKKSGRGVFMLVDVFGEAMEDWRKAKRKYPFAE* |
| Ga0070700_1017031171 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | LIDAIRRALKKSGRGLFMMVDVFQEAMGQWRAAQRKYPFAE* |
| Ga0070700_1020214622 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPTVIYLLETLRRALKKSGRGLFIVADAFREAMHDWRAA |
| Ga0070678_1021256862 | 3300005456 | Miscanthus Rhizosphere | ISPMLPIIVFLLDALRRALNKSGRGVLLLIDVFGEAMQDWRNAGREYPYAE* |
| Ga0068867_1010624512 | 3300005459 | Miscanthus Rhizosphere | MLPTVIYLIEALRRALRKSTRGMFIVADAFQVAMHDWREAKRKYPFAE* |
| Ga0070699_1005435121 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPTVIYLLDAIRRALKKSGRGLSMVAGAFHEAMADWRAAGRKYPFAE* |
| Ga0070695_1011376442 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPAVIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAAKRKYPFAE* |
| Ga0070696_1006716692 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPTVIYLLDAIRRALKKSGRGLSMIVDVFREAMGEWRAAQRKYPFAE* |
| Ga0068852_1022712802 | 3300005616 | Corn Rhizosphere | TVIYLIEAIRRALKKSGRGVFMLVDVFGEAMEDWRKAKRKYPFAE* |
| Ga0068852_1025820792 | 3300005616 | Corn Rhizosphere | MLPTVIYLLETLRRALKKSGRGLFIVADAFREAMHDWRAARRKYPFAE* |
| Ga0068863_1006623601 | 3300005841 | Switchgrass Rhizosphere | MLPTVIYLIEAIRRALKKSGRGVFMLIDVFGEAMDDWRKAKRKYPFAE* |
| Ga0068858_1012153652 | 3300005842 | Switchgrass Rhizosphere | MLPTVILLIDAIRRALKKSGRGLSMIVDVFREAMGQWRAAQRKYPFAE* |
| Ga0070717_105845142 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPVVIYLLEALRRALKKSGRGLFIVADAFREAMQDWRAAGRKYPFAE* |
| Ga0075363_1004678762 | 3300006048 | Populus Endosphere | MLPTVIYLLEALRRALKKSGRGLFMLADVFGEAMQDWRNAKRKYPFGE* |
| Ga0075028_1003040512 | 3300006050 | Watersheds | MLPTVIYLLEALRRAFKKSGRGLFILADSFREAMHDWRAAGRKYPFAE* |
| Ga0075364_103067682 | 3300006051 | Populus Endosphere | MLPTLIYLLASLGRALRKSGRGLFMLSDVLSEAMQDWRDMKRKYPFGE* |
| Ga0070715_111025002 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAA |
| Ga0070716_1013858952 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | RRALKKSGRGLFIVADASREAMHDWRAARHKYPFAE* |
| Ga0075362_101815162 | 3300006177 | Populus Endosphere | MLPTVIYLLEALRRALKKSGRGLFIVAEAFREAMNDWRAAKRKYPFAE* |
| Ga0075367_103642822 | 3300006178 | Populus Endosphere | MLPTLIYLLEHLRRALKKSGRGLFIVADAFQEAMHDWRAAKRKYPFGE* |
| Ga0075369_101550651 | 3300006186 | Populus Endosphere | MLPTLIYLLENLRRALKKSGRGLFIVTDAFQEAMQDWRDAKRKYPFSE* |
| Ga0097621_1021645841 | 3300006237 | Miscanthus Rhizosphere | TTTQEQEDYPMLPTVIYLIEAIRRALKKSGRGVFMLVDVFGEAMEDWRKAKRKYPFAE* |
| Ga0068871_1008618541 | 3300006358 | Miscanthus Rhizosphere | MLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAARRK |
| Ga0075522_100407622 | 3300006638 | Arctic Peat Soil | MATLPVLIHLLDIIRRTVKKSGRGLFVVADAFGEAMRDWREAGRKYPFAE* |
| Ga0075521_102358091 | 3300006642 | Arctic Peat Soil | MLPTVIYLLEAIRRALKKSGRGIFMLVDVFGEAMDDWRKAKRKYPFAE* |
| Ga0068865_1011995581 | 3300006881 | Miscanthus Rhizosphere | MLPTVIYLIEAIRRALEKSGRGVFMLVDVFGEAMEDWRKAKRKYPFAE* |
| Ga0097620_1014938342 | 3300006931 | Switchgrass Rhizosphere | AIRRALKKSGRGVFMLVDVFGEAMEDWRKAKRKYPFAE* |
| Ga0105240_125415112 | 3300009093 | Corn Rhizosphere | MLPTVIYLLEALRRALKKSGRGLSMIVDVFREAMGEWRAAQRKYPFAE* |
| Ga0105245_116551121 | 3300009098 | Miscanthus Rhizosphere | MLPTLIYLFEILRRALKKSGRGLFMLSDVLSEAMQDWRNAARKYPFGE* |
| Ga0066709_1014174982 | 3300009137 | Grasslands Soil | MLPTVIYLLEALRRALKKSSRGLFIVADAFGEAMHDWRAAKRKYPFAE* |
| Ga0105243_104067452 | 3300009148 | Miscanthus Rhizosphere | MLPTVIYLLETLRRALKKSGRGLFMVADAFREAMHDWRAAKRKYPFAE* |
| Ga0105243_118955301 | 3300009148 | Miscanthus Rhizosphere | IRRALKKSGRGVFMLIDVFGEAMDDWRKAKRKYPFAE* |
| Ga0111538_112335451 | 3300009156 | Populus Rhizosphere | MLPTVIVLIDAIRRALKKSGRGLFMIVDVFQEAMSHWRAAQRKYPFAE* |
| Ga0105241_108269812 | 3300009174 | Corn Rhizosphere | MLPTVILLIDVIRRALKKSGRGLSMIVDVFREAMGEWRAAQRKYPFAE* |
| Ga0105241_123556591 | 3300009174 | Corn Rhizosphere | TQEQEDYPMLPTVIYLIEAIRRALKKSGRGVFMLVDVFGEAMEDWRKAKRKYPFAE* |
| Ga0105242_118623471 | 3300009176 | Miscanthus Rhizosphere | RALKKSSRGVFMLVDVFGEAMEDWRKARRKYPFAE* |
| Ga0105854_13665692 | 3300009660 | Permafrost Soil | MLPTVIYLLEALRRAFKKSGRGLFIVAESFREAMHDWRAARRKYPFAE* |
| Ga0105858_12422861 | 3300009661 | Permafrost Soil | MLPTVIYLFKALRRAFKKSGRGLFIVAESFREAMHDWRAARRKYPFAE |
| Ga0126314_114601061 | 3300010042 | Serpentine Soil | MLPTVIYLIQAIRRALKKSGRGASMLVDVFGEAMEDWRKAKRKYPFAE* |
| Ga0126310_100370983 | 3300010044 | Serpentine Soil | MLPTVIYLLKALRRALKKSGRGLFIVADAFREAMHDWRAAKRKYPFAE* |
| Ga0099796_102728432 | 3300010159 | Vadose Zone Soil | MLPTVMYLLEALRRALKKSGRGLFMLADVFREAMHDWREAKRKYPFAE* |
| Ga0126306_102434891 | 3300010166 | Serpentine Soil | LIEAIRRALKKSRRGMFIVADAFQEAMHDWRAAKRKYPFAE* |
| Ga0134066_101892962 | 3300010364 | Grasslands Soil | MLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAARRKYPFVE* |
| Ga0134125_119810062 | 3300010371 | Terrestrial Soil | MLPTIVYLLEALRRALKRAGRGLFIVAEAFGEARDAARHYPFAE* |
| Ga0134122_104167662 | 3300010400 | Terrestrial Soil | MLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAAKRKYPFAE* |
| Ga0126350_121366852 | 3300010880 | Boreal Forest Soil | RALKKSGRGLFIVADSFREAMHDWREAGRKYPFAE* |
| Ga0105246_110658831 | 3300011119 | Miscanthus Rhizosphere | MLPIIIHLLEALRRALNKSGRGLSLIADAFQEAMQD |
| Ga0137399_111651851 | 3300012203 | Vadose Zone Soil | MLPTVIYLLAALRRALKKSGRGLFIVADAFREAMQDWRAARRKYPFAE* |
| Ga0150985_1139626912 | 3300012212 | Avena Fatua Rhizosphere | MLPTVIYVIEALRRALKKSGRGLFIVADAFGEAMHDWRAAKRKYPFAE* |
| Ga0137398_106070492 | 3300012683 | Vadose Zone Soil | MLPTVIYLLEALRRALKKSGRGLFMLADVFREAMHDWRTAKRKYPFAE* |
| Ga0157296_100701823 | 3300012905 | Soil | MLPTVVYLLEAIRRALKKSRRGMFIVADAFQEAMHDW |
| Ga0157286_100850541 | 3300012908 | Soil | TTTQEQEDDPMLPTVIYLIEAIRRALKKSGRGVFMLIDVFGEAMDDWRKAKRKYPFAE* |
| Ga0157301_103204332 | 3300012911 | Soil | MLPTVILLIDAIRRALKKSGRGLFIVADAFREAMHDWRAAKRKYPFAE* |
| Ga0137416_118441832 | 3300012927 | Vadose Zone Soil | MLPTVIYLLAALRRALKKSGRGLFMLADVFREAMHDWREAKRKYPFAE* |
| Ga0137404_101115072 | 3300012929 | Vadose Zone Soil | MLPTVIYLLEALRRALKKSGRGLFVVADVFREAMHDWRAAKRKYPFAE* |
| Ga0164298_105324652 | 3300012955 | Soil | MLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAAQRKYPFAE* |
| Ga0164298_106348762 | 3300012955 | Soil | MLPAVIYLLETLRRALKKSGRGLFIVADAFREAMHDWRAAKRKYPFAE* |
| Ga0164298_109629591 | 3300012955 | Soil | MLLTVIYLIEAIRRALQKSGRGVFMLIDVFGEAMEDWRKAKRKYPFAE* |
| Ga0164305_104585412 | 3300012989 | Soil | MLPTVIYLIEAIRRALQKSGRGVFMLIDVFGEAMEDWRKAKRKYPFAE* |
| Ga0164305_117976272 | 3300012989 | Soil | MLPIIVFLLDALRRALNKSGRGVLLLIDVFGEAMQDWRNAARKYPYAE* |
| Ga0163162_117224522 | 3300013306 | Switchgrass Rhizosphere | MANTFARTKDTAMLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAAKQKYPFAE |
| Ga0157380_102545581 | 3300014326 | Switchgrass Rhizosphere | LIEAIRRALEKSGRGVFMLVDVFGEAMEDWRKAKRKYPFAE* |
| Ga0157380_124718462 | 3300014326 | Switchgrass Rhizosphere | MLPTVVYLLEAIRRALKKSRRGMFIVADAFQEAMQDWRKAHRRYPFSE* |
| Ga0157380_125770192 | 3300014326 | Switchgrass Rhizosphere | MANTFARTKDTAMLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAAK |
| Ga0157376_114831001 | 3300014969 | Miscanthus Rhizosphere | IRRALQKSGRGVFMLVDVFSEAMEDWRQAQRKYPFAE* |
| Ga0173483_102078522 | 3300015077 | Soil | MLPTIIYLIEAIRRALKKSGRGVFMLIDVFGEAMDDWRKAKRKYPFAE* |
| Ga0173478_104369392 | 3300015201 | Soil | MLPTVVYLLEAIRRALKKSRRGMFIVADAFQEAMHDWRAAKRK |
| Ga0137403_102033184 | 3300015264 | Vadose Zone Soil | MLPTVIYLLEALRRALKKSGRGLFVVADAFREAMHDWRAAKRKYPFAE* |
| Ga0132255_1045844571 | 3300015374 | Arabidopsis Rhizosphere | VIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAAKQKYPFAE* |
| Ga0190270_105156502 | 3300018469 | Soil | MLPTVVYLLEAIRRALKKSRRGMFIVADAFQEAMHDWRAAKRKYPFAE |
| Ga0190274_113977573 | 3300018476 | Soil | MLPTVVYLIEAIRRALKKSGRGLLIVADAFREAMHDWRQAKRKYPFAE |
| Ga0190274_117295641 | 3300018476 | Soil | MLPTVIFLIDAIRRALKKSGRGLFMIVDVFQEAMAQWRAAQRKYPFAE |
| Ga0190274_119244352 | 3300018476 | Soil | MLPTVIYLLEALRRAFKKSGRGLFILADSFREAMHDWRAAKRKYPFAE |
| Ga0066669_122182441 | 3300018482 | Grasslands Soil | MLPTVIYLLEALRRALKKSGRALFIVADAFREAMHDWRAARRKYPFVE |
| Ga0173481_100373362 | 3300019356 | Soil | MLPTVIYLIEAIRRALKKSGRGVFMLVDVFGEAMDDWRKAKRKYPFAE |
| Ga0173482_106186532 | 3300019361 | Soil | MLPTVIYLIEAIRRALKKSGRGVFMLIDVFGEAMDDWRKAKRKYPFAE |
| Ga0173479_100254473 | 3300019362 | Soil | MLPTVIYLIEAIRRALKKSGRGVFMLVDVFGEAMEDWRKAKRKYPFAE |
| Ga0190267_104975182 | 3300019767 | Soil | MLPTVIYLIEAIRRALEKSGRGVFMLVDVFGEAMEDWRKAKRKYPFAE |
| Ga0193717_10447562 | 3300020060 | Soil | MLPIVVYLLEALRRALNKSSRGLFMLADAFREAMQHWREAKRKYPFAE |
| Ga0194051_10602103 | 3300021470 | Anoxic Zone Freshwater | MLPMMIYLLQAVRRALNKSSRGMLMLADVFQEAMQDWREAKRKYPFAE |
| Ga0207697_100416882 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPTVIYLLETLRRALKKSGRGLFIVADAFREAMHDWRAAKRKYPFAE |
| Ga0209483_10748372 | 3300025862 | Arctic Peat Soil | MATLPVLIHLLDIIRRTVKKSGRGLFVVADAFGEAMRDWREAGRKYPFAE |
| Ga0207642_100181472 | 3300025899 | Miscanthus Rhizosphere | MLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAAKQKYPFAE |
| Ga0207680_113810952 | 3300025903 | Switchgrass Rhizosphere | TAMLPTVIYLLETLRRALKKSGRGLFIVADAFREAMHDWRAAKRKYPFAE |
| Ga0207685_101357211 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAARRKYPF |
| Ga0207685_104463682 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHEWRVAGRKYPFAE |
| Ga0207681_103584852 | 3300025923 | Switchgrass Rhizosphere | MLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAAKRKYPFAE |
| Ga0207687_116897661 | 3300025927 | Miscanthus Rhizosphere | MLPTVIYLIEAIRRALKKSSRGVFMLVDVFGEAMEDWRK |
| Ga0207701_104851492 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPTVIYLIEAIRRALQKSGRGVFMLVDVFSEAMEDWRQAQRKYPFAE |
| Ga0207644_102038793 | 3300025931 | Switchgrass Rhizosphere | MLPTVIYLLEALRRALKKSGRGLFIVADAFREAMH |
| Ga0207644_103445132 | 3300025931 | Switchgrass Rhizosphere | KQKDAAMLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDARRKYPFAE |
| Ga0207706_116013461 | 3300025933 | Corn Rhizosphere | KPNLATTLARTKDAAMLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAAKRKYPFAE |
| Ga0207709_116358531 | 3300025935 | Miscanthus Rhizosphere | NKPHKNKGRVPMLPTVILLIDAIRRALKKSGRGVFMLIDVFGEAMDDWRKAKRKYPFAE |
| Ga0207689_101605541 | 3300025942 | Miscanthus Rhizosphere | MLPTVIYLIEAIRRALKKSSRGVFMLVDVFGEAMEDWRKARRKYPFAE |
| Ga0207679_106182242 | 3300025945 | Corn Rhizosphere | MLPTVIYLIEAIRRALKKSGRGVFMLVDVFGEAMEDWR |
| Ga0207677_109318331 | 3300026023 | Miscanthus Rhizosphere | MLPTVIYLIDAIRRALQKSGRGVFMLIDVFGEAMEDWRKAKRKYPFAE |
| Ga0207677_111459953 | 3300026023 | Miscanthus Rhizosphere | MLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDWRAAKQKYP |
| Ga0207677_122878352 | 3300026023 | Miscanthus Rhizosphere | MLPILIHLLKALQRALNKSGRGLSLLADTFQEAMHDWREAKKKYPFAE |
| Ga0207708_107165102 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MLPTVIVLIDAIRRALKKSGRGVFMLVDVFGEAMEDWRKAKRKYPFAE |
| Ga0209068_106810432 | 3300027894 | Watersheds | MLPTVIYLLEALRRAFKKSGRGLFILADSFREAMHDWRAAGRKYPFAE |
| Ga0209488_103021812 | 3300027903 | Vadose Zone Soil | MLPTVIYLLEALRRALKKSGRGLFMLADVFREAMHDWRTAKRKYPFAE |
| Ga0209069_102485102 | 3300027915 | Watersheds | MLPTVIYLLEALRRAFKKSGRGLFIVADAFREAMHDWRAAGRKYPFAE |
| Ga0268266_104777201 | 3300028379 | Switchgrass Rhizosphere | MLPTLIYLLENLRRALKKSGRGLFMLADVFGEAMQDWRDAKRKYPFGE |
| Ga0268264_119445461 | 3300028381 | Switchgrass Rhizosphere | MLPTVIYLLEALRRALKKSGRGLFIVADAFREAMHDWR |
| Ga0307503_100490322 | 3300028802 | Soil | MLPTVVYLLEAIRRALKKIRRGMFIVADAFQEAMHDWRAAKRKYPFAE |
| Ga0307294_101987171 | 3300028810 | Soil | MLPTVIYLIEAIRRALKKSGRGASMLVDVFGEAMEDWRKAKRKYPFAE |
| Ga0075376_112117902 | 3300030968 | Soil | MATLPVIIYLLEIIRRAAKKSGRGLFLVAGAFGEAMRDWREAGRKYPFAE |
| Ga0074003_137028302 | 3300031003 | Soil | MLPTVIYLIEALRRALQKSGRGLFIVADAFQEAMHDWREAKRKYPFGE |
| Ga0307496_100773281 | 3300031200 | Soil | MLPTVIYLIEAIRRALKKSGRGLFMIVDVFQEAMSHWRAAQRKYPFAE |
| Ga0302323_1034024131 | 3300031232 | Fen | MLPTVIYLLEALRRAFKKSGRGLFIVAASFREAMRDWRAAGRKYPFAE |
| Ga0265340_101450452 | 3300031247 | Rhizosphere | TVIYLLDAIRRALKKSGRGLSMVAGAFHEAMADWRAAGRKYPFAE |
| Ga0310907_100552001 | 3300031847 | Soil | EDDPMLPTVIYLIEAIRRALKKSGRGVFMLIDVFGEAMDDWRKAKRKYPFAE |
| Ga0310900_104422711 | 3300031908 | Soil | SLTTTQEQEDDPMLPTVIYLIEAIRRALKKSGRGVFMLIDVFGEAMDDWRKAKRKYPFAE |
| Ga0308175_1016539621 | 3300031938 | Soil | EALRRALNKSGRGLLLVAAAFHEAMNDWRKANRKYPFAE |
| Ga0310906_102599141 | 3300032013 | Soil | MLPTVIYLIEAIRRALKKSGRGVFMLIDVFGEAMDDWRK |
| Ga0307472_1013681972 | 3300032205 | Hardwood Forest Soil | MLPTMIFLIDAIRRALKKSGRSLFMIVDVFREAMGQWRAAQRKYPFAE |
| Ga0372943_0655685_3_128 | 3300034268 | Soil | LLEALRRALKKSGRGLSIVADAFREAMHDWRAAKRKYPFAE |
| ⦗Top⦘ |