| Basic Information | |
|---|---|
| Family ID | F054338 |
| Family Type | Metagenome |
| Number of Sequences | 140 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MKLPVDTSAIAFLCALEPQPVVDFETKRPRADENGEPL |
| Number of Associated Samples | 73 |
| Number of Associated Scaffolds | 140 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.57 % |
| % of genes near scaffold ends (potentially truncated) | 94.29 % |
| % of genes from short scaffolds (< 2000 bps) | 88.57 % |
| Associated GOLD sequencing projects | 68 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (64.286 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil (25.714 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.143 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.714 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.12% β-sheet: 6.06% Coil/Unstructured: 81.82% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 140 Family Scaffolds |
|---|---|---|
| PF01381 | HTH_3 | 12.86 |
| PF00392 | GntR | 12.86 |
| PF07702 | UTRA | 9.29 |
| PF00436 | SSB | 2.86 |
| PF00293 | NUDIX | 2.14 |
| PF03091 | CutA1 | 1.43 |
| PF12728 | HTH_17 | 1.43 |
| PF13560 | HTH_31 | 1.43 |
| PF01527 | HTH_Tnp_1 | 1.43 |
| PF00376 | MerR | 0.71 |
| PF12844 | HTH_19 | 0.71 |
| PF10458 | Val_tRNA-synt_C | 0.71 |
| PF13649 | Methyltransf_25 | 0.71 |
| PF12681 | Glyoxalase_2 | 0.71 |
| PF13546 | DDE_5 | 0.71 |
| PF02371 | Transposase_20 | 0.71 |
| PF13302 | Acetyltransf_3 | 0.71 |
| PF02441 | Flavoprotein | 0.71 |
| PF00583 | Acetyltransf_1 | 0.71 |
| PF13730 | HTH_36 | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 140 Family Scaffolds |
|---|---|---|---|
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 2.86 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 2.86 |
| COG1324 | Divalent cation tolerance protein CutA | Inorganic ion transport and metabolism [P] | 1.43 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 64.29 % |
| Unclassified | root | N/A | 35.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000550|F24TB_10358896 | Not Available | 1603 | Open in IMG/M |
| 3300000559|F14TC_100153245 | Not Available | 998 | Open in IMG/M |
| 3300000956|JGI10216J12902_101595217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 506 | Open in IMG/M |
| 3300000956|JGI10216J12902_106027188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1001 | Open in IMG/M |
| 3300000956|JGI10216J12902_120408362 | Not Available | 791 | Open in IMG/M |
| 3300003203|JGI25406J46586_10028549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 2125 | Open in IMG/M |
| 3300003373|JGI25407J50210_10072856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 857 | Open in IMG/M |
| 3300003373|JGI25407J50210_10169511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 538 | Open in IMG/M |
| 3300005562|Ga0058697_10199404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 906 | Open in IMG/M |
| 3300005562|Ga0058697_10212486 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300005562|Ga0058697_10283081 | Not Available | 784 | Open in IMG/M |
| 3300005981|Ga0081538_10017846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 5362 | Open in IMG/M |
| 3300005981|Ga0081538_10031972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3538 | Open in IMG/M |
| 3300005981|Ga0081538_10256613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 663 | Open in IMG/M |
| 3300005985|Ga0081539_10034759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3040 | Open in IMG/M |
| 3300005985|Ga0081539_10268019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 750 | Open in IMG/M |
| 3300006049|Ga0075417_10134916 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| 3300006058|Ga0075432_10289972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 676 | Open in IMG/M |
| 3300006169|Ga0082029_1106933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 584 | Open in IMG/M |
| 3300006844|Ga0075428_100668268 | Not Available | 1107 | Open in IMG/M |
| 3300006880|Ga0075429_100744409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 859 | Open in IMG/M |
| 3300006918|Ga0079216_11703501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 537 | Open in IMG/M |
| 3300009100|Ga0075418_11514697 | Not Available | 728 | Open in IMG/M |
| 3300009100|Ga0075418_11589182 | Not Available | 710 | Open in IMG/M |
| 3300009100|Ga0075418_12900319 | Not Available | 523 | Open in IMG/M |
| 3300009162|Ga0075423_10073711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 3548 | Open in IMG/M |
| 3300009162|Ga0075423_11218577 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300009162|Ga0075423_11427118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 742 | Open in IMG/M |
| 3300009789|Ga0126307_10155251 | All Organisms → cellular organisms → Bacteria | 1832 | Open in IMG/M |
| 3300009789|Ga0126307_10164451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1778 | Open in IMG/M |
| 3300009789|Ga0126307_10424886 | Not Available | 1072 | Open in IMG/M |
| 3300009789|Ga0126307_11688931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 515 | Open in IMG/M |
| 3300009810|Ga0105088_1082465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 577 | Open in IMG/M |
| 3300009840|Ga0126313_10029124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3765 | Open in IMG/M |
| 3300009840|Ga0126313_10043198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3149 | Open in IMG/M |
| 3300009840|Ga0126313_10263171 | Not Available | 1340 | Open in IMG/M |
| 3300009840|Ga0126313_10730201 | Not Available | 803 | Open in IMG/M |
| 3300009840|Ga0126313_11303572 | Not Available | 600 | Open in IMG/M |
| 3300009840|Ga0126313_11384327 | Not Available | 583 | Open in IMG/M |
| 3300009840|Ga0126313_11819403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
| 3300010036|Ga0126305_10175578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1347 | Open in IMG/M |
| 3300010036|Ga0126305_11063479 | Not Available | 556 | Open in IMG/M |
| 3300010036|Ga0126305_11193231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 526 | Open in IMG/M |
| 3300010037|Ga0126304_10049745 | Not Available | 2542 | Open in IMG/M |
| 3300010037|Ga0126304_10472486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 841 | Open in IMG/M |
| 3300010037|Ga0126304_10577591 | Not Available | 757 | Open in IMG/M |
| 3300010038|Ga0126315_10199837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1204 | Open in IMG/M |
| 3300010038|Ga0126315_10406165 | Not Available | 857 | Open in IMG/M |
| 3300010038|Ga0126315_10595750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2500 | 713 | Open in IMG/M |
| 3300010038|Ga0126315_10694670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 663 | Open in IMG/M |
| 3300010038|Ga0126315_11270982 | Not Available | 501 | Open in IMG/M |
| 3300010040|Ga0126308_10732819 | Not Available | 681 | Open in IMG/M |
| 3300010041|Ga0126312_10038370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3199 | Open in IMG/M |
| 3300010041|Ga0126312_10167383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1530 | Open in IMG/M |
| 3300010041|Ga0126312_10379480 | Not Available | 1004 | Open in IMG/M |
| 3300010041|Ga0126312_10615037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea pusilla | 781 | Open in IMG/M |
| 3300010041|Ga0126312_10714626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 724 | Open in IMG/M |
| 3300010041|Ga0126312_11118176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 579 | Open in IMG/M |
| 3300010041|Ga0126312_11202091 | Not Available | 559 | Open in IMG/M |
| 3300010042|Ga0126314_10509847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 873 | Open in IMG/M |
| 3300010044|Ga0126310_10960167 | Not Available | 670 | Open in IMG/M |
| 3300010044|Ga0126310_11163557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 617 | Open in IMG/M |
| 3300010045|Ga0126311_10495237 | Not Available | 955 | Open in IMG/M |
| 3300010045|Ga0126311_11309460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 602 | Open in IMG/M |
| 3300010166|Ga0126306_10832384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium | 746 | Open in IMG/M |
| 3300014487|Ga0182000_10299818 | Not Available | 669 | Open in IMG/M |
| 3300018051|Ga0184620_10184923 | Not Available | 687 | Open in IMG/M |
| 3300018073|Ga0184624_10131330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes derwentensis | 1091 | Open in IMG/M |
| 3300018073|Ga0184624_10280838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 747 | Open in IMG/M |
| 3300018074|Ga0184640_10389707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 628 | Open in IMG/M |
| 3300018081|Ga0184625_10441886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 667 | Open in IMG/M |
| 3300018422|Ga0190265_13301060 | Not Available | 538 | Open in IMG/M |
| 3300018465|Ga0190269_10739986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 695 | Open in IMG/M |
| 3300018465|Ga0190269_11175910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 600 | Open in IMG/M |
| 3300018466|Ga0190268_10512616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 818 | Open in IMG/M |
| 3300018466|Ga0190268_10655770 | Not Available | 759 | Open in IMG/M |
| 3300018466|Ga0190268_10974213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 671 | Open in IMG/M |
| 3300018466|Ga0190268_11245197 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300018466|Ga0190268_12300970 | Not Available | 508 | Open in IMG/M |
| 3300019767|Ga0190267_10155015 | Not Available | 1008 | Open in IMG/M |
| 3300019767|Ga0190267_10508331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 715 | Open in IMG/M |
| 3300019767|Ga0190267_11436765 | Not Available | 526 | Open in IMG/M |
| 3300022694|Ga0222623_10231816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 714 | Open in IMG/M |
| 3300027277|Ga0209846_1011506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1498 | Open in IMG/M |
| 3300027718|Ga0209795_10119771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 749 | Open in IMG/M |
| 3300027873|Ga0209814_10190236 | Not Available | 886 | Open in IMG/M |
| 3300027880|Ga0209481_10347483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 756 | Open in IMG/M |
| 3300027907|Ga0207428_10830189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 655 | Open in IMG/M |
| 3300027909|Ga0209382_10106672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3277 | Open in IMG/M |
| 3300027909|Ga0209382_12135505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 532 | Open in IMG/M |
| 3300028597|Ga0247820_11111192 | Not Available | 568 | Open in IMG/M |
| 3300028704|Ga0307321_1100998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 586 | Open in IMG/M |
| 3300028707|Ga0307291_1124090 | Not Available | 651 | Open in IMG/M |
| 3300028711|Ga0307293_10161157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 714 | Open in IMG/M |
| 3300028720|Ga0307317_10275686 | Not Available | 568 | Open in IMG/M |
| 3300028721|Ga0307315_10283365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 524 | Open in IMG/M |
| 3300028722|Ga0307319_10306470 | Not Available | 525 | Open in IMG/M |
| 3300028744|Ga0307318_10152866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 792 | Open in IMG/M |
| 3300028771|Ga0307320_10176722 | Not Available | 831 | Open in IMG/M |
| 3300028796|Ga0307287_10106028 | Not Available | 1061 | Open in IMG/M |
| 3300028811|Ga0307292_10274216 | Not Available | 703 | Open in IMG/M |
| 3300028812|Ga0247825_11415517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
| 3300028819|Ga0307296_10282044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 905 | Open in IMG/M |
| 3300028881|Ga0307277_10015008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3006 | Open in IMG/M |
| 3300030499|Ga0268259_10149328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 555 | Open in IMG/M |
| 3300031548|Ga0307408_101604719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 618 | Open in IMG/M |
| 3300031548|Ga0307408_102113437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
| 3300031731|Ga0307405_10061622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2372 | Open in IMG/M |
| 3300031731|Ga0307405_10893241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 751 | Open in IMG/M |
| 3300031731|Ga0307405_11009047 | Not Available | 710 | Open in IMG/M |
| 3300031824|Ga0307413_10508375 | Not Available | 969 | Open in IMG/M |
| 3300031824|Ga0307413_10946624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Catellatospora → Catellatospora citrea | 735 | Open in IMG/M |
| 3300031852|Ga0307410_10695107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 857 | Open in IMG/M |
| 3300031852|Ga0307410_11081803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 694 | Open in IMG/M |
| 3300031852|Ga0307410_11935159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 525 | Open in IMG/M |
| 3300031901|Ga0307406_10031178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3244 | Open in IMG/M |
| 3300031901|Ga0307406_10135707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → unclassified Catenulispora → Catenulispora sp. 13_1_20CM_3_70_7 | 1734 | Open in IMG/M |
| 3300031901|Ga0307406_10396915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium | 1092 | Open in IMG/M |
| 3300031901|Ga0307406_10965909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2500 | 729 | Open in IMG/M |
| 3300031901|Ga0307406_11726139 | Not Available | 555 | Open in IMG/M |
| 3300031903|Ga0307407_10046172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2465 | Open in IMG/M |
| 3300031903|Ga0307407_10557383 | Not Available | 848 | Open in IMG/M |
| 3300031911|Ga0307412_10857238 | Not Available | 793 | Open in IMG/M |
| 3300031995|Ga0307409_100191358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1821 | Open in IMG/M |
| 3300031995|Ga0307409_100602299 | Not Available | 1086 | Open in IMG/M |
| 3300032002|Ga0307416_100828486 | Not Available | 1022 | Open in IMG/M |
| 3300032002|Ga0307416_101153484 | Not Available | 880 | Open in IMG/M |
| 3300032002|Ga0307416_101521427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 775 | Open in IMG/M |
| 3300032002|Ga0307416_102505618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 614 | Open in IMG/M |
| 3300032004|Ga0307414_10050761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2875 | Open in IMG/M |
| 3300032004|Ga0307414_10159266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1791 | Open in IMG/M |
| 3300032005|Ga0307411_10135532 | All Organisms → cellular organisms → Bacteria | 1807 | Open in IMG/M |
| 3300032005|Ga0307411_10659525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 907 | Open in IMG/M |
| 3300032126|Ga0307415_100451654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1111 | Open in IMG/M |
| 3300032126|Ga0307415_100649830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 945 | Open in IMG/M |
| 3300032126|Ga0307415_102332624 | Not Available | 525 | Open in IMG/M |
| 3300032126|Ga0307415_102508487 | Not Available | 508 | Open in IMG/M |
| 3300033168|Ga0272423_1069674 | All Organisms → cellular organisms → Bacteria | 2229 | Open in IMG/M |
| 3300034172|Ga0334913_050078 | Not Available | 887 | Open in IMG/M |
| 3300034172|Ga0334913_088452 | Not Available | 654 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 25.71% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 22.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 16.43% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.71% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.57% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 3.57% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.14% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.14% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 1.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.43% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.43% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.43% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.71% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.71% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.71% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 0.71% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300027277 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027718 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028704 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379 | Environmental | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300030499 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2) | Host-Associated | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300033168 | Rock endolithic microbial communities from Victoria Land, Antarctica - Mt New Zealand sud | Environmental | Open in IMG/M |
| 3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F24TB_103588962 | 3300000550 | Soil | MRLPVDVSAISFLCAMAPEPVVDFETKRPRADENGEP |
| F14TC_1001532451 | 3300000559 | Soil | VKLPIDTSAIAFLCAMPPEPVVDFETRRPKADENGE |
| JGI10216J12902_1015952171 | 3300000956 | Soil | VKLPVDTSAIAFLCAMPPEPVVDFETKRPRADDNGE |
| JGI10216J12902_1060271881 | 3300000956 | Soil | LKLPVDTSAIAFLCALEPQPLLAFDTKQPRADENGEPL |
| JGI10216J12902_1204083621 | 3300000956 | Soil | MKLPVDTSAIAFLCAMPPEPVIDFQTKQHRADENGEPLFVVQLLVMGEDSADLIA |
| JGI25406J46586_100285491 | 3300003203 | Tabebuia Heterophylla Rhizosphere | MKLPVDTSAIAFLCALEPQPVLDFETRQPRADGNGEPLYV |
| JGI25407J50210_100728562 | 3300003373 | Tabebuia Heterophylla Rhizosphere | VKLPIDTSAIAFLCAMPAEPVVDFETRRPKADENGEPLYVVQLLVMGED |
| JGI25407J50210_101695112 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MKLPVDTSAIAFLCAVEAEPVVDFETRRPKADENGEPLYVV |
| Ga0058697_101994041 | 3300005562 | Agave | MKLPVDTSSIAFLCALEPQPVLDFETRQPRADENGEPLYVVQLIA |
| Ga0058697_102124862 | 3300005562 | Agave | VKLPIDTSAIAFLCALAPEPVVDFETRRPKADENGEPLYTVQLLVMGED |
| Ga0058697_102830811 | 3300005562 | Agave | VKLPIDTSAIAFMCAMPPEPVVDFETRRPKADENGEPLYVVQL |
| Ga0081538_100178468 | 3300005981 | Tabebuia Heterophylla Rhizosphere | VKLPVDTSAIAFLCAVEAEPVVDFETKRPSADENGEPL |
| Ga0081538_100319725 | 3300005981 | Tabebuia Heterophylla Rhizosphere | VKLPVDTSAIAFLCAMPPEPVVDFETKRPRADENGEPLYV |
| Ga0081538_102566132 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MKLPVDTSAIAFLCAVEAEPVVDFETRRPKADENGEP |
| Ga0081539_100347596 | 3300005985 | Tabebuia Heterophylla Rhizosphere | VKLPVDTSAIAFLCALEPQPVLDFETRQPRADSNG |
| Ga0081539_102680191 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MKLPVDTSAIAFLCAVEAEPVVDFETTRPRADENGEPLYLVQLIA |
| Ga0075417_101349161 | 3300006049 | Populus Rhizosphere | VKLPIDTSAIAFLCAMPPEPVVDFETRRPKADENGEPL |
| Ga0075432_102899721 | 3300006058 | Populus Rhizosphere | LKLPVDTSAIAFLCALEPQPVLDFETRRPRADENGEPLYV |
| Ga0082029_11069331 | 3300006169 | Termite Nest | MKLPVDTSAIAFLCALEPQPVLAFDTKQPRADENGEPL |
| Ga0075428_1006682681 | 3300006844 | Populus Rhizosphere | MKLPVDTSAIACLCAMPPEPVVDFETRRPKADENGEPLYVIQLLAMGDGS |
| Ga0075429_1007444091 | 3300006880 | Populus Rhizosphere | VKLPIDTSAIAFLCAMAPEPVVDFETKRPRADENGE |
| Ga0079216_117035011 | 3300006918 | Agricultural Soil | MKLPVDTSAIAFLCALAPEPVIDFQTKQPRADENGEPLYLIQLL |
| Ga0075418_115146971 | 3300009100 | Populus Rhizosphere | MKLPVDTSAIAFLCAMPPEPVIDFQTKQHRADENGEPLYVIQL |
| Ga0075418_115891822 | 3300009100 | Populus Rhizosphere | MKLPVDTSAIAFLCAMAPEPVVDFETRRPKADENGEPLYVIQLLA |
| Ga0075418_129003191 | 3300009100 | Populus Rhizosphere | VRTLPIDTTAITFLASAPPAPVLDFQTKQPKADSNGEPLYAVQLVAMQPA |
| Ga0075423_100737115 | 3300009162 | Populus Rhizosphere | VKLPIDTSAIAFLCALAPEPVVDFETRRPKADENGEPLYTVQLLV |
| Ga0075423_112185773 | 3300009162 | Populus Rhizosphere | MKLPVDTSAIAFLCAVEAEPVVDFETKRPRADENGEPCTWCS* |
| Ga0075423_114271182 | 3300009162 | Populus Rhizosphere | MKLPVDTSAIAFLCALAPEPVVDFETRQPKADENGEPL |
| Ga0126307_101552514 | 3300009789 | Serpentine Soil | MKLPVDTSAIAFLCAPEPQPVLAFETKQPRRMRTVSRCTWCS* |
| Ga0126307_101644513 | 3300009789 | Serpentine Soil | MKLPVDTTSITFLCALEPQPLLDFETKQPRADENGEPLYVVQLIAL |
| Ga0126307_104248862 | 3300009789 | Serpentine Soil | VKLPIDTSAIAFLCAMPPEPVVDFETRRPKADENGEP |
| Ga0126307_116889311 | 3300009789 | Serpentine Soil | VKLPIDTSAIAFLCALAPEPLVDFETRRPKADENGEPL |
| Ga0105088_10824652 | 3300009810 | Groundwater Sand | VKLPVDTSALAFLCAMPPEPVVDFETRRPKADENGEPLYVVQL |
| Ga0126313_100291245 | 3300009840 | Serpentine Soil | VKLPVDTSAIAFLCALEPQPVLAFDTKQPRADENGEPLFVVQLIALVGLCQVGG* |
| Ga0126313_100431981 | 3300009840 | Serpentine Soil | MKLPVDTSSIAFLCALEPQPVLAFDTKQPRADENGEPLYV |
| Ga0126313_102631711 | 3300009840 | Serpentine Soil | VKLPIDTSAIAFLCAMPPEPVVDFETRRPKADENG |
| Ga0126313_107302012 | 3300009840 | Serpentine Soil | VKLPVDTSAIAFLCALEPQPVLAFDTKQPRADENGE |
| Ga0126313_113035721 | 3300009840 | Serpentine Soil | LKLPIDTSAIAFLCAMPPEPVLDFQTCQTKADDNGEPLYVIQS* |
| Ga0126313_113843271 | 3300009840 | Serpentine Soil | MKLPVDTSAIAFLCAVEAEPVVDFETRRPKADENGEPLYL |
| Ga0126313_118194032 | 3300009840 | Serpentine Soil | VRLPVDTSAITFLCALAPEPLVDFETRRPKADENGEPLYVI |
| Ga0126305_101755781 | 3300010036 | Serpentine Soil | MKLPVDTSAIAFLCALEPQPVLDFETRRPRADENGEPLYVMQL |
| Ga0126305_110634792 | 3300010036 | Serpentine Soil | VKLPIDTSAIAFLCAMPPEPVLDFETRRPKADDNGEPLYVIQLL |
| Ga0126305_111932311 | 3300010036 | Serpentine Soil | MKLPVDTSAIAFLCALEPQPVLHFETRQPRADGNGEPL |
| Ga0126304_100497451 | 3300010037 | Serpentine Soil | MKLPVDTSAIAFLCALAPEPVVDFETRRPKADENGEPLYLIQLLAMGD |
| Ga0126304_104724861 | 3300010037 | Serpentine Soil | MKLPVDTSAIAFLCALAPEPVVDFETRRPKADENGEPLYLI |
| Ga0126304_105775911 | 3300010037 | Serpentine Soil | VKLPIDTSAIAFLCAMPPEPVVDFQTCRPKADDNGEPLY |
| Ga0126315_101998374 | 3300010038 | Serpentine Soil | MKLPIDTSAIAFLCALAPEPVVDFETRRPRADENGEPLYVIQLL |
| Ga0126315_104061652 | 3300010038 | Serpentine Soil | MKLPIDTSAIAFLCALAPEPVIDFETKRPRADENGEPL |
| Ga0126315_105957502 | 3300010038 | Serpentine Soil | MKLPVDTSAIAFLCAVEAEPVVDFETKRPRADENG |
| Ga0126315_106946703 | 3300010038 | Serpentine Soil | LKLPIDTSAIAFLCAMPPEPVLDFQTCQTKADDNGEPLYVIRS* |
| Ga0126315_112709821 | 3300010038 | Serpentine Soil | VKLPIDTSAIAFLCAMPPEPVIDFETKRPRADENGEPL |
| Ga0126308_107328192 | 3300010040 | Serpentine Soil | VDTSAIAFLCALEPQPVLAFDTKQPRADENGEPLYVVQLIALGEGEA |
| Ga0126312_100383701 | 3300010041 | Serpentine Soil | MKLPIDTSAIAFLCALAPEPVVDFETRRPKADENGEPLYVIQLL |
| Ga0126312_101673834 | 3300010041 | Serpentine Soil | MKLPVDTSAIAFLCALAPEPVVDFETRRPRADENGEP |
| Ga0126312_103794801 | 3300010041 | Serpentine Soil | VDTSAIAFLCALEPQPVLAFDTKQPRADENGEPLYVVQ |
| Ga0126312_106150373 | 3300010041 | Serpentine Soil | VKLPVDTSAIAFLCALEPQPLLTFDTKQPRANENGE |
| Ga0126312_107146262 | 3300010041 | Serpentine Soil | MKLPVDTSAIAFLCALAPEPVVDFQTKQQRADENGEPLYVI* |
| Ga0126312_111181762 | 3300010041 | Serpentine Soil | MRLPVDTSAIAFLCAVEAEPVVDFETRRPKADENG |
| Ga0126312_112020911 | 3300010041 | Serpentine Soil | MKLPVDTSAIAFLCALEPQPVLAFDTKQQRADENGEPLYV |
| Ga0126314_105098472 | 3300010042 | Serpentine Soil | MKLPVDTSAIAFLCALEPQPLLRFDTKEPRADENGEPLYVVQLIALA |
| Ga0126310_109601671 | 3300010044 | Serpentine Soil | VKLPIDTSAIAFLCAMAPEPVVDFETRRPKADENGEPLYV |
| Ga0126310_111635571 | 3300010044 | Serpentine Soil | VKLPIDTSAIAFLCAMPPEPVVDFETRRPKADENGEPLYVLQLLVMGE |
| Ga0126311_104952372 | 3300010045 | Serpentine Soil | MKLPIDTSAIAFLCAMPPEPVVDFETRRPKADDNGEPL |
| Ga0126311_113094602 | 3300010045 | Serpentine Soil | MKLPVDTSAIAFRCALAPEPVGDFETRRPKADENGEPLYL |
| Ga0126306_108323841 | 3300010166 | Serpentine Soil | VKLPIDTSAIAFLCAMPPEPVVDFETRRPKADENGEPLYTVQLLVMGDDSADLIA |
| Ga0182000_102998181 | 3300014487 | Soil | VKLPIDTSAIAFLCAMPPEPVVDFETRRPKADENGEPLYVVQLL |
| Ga0184620_101849232 | 3300018051 | Groundwater Sediment | VKLPVDTSAIAFLCALEPHPLLDFQSKQQRADENGEPLYVVQ |
| Ga0184624_101313301 | 3300018073 | Groundwater Sediment | MKLPVDTSAIAFLCAVEAEPVVDFETERPRADENGEPLYVVQLIALTD |
| Ga0184624_102808382 | 3300018073 | Groundwater Sediment | VKLPVDTSAIAFLCAVEAEPVVDFETKRPRADENGEP |
| Ga0184640_103897072 | 3300018074 | Groundwater Sediment | MKLPVDTSSIAFLCALEPQPVLAFDTKQPRADENGE |
| Ga0184625_104418862 | 3300018081 | Groundwater Sediment | MKLPVDTSAIAFLCALEPRPVLAFDTKEQRADENGEPL |
| Ga0190265_133010602 | 3300018422 | Soil | VKLPIDTSAIAFLCALAPEPVVDFETRRPKADENGEPLYTVQLLVMGEDSA |
| Ga0190269_107399861 | 3300018465 | Soil | VKLPVDTSAIAFLCALEPQPVLAFDTKQPRADENGEPLYVVQLIALA |
| Ga0190269_111759102 | 3300018465 | Soil | MKLPVDTSAIAFLCALEPQPVLAFDTKQPRADENGEPLYLVQLIALAE |
| Ga0190268_105126162 | 3300018466 | Soil | MKLPVDTSAIAFLCALEPQPVLAFDTKQPRADENGERCMWCS |
| Ga0190268_106557701 | 3300018466 | Soil | MKLPVDTSAIAFLCAMAPEPVVDFETRRPKADENGEPL |
| Ga0190268_109742131 | 3300018466 | Soil | MRLPVDTSAIAFLCALEPQPVLAFDTKQPRADENGEPLYVVQ |
| Ga0190268_112451971 | 3300018466 | Soil | VKLPIDTSAIAFLCAMPPEPVVDFETRRPKADENGEPLYVVQLLV |
| Ga0190268_123009701 | 3300018466 | Soil | MKLPVDTSAIAFLCAVEAEPVVDFETKRPRADENGE |
| Ga0190267_101550152 | 3300019767 | Soil | VKLPVDTSAIAFLCALEPQPVLAFDTKQPRADENGEPLYVVQLIALAEGE |
| Ga0190267_105083311 | 3300019767 | Soil | MKLPVDTSAIAFLCALPPEPVIDFQTKQPRADENGEP |
| Ga0190267_114367651 | 3300019767 | Soil | VKLPVDTSSIAFLCALEPQPVLAFDTKQPRADENGEPLLRGPADR |
| Ga0222623_102318162 | 3300022694 | Groundwater Sediment | MKLPVDTSALAFLCALEPQPVLAFDTKQPRADENGEPLYVVQLIALGEG |
| Ga0209846_10115063 | 3300027277 | Groundwater Sand | VKLPVDTSALAFLCAMPPEPVVDFETRRPKADENGEPLYVVQLIAMTDG |
| Ga0209795_101197712 | 3300027718 | Agave | VKLPIDTSAIAFLCAMPPEPVVDFETKRPRADDNGEPLYVV |
| Ga0209814_101902361 | 3300027873 | Populus Rhizosphere | VKLPIDTSAIAFLCAMPPEPVVDFETRRPKADENGEPLYT |
| Ga0209481_103474832 | 3300027880 | Populus Rhizosphere | MKLPVDTSAIAFLCALEPQPVLDFETRQPRADGNGEPLYVVQLIALGE |
| Ga0207428_108301892 | 3300027907 | Populus Rhizosphere | LKLPVDTSAIAFLCALEPQPVLDFETRRPRADENGEPLYVI |
| Ga0209382_101066726 | 3300027909 | Populus Rhizosphere | VKLPVDTSAIAFLCALEPQPLLAFDTKQPRADENGEPLYV |
| Ga0209382_121355051 | 3300027909 | Populus Rhizosphere | VKLPVDTSAIAFLCAVEAEPVVDFETKRPRADENG |
| Ga0247820_111111922 | 3300028597 | Soil | VKLPIDTSAIAFLCTLAPEPVIDFETKRPRADENGEPLY |
| Ga0307321_11009982 | 3300028704 | Soil | MKLPVDTSAIAFLCALPPEPVIDFQTKQPRADENGEPLYVIQLL |
| Ga0307291_11240902 | 3300028707 | Soil | VDAVACSEAAIAFLCAVEAEPVVDFETKRPRADENGEPLYLVQLIA |
| Ga0307293_101611572 | 3300028711 | Soil | MKLPVDTSAIAFLCAVEAEPVVDFETRRPKADENGEPLYLVQLIAMTD |
| Ga0307317_102756862 | 3300028720 | Soil | VKLPVDTSAIAFLCALEPQPLLAFDTKQPRADENGEPLY |
| Ga0307315_102833651 | 3300028721 | Soil | MKLPVDTSAIAFLCAVEAEPVVDFETKRPRADENGEPL |
| Ga0307319_103064701 | 3300028722 | Soil | MKLPVDTSAIAFLCALEPQPLLAFDTKQPRADENGEPLYVVQLIALGD |
| Ga0307318_101528661 | 3300028744 | Soil | MKLPVDTSAIAFLCAVEAEPVVDFETRRPRADENG |
| Ga0307320_101767221 | 3300028771 | Soil | VKLPIDTSAIAFLCAMPPEPVVDFETRRPKADENGEPLFVVQLLVMGED |
| Ga0307287_101060281 | 3300028796 | Soil | MKLPVDTSSIAFLCALEPQPVLAFDTKQPRADENGEPLYVVQLIALGE |
| Ga0307292_102742161 | 3300028811 | Soil | MKLPVDTSAIAFLCALEPQPVLAFDTKQPRADENGEPLYV |
| Ga0247825_114155172 | 3300028812 | Soil | MKLPVDTSAIAFLCALEPQPVLAFDTKQPRADENGEPLYVVQ |
| Ga0307296_102820442 | 3300028819 | Soil | MKLPVDTSSIAFLCALEPQPLLAFDTKQPRADGNG |
| Ga0307277_100150081 | 3300028881 | Soil | VKLPIDTSAIAFLCAMPPEPVVDFETRRPKADENGEPLYV |
| Ga0268259_101493282 | 3300030499 | Agave | MRLPVDTSAIAFLCALEPQPVLAFDTKQPRADENGEPL |
| Ga0307408_1016047191 | 3300031548 | Rhizosphere | MKLPVDTSAMAFLCALEPQPLLAFDTKQPRADENG |
| Ga0307408_1021134371 | 3300031548 | Rhizosphere | MKLPVDTSAIAFLCALEPQPVVDFETKRPRADENGEPL |
| Ga0307405_100616223 | 3300031731 | Rhizosphere | MKLPVDTSAIAFVCALAPEPVVDFETRRPKADENGEPLYVIQL |
| Ga0307405_108932411 | 3300031731 | Rhizosphere | VKLPVDTSAIAFLCALEPQPLLRFDTKEPRADENGEP |
| Ga0307405_110090472 | 3300031731 | Rhizosphere | LKLPIDTSAIAFLCAMPPEPVLDFQTCQTKADDNGEPLYVIRS |
| Ga0307413_105083752 | 3300031824 | Rhizosphere | VKLPIDTSAIAFLCAMPPEPVVDFETRRPKADENGEPLYVVQLLVMGEAG |
| Ga0307413_109466243 | 3300031824 | Rhizosphere | MKLPVDTSSIAFLCALEPQPVLAFDTKQPRADENGEPLYVV |
| Ga0307410_106951073 | 3300031852 | Rhizosphere | LKLPIDTSAIAFLCAMPPEPVVDFQTCQPKADDNGEPLYVIRS |
| Ga0307410_110818032 | 3300031852 | Rhizosphere | MKLPVDTSAIAFLCALEPQPVLDFETRRPRADENGEPLYVIQL |
| Ga0307410_119351591 | 3300031852 | Rhizosphere | MKLPVDTSAIAFLCALEPQPVLAFDTKQQRADENGEPLYVVQLIALAEGE |
| Ga0307406_100311786 | 3300031901 | Rhizosphere | MKLPVDTSAIAFLCALEPQPVLAFDTKQPRADENGEPLYVVQLIALAEG |
| Ga0307406_101357073 | 3300031901 | Rhizosphere | MKLPVDTSSIAFLCALEPQPVLDFETRQPRADGNGEPLYVV |
| Ga0307406_103969152 | 3300031901 | Rhizosphere | MKLPIDTSAIAFLCAMPPEPVVDFETRRPKADENGEPLYVVQ |
| Ga0307406_109659091 | 3300031901 | Rhizosphere | MKLPVDTSAIAFLCAVEAEPVVDFETKRPRADENGEP |
| Ga0307406_117261391 | 3300031901 | Rhizosphere | MKLPVDTSSIAFLCALEPQPVLAFDTKQPRADENG |
| Ga0307407_100461721 | 3300031903 | Rhizosphere | MKLPVDTSAIAFLCALEPQPVLDFETRQPRADGNGEPLYVVQLIALG |
| Ga0307407_105573831 | 3300031903 | Rhizosphere | MKLPVDTSAIAFLCALEPQPLLNFQSKEQRADENGE |
| Ga0307412_108572381 | 3300031911 | Rhizosphere | VKLPIDTSAIAFLCAMPPEPVVDFETRRPKADENGEPLYVAQLLVMGED |
| Ga0307409_1001913583 | 3300031995 | Rhizosphere | MKLPVDTSAIAFLCALEPQPVLAFDTKQPRADENGEPLYVVQL |
| Ga0307409_1006022992 | 3300031995 | Rhizosphere | MKLPVDTSAIAFLCALEPQPVLAFDTKQPRADENGEPLYVV |
| Ga0307416_1008284861 | 3300032002 | Rhizosphere | MKLPVDTSAIAFLCAVEAEPVVDFETRRPKADENGEPLYLVQLI |
| Ga0307416_1011534842 | 3300032002 | Rhizosphere | MKLPVDTSAIAFLCAMPPEPVVDFETRRPKADENGEPLYLVQLLVM |
| Ga0307416_1015214272 | 3300032002 | Rhizosphere | MKLPVDTSSIAFLCALEPQPVLAFDTKQPRADENGEPLYVVQL |
| Ga0307416_1025056181 | 3300032002 | Rhizosphere | MRLPVDTSAIAFLCAVEAEPVVDFETRRPKADENGEPLYVV |
| Ga0307414_100507614 | 3300032004 | Rhizosphere | VKLPIDTSAIAFLCAMPPEPVVDFETRRPKADENGEPLYVVQLLVMGEDSADLIA |
| Ga0307414_101592663 | 3300032004 | Rhizosphere | MKLPVDTSAIAFLCAVEAEPVVDFETRRPKADENGEPLYLV |
| Ga0307411_101355321 | 3300032005 | Rhizosphere | MKLPVDTSSIAFLCALEPQPVLAFDTKQPRADENGEPLYVVQ |
| Ga0307411_106595251 | 3300032005 | Rhizosphere | MKLPVDTSSIAFLCALEPQPVLDFETRRPRADENGEPLYVIQLIALAE |
| Ga0307415_1004516541 | 3300032126 | Rhizosphere | VKLPVDTSSIAFLCALEPQPVLAFDTKQPRADENGEPLYVVQLIAL |
| Ga0307415_1006498302 | 3300032126 | Rhizosphere | VKLPIDTSAIAFLCAMPPEPVVDFETRRPKADENGEPLYVIQLLVMGEDSAD |
| Ga0307415_1023326242 | 3300032126 | Rhizosphere | MRLPVDTSSIAFLCALEPQPVLAFDTKQPRADENGEPLYVV |
| Ga0307415_1025084872 | 3300032126 | Rhizosphere | MKLPVDTSAIAFLCALEPQPVLAFDTKQPRADENGEPLY |
| Ga0272423_10696741 | 3300033168 | Rock | MKLPIDTTGVTFLCALAPEPLMDFETKRQKGDLNGEP |
| Ga0334913_050078_761_886 | 3300034172 | Sub-Biocrust Soil | VKLPIDTSAIAFLCALAPEPVVDFETRRPKADENGEPLYTVQ |
| Ga0334913_088452_535_654 | 3300034172 | Sub-Biocrust Soil | MKLPVDTSAIAFLCALAPEPVVDFETRRPKADENGEPLYL |
| ⦗Top⦘ |