Basic Information | |
---|---|
Family ID | F054335 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 140 |
Average Sequence Length | 51 residues |
Representative Sequence | MLWWVGSGLILAWLILRLVKPMGWIPMLLLSGICVLIIQIAAYRKTKSHR |
Number of Associated Samples | 98 |
Number of Associated Scaffolds | 140 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 77.86 % |
% of genes near scaffold ends (potentially truncated) | 31.43 % |
% of genes from short scaffolds (< 2000 bps) | 78.57 % |
Associated GOLD sequencing projects | 90 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (87.857 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil (8.571 % of family members) |
Environment Ontology (ENVO) | Unclassified (47.857 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (69.286 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.85% β-sheet: 0.00% Coil/Unstructured: 46.15% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 140 Family Scaffolds |
---|---|---|
PF00486 | Trans_reg_C | 63.57 |
PF00664 | ABC_membrane | 7.14 |
PF14346 | DUF4398 | 1.43 |
PF00072 | Response_reg | 0.71 |
PF05187 | ETF_QO | 0.71 |
PF02390 | Methyltransf_4 | 0.71 |
PF02954 | HTH_8 | 0.71 |
PF08340 | DUF1732 | 0.71 |
PF00691 | OmpA | 0.71 |
PF01596 | Methyltransf_3 | 0.71 |
PF00067 | p450 | 0.71 |
PF02518 | HATPase_c | 0.71 |
COG ID | Name | Functional Category | % Frequency in 140 Family Scaffolds |
---|---|---|---|
COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 1.43 |
COG0030 | 16S rRNA A1518 and A1519 N6-dimethyltransferase RsmA/KsgA/DIM1 (may also have DNA glycosylase/AP lyase activity) | Translation, ribosomal structure and biogenesis [J] | 0.71 |
COG0220 | tRNA G46 N7-methylase TrmB | Translation, ribosomal structure and biogenesis [J] | 0.71 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.71 |
COG1561 | Endoribonuclease YloC, YicC family | Translation, ribosomal structure and biogenesis [J] | 0.71 |
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.71 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.71 |
COG2440 | Ferredoxin-like protein FixX | Energy production and conversion [C] | 0.71 |
COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.71 |
COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 0.71 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 87.86 % |
Unclassified | root | N/A | 12.14 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2162886006|SwRhRL3b_contig_2345949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 810 | Open in IMG/M |
3300000531|CNBas_1006129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
3300000891|JGI10214J12806_10511641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
3300000953|JGI11615J12901_10187512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
3300000956|JGI10216J12902_122470509 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
3300003203|JGI25406J46586_10005435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5910 | Open in IMG/M |
3300003319|soilL2_10039421 | All Organisms → cellular organisms → Bacteria | 2228 | Open in IMG/M |
3300004114|Ga0062593_102207651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
3300004114|Ga0062593_102736912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
3300004157|Ga0062590_101983013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
3300004643|Ga0062591_101458601 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300004643|Ga0062591_101719673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
3300005289|Ga0065704_10168013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1309 | Open in IMG/M |
3300005290|Ga0065712_10006471 | All Organisms → cellular organisms → Bacteria | 3439 | Open in IMG/M |
3300005290|Ga0065712_10380290 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300005293|Ga0065715_10047434 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
3300005293|Ga0065715_10180345 | Not Available | 1481 | Open in IMG/M |
3300005294|Ga0065705_10014173 | All Organisms → cellular organisms → Bacteria | 2261 | Open in IMG/M |
3300005329|Ga0070683_100997227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 804 | Open in IMG/M |
3300005331|Ga0070670_100000057 | All Organisms → cellular organisms → Bacteria | 118540 | Open in IMG/M |
3300005331|Ga0070670_100343845 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
3300005331|Ga0070670_101219703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
3300005334|Ga0068869_100340842 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
3300005339|Ga0070660_100383641 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
3300005345|Ga0070692_10044668 | All Organisms → cellular organisms → Bacteria | 2283 | Open in IMG/M |
3300005354|Ga0070675_100343447 | All Organisms → cellular organisms → Bacteria | 1322 | Open in IMG/M |
3300005438|Ga0070701_10581258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 739 | Open in IMG/M |
3300005438|Ga0070701_11401810 | Not Available | 502 | Open in IMG/M |
3300005440|Ga0070705_100967621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
3300005444|Ga0070694_100163199 | All Organisms → cellular organisms → Bacteria | 1637 | Open in IMG/M |
3300005444|Ga0070694_100974423 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
3300005444|Ga0070694_101612595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
3300005456|Ga0070678_100244120 | All Organisms → cellular organisms → Bacteria | 1503 | Open in IMG/M |
3300005535|Ga0070684_101874749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
3300005539|Ga0068853_100152373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2081 | Open in IMG/M |
3300005546|Ga0070696_100108636 | All Organisms → cellular organisms → Bacteria | 1996 | Open in IMG/M |
3300005546|Ga0070696_101787877 | Not Available | 531 | Open in IMG/M |
3300005549|Ga0070704_101553553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
3300005578|Ga0068854_100585491 | Not Available | 950 | Open in IMG/M |
3300005578|Ga0068854_100694675 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
3300005578|Ga0068854_101189161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
3300005616|Ga0068852_101997025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
3300005617|Ga0068859_101211458 | Not Available | 831 | Open in IMG/M |
3300005719|Ga0068861_101527094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
3300005842|Ga0068858_100040885 | All Organisms → cellular organisms → Bacteria | 4300 | Open in IMG/M |
3300005937|Ga0081455_10642673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
3300006049|Ga0075417_10207242 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
3300006169|Ga0082029_1177893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 39166 | Open in IMG/M |
3300006169|Ga0082029_1412675 | All Organisms → cellular organisms → Bacteria | 2269 | Open in IMG/M |
3300006169|Ga0082029_1556654 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300006755|Ga0079222_10894085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 744 | Open in IMG/M |
3300006806|Ga0079220_11195425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
3300006844|Ga0075428_102502068 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300006845|Ga0075421_100133993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3104 | Open in IMG/M |
3300006852|Ga0075433_11911088 | Not Available | 509 | Open in IMG/M |
3300006894|Ga0079215_10334250 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
3300006894|Ga0079215_11426085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
3300006969|Ga0075419_10028333 | All Organisms → cellular organisms → Bacteria | 3470 | Open in IMG/M |
3300007004|Ga0079218_11451412 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300009093|Ga0105240_10103038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 3468 | Open in IMG/M |
3300009101|Ga0105247_10628364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 800 | Open in IMG/M |
3300009101|Ga0105247_11183547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 608 | Open in IMG/M |
3300009101|Ga0105247_11599067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 535 | Open in IMG/M |
3300009148|Ga0105243_10299207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1457 | Open in IMG/M |
3300009148|Ga0105243_10972818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 849 | Open in IMG/M |
3300009148|Ga0105243_11242900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
3300009156|Ga0111538_12780984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
3300009162|Ga0075423_10227757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1953 | Open in IMG/M |
3300009176|Ga0105242_12933085 | Not Available | 527 | Open in IMG/M |
3300009545|Ga0105237_11139826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 786 | Open in IMG/M |
3300009553|Ga0105249_11610512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 722 | Open in IMG/M |
3300009789|Ga0126307_10963720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 689 | Open in IMG/M |
3300010040|Ga0126308_11212327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
3300010042|Ga0126314_10120978 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1800 | Open in IMG/M |
3300010045|Ga0126311_10000003 | All Organisms → cellular organisms → Bacteria | 300912 | Open in IMG/M |
3300010045|Ga0126311_10045532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2792 | Open in IMG/M |
3300010047|Ga0126382_11612678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
3300010146|Ga0126320_1053776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
3300010360|Ga0126372_10702355 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 988 | Open in IMG/M |
3300010396|Ga0134126_10035301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 6316 | Open in IMG/M |
3300010396|Ga0134126_11193581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 846 | Open in IMG/M |
3300010397|Ga0134124_10838603 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 921 | Open in IMG/M |
3300010397|Ga0134124_12090064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
3300010399|Ga0134127_10021163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 5048 | Open in IMG/M |
3300010399|Ga0134127_10074850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2888 | Open in IMG/M |
3300010399|Ga0134127_10354651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1434 | Open in IMG/M |
3300010399|Ga0134127_10636053 | Not Available | 1100 | Open in IMG/M |
3300010399|Ga0134127_12952803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
3300010400|Ga0134122_10341591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1300 | Open in IMG/M |
3300010400|Ga0134122_11429311 | Not Available | 707 | Open in IMG/M |
3300010401|Ga0134121_10002672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 15248 | Open in IMG/M |
3300011119|Ga0105246_12066577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
3300012212|Ga0150985_105871085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
3300012212|Ga0150985_116516296 | Not Available | 972 | Open in IMG/M |
3300012212|Ga0150985_120729995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
3300012469|Ga0150984_109798286 | Not Available | 1064 | Open in IMG/M |
3300012469|Ga0150984_112716899 | Not Available | 907 | Open in IMG/M |
3300012899|Ga0157299_10197565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
3300013307|Ga0157372_10197759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2328 | Open in IMG/M |
3300013308|Ga0157375_11015221 | Not Available | 969 | Open in IMG/M |
3300013308|Ga0157375_12461625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 621 | Open in IMG/M |
3300013760|Ga0120188_1007251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 925 | Open in IMG/M |
3300014325|Ga0163163_11958941 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
3300014325|Ga0163163_13056592 | Not Available | 522 | Open in IMG/M |
3300014745|Ga0157377_10484889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 861 | Open in IMG/M |
3300015373|Ga0132257_103747843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
3300018422|Ga0190265_10659310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1167 | Open in IMG/M |
3300018466|Ga0190268_11669285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
3300025315|Ga0207697_10083377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1349 | Open in IMG/M |
3300025321|Ga0207656_10000688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 11066 | Open in IMG/M |
3300025899|Ga0207642_10171223 | Not Available | 1175 | Open in IMG/M |
3300025900|Ga0207710_10002205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 9152 | Open in IMG/M |
3300025908|Ga0207643_10022676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 3459 | Open in IMG/M |
3300025908|Ga0207643_10056600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2231 | Open in IMG/M |
3300025908|Ga0207643_10165680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1331 | Open in IMG/M |
3300025911|Ga0207654_10362083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1001 | Open in IMG/M |
3300025911|Ga0207654_10505565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 854 | Open in IMG/M |
3300025913|Ga0207695_10107843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2770 | Open in IMG/M |
3300025924|Ga0207694_10014714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 5899 | Open in IMG/M |
3300025925|Ga0207650_10000027 | All Organisms → cellular organisms → Bacteria | 257466 | Open in IMG/M |
3300025925|Ga0207650_10954938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 729 | Open in IMG/M |
3300025935|Ga0207709_10192368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1450 | Open in IMG/M |
3300025935|Ga0207709_11424040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
3300025942|Ga0207689_10610739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 918 | Open in IMG/M |
3300025942|Ga0207689_10867098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
3300025942|Ga0207689_11146996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
3300025981|Ga0207640_10802916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 815 | Open in IMG/M |
3300025981|Ga0207640_11684605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
3300026023|Ga0207677_12217262 | Not Available | 511 | Open in IMG/M |
3300026116|Ga0207674_11083947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 770 | Open in IMG/M |
3300026142|Ga0207698_12329491 | Not Available | 547 | Open in IMG/M |
3300027775|Ga0209177_10039926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1282 | Open in IMG/M |
3300027907|Ga0207428_10148008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1789 | Open in IMG/M |
3300027909|Ga0209382_10113679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 3161 | Open in IMG/M |
3300028381|Ga0268264_10047056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 3585 | Open in IMG/M |
3300028381|Ga0268264_11142669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 788 | Open in IMG/M |
3300028381|Ga0268264_12258498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
3300030619|Ga0268386_10000134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 42500 | Open in IMG/M |
3300031538|Ga0310888_10697416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
3300031716|Ga0310813_10725022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 890 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 8.57% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.14% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 7.14% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 6.43% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.43% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.00% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.29% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.29% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.29% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.57% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.57% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.57% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.57% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.86% |
Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 2.14% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.14% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.14% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.14% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.43% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.43% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.43% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.43% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.43% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.43% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.71% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.71% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.71% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.71% |
Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 0.71% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.71% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.71% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.71% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.71% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.71% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.71% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Host-Associated | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010146 | Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300013760 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
SwRhRL3b_0824.00001660 | 2162886006 | Switchgrass Rhizosphere | RDSLMLWWVGSGLILAWLILRFVKPMGWIPMLLLSGICVLIIQTAAYRKAKSHRSS |
CNBas_10061292 | 3300000531 | Quercus Rhizosphere | MLWWVGSGLILAWIVLQLFAPRGWIPMLLLAGITVLIVQTAAYRKIKSLK* |
JGI10214J12806_105116412 | 3300000891 | Soil | MLWVIGAGLIIVWLVLTLFMPRGWVPLLLLSGITVLIIQIAAYRKTKYSNSVSRK* |
JGI11615J12901_101875121 | 3300000953 | Soil | MLWWVGSGLIVAWFILWLVKPVGWIPMLLISGICCLIIQIAAYRK |
JGI10216J12902_1224705092 | 3300000956 | Soil | MLWWLGSGLIVLWAVLRLVAPRGWIPTLLIAGISVLIIQIAAYRKTKAAHKGG* |
JGI25406J46586_100054352 | 3300003203 | Tabebuia Heterophylla Rhizosphere | MLWWVGVGLIVAWIILRLVAPMGWIPMLLLSGVCVLIIQIAAYRKTKSHR* |
soilL2_100394216 | 3300003319 | Sugarcane Root And Bulk Soil | MLWWVGAGLILAWVILRLVAPMGWIPMLLLSGICVLIIQIAAYRKTKSHR* |
Ga0062593_1022076512 | 3300004114 | Soil | MLWWVGSGLIFAWFVLWLVKPMGWIPMLLLTGIFILIVQIAAYRKTKSHR* |
Ga0062593_1027369122 | 3300004114 | Soil | LAWLILRFVKPMGWIPMLLLSGICVLIIQTAAYRKAKSHRSS* |
Ga0062590_1019830132 | 3300004157 | Soil | GSGLILAWLILRFVKPAGWIPMLLLSGICCLIIQIAAYRKTRSHR* |
Ga0062591_1014586011 | 3300004643 | Soil | MLWWIGAGLIILWALLSLFAHRSWAPFLLLSGICVLIVQIAAYRKTHHR* |
Ga0062591_1017196732 | 3300004643 | Soil | MLWWVGSGLIFAWFVLWLVKPMGWIPMLLLTGIFILIVQITAYRKTKSHR* |
Ga0065704_101680131 | 3300005289 | Switchgrass Rhizosphere | AERDSLMLWWVGSGLILAWLILRFVKPMGWIPMLLLSGICVLIIQTAAYRKAKSHRSS* |
Ga0065712_100064713 | 3300005290 | Miscanthus Rhizosphere | MLWWVGAGLILAWIILRLVAPMGWIPMLLLSGVCVLIVQIAAYRKTKSHR* |
Ga0065712_103802902 | 3300005290 | Miscanthus Rhizosphere | MLWWVGTGLILAWAVLRLVKPMGWIPMLLLSGICCLIIQIAAYRKTKNHRSH* |
Ga0065715_100474342 | 3300005293 | Miscanthus Rhizosphere | MLWWVGSGLILAWLILRFVKPMGWIPMLLLSGICVLIIQIAAYRKTKSHRSS* |
Ga0065715_101803452 | 3300005293 | Miscanthus Rhizosphere | MLWWVGAGLILAWIILRLIAPMGWIPMLLLSGVCVLIIQIAAYRKTKSHR* |
Ga0065705_100141732 | 3300005294 | Switchgrass Rhizosphere | MLWWVGSGLILAWLILRLVKPMGWIPMLLLSGICVLIIQIAAYRKTKSLR* |
Ga0070683_1009972272 | 3300005329 | Corn Rhizosphere | MLWWVGSGLILAWFVLRLVRPMGWIPMLLLSGIYCLIVQIAAYRKTKSHRSH* |
Ga0070670_1000000577 | 3300005331 | Switchgrass Rhizosphere | MLWWVGSGLILAWLILRFVKPMGWIPMLLISGISVLIIQLAAYRKTKSVK* |
Ga0070670_1003438452 | 3300005331 | Switchgrass Rhizosphere | MLWWVGAGLILAWIILRLVAPMGWIPMLLLSGVCVLIIQIAAYRKTKSHR* |
Ga0070670_1012197031 | 3300005331 | Switchgrass Rhizosphere | MLWVVGSGLILAWLILRFVKPMGWIPMLLLSGICVLIIQIAAYRKTKSHR* |
Ga0068869_1003408422 | 3300005334 | Miscanthus Rhizosphere | MLWWVGSGLILAWLILRFVKPMGWIPMLLISGISILIIQLAAYRKTKSVK* |
Ga0070660_1003836412 | 3300005339 | Corn Rhizosphere | MLWWLGIGLILAWFVLWLVKPMGWIPMLLLSGIFVLIIQIAAYRKTKSHR* |
Ga0070692_100446682 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MLWVIGSGLIVSWIVLTLFAPRGWAPLLLLSGICVLVVQIAAYRKTKVHR* |
Ga0070675_1003434472 | 3300005354 | Miscanthus Rhizosphere | MLWWVGSGLILAWLILRFVKPMGWIPMLLLSGICVLIIQTAAYRKTKSHR* |
Ga0070701_105812582 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MLWVVGAGLIAAWGVLTLFAPKGWAPLLLLSGICCLIIQIAAYRKKKVHRYHR* |
Ga0070701_114018101 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | GSGLILAWLILRFVKPMGWIPMLLLSGICVLIIQIAAYRKTKSHR* |
Ga0070705_1009676211 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MLWWVGSGLILAWLILRFVKPMGWIPMLLLSGICVLIIQTAAYRKTKRHR* |
Ga0070694_1001631991 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MLWWVGAGLILLWGILTLFAPKGWAPLLLLSGICCLIIQIAAYRKTRYQRTASKD* |
Ga0070694_1009744231 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | AERDSLMLWWVGSGLILAWLILRFVKPMGWIPMLLLSGICVLIIQIAAYRKTKSHRSS* |
Ga0070694_1016125952 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MLWWVGSGLILAWLILRLVKPMGWIPMLLLSGICVLIIQIAAYRKTKSHR* |
Ga0070678_1002441202 | 3300005456 | Miscanthus Rhizosphere | MLWWVGSGLILAWLILRFVKPMGWIPMLLLSGICVLIIQIAAYRKTKSHR* |
Ga0070684_1018747491 | 3300005535 | Corn Rhizosphere | MLWWVGSGLILAWLILRFVKPSGWIPMLLLSGICCLIIQVAAYR |
Ga0068853_1001523732 | 3300005539 | Corn Rhizosphere | MLWWVGSGLILAWLILRFVKPMGWIPMLLLSGMCVLIIQTAAYRKRRATDKHG* |
Ga0070696_1001086363 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MLWWVGSGLILAWLILRFVKPMGWIPMLLLSGICVLIIQIAAYRKTRIHR |
Ga0070696_1017878772 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | LMLWRIGAGLILGWAVLTLFVPKGWAPLLLLSGICCLIVHIAAYRKAKVHRYHR* |
Ga0070704_1015535532 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MLWWVGSGLILAWLILRFVKPMGWIPMLLISGISVLIIQLAAYRKTKAVK* |
Ga0068854_1005854912 | 3300005578 | Corn Rhizosphere | MLWWVGAGLILAWGILSLFAPKGWAPLLLLSGICCLIIQIAAYRKTKYQRTASKD* |
Ga0068854_1006946752 | 3300005578 | Corn Rhizosphere | MLWWVGSGLILAWLILRFVKPMGWIPMLLISGVSVLIIQLAAYRKTKSVK* |
Ga0068854_1011891611 | 3300005578 | Corn Rhizosphere | MLWWVGTGLILAWFVLWLVKPMGWIPMLLLSGIFILIVQVAAYRKTKSHR* |
Ga0068852_1019970251 | 3300005616 | Corn Rhizosphere | SLMLWWLGIGLILAWFVLWLVKPMGWIPMLLLSGIFVLIIQIAAYRKTKSHR* |
Ga0068859_1012114581 | 3300005617 | Switchgrass Rhizosphere | MLWVVGSGLILAWLILRFVKPMGWIPMLLLSGICVLIIQIA |
Ga0068861_1015270941 | 3300005719 | Switchgrass Rhizosphere | ILAWIILRLVAPMGWIPMLLLSGVCVLIVQIAAYRKTKSHR* |
Ga0068858_1000408853 | 3300005842 | Switchgrass Rhizosphere | MLWWVGSGLILAWLILRFVKPMGWIPMLLLSGICVLIIQIAAYRKTRIHRLRR* |
Ga0081455_106426731 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MLWVIGAGLIFGWIILTLFAPRGWAPLLLLSGICVLIVQIAAYRRTRYARSKLHE |
Ga0075417_102072422 | 3300006049 | Populus Rhizosphere | MLWWIGAGLILGWGVLTLFAPKGWAPLLLLSGICCLIIQIAAYRKTKSTGFHK* |
Ga0082029_117789313 | 3300006169 | Termite Nest | MLWMIGAGLILLWGILTLFAPKGWAPLLLLSGICCLIIQIAAYRKTKVHRYHR* |
Ga0082029_14126752 | 3300006169 | Termite Nest | MLWVIGAGLIVSWIVLTLFAPRGWAPLLLLSGICVLIVQIAAYRKTKVHR* |
Ga0082029_15566542 | 3300006169 | Termite Nest | MLWWVGSGLILAWLILRFVKPMGWIPMLLISGISILIIQLAAYRKAKSVK* |
Ga0079222_108940852 | 3300006755 | Agricultural Soil | MLWLVGSGLILAWFILWLVKPSGWIPMLLLSGLFILIIQIAAYRKTKSHR* |
Ga0079220_111954251 | 3300006806 | Agricultural Soil | LWLVKPSGWIPMLLLSGLFILIIQIAAYRKTKSHR* |
Ga0075428_1025020681 | 3300006844 | Populus Rhizosphere | MLWAIGAGLILLWGILTLFAPKGWAPLLLLSGICVLIIQIAAYRKTKYQGTASKD* |
Ga0075421_1001339932 | 3300006845 | Populus Rhizosphere | MLWVVGAGLILGWGILSLFAPRAWSPLLLLSGITVLIIQIAAYRKTRMHRSVD* |
Ga0075433_119110881 | 3300006852 | Populus Rhizosphere | RLQAERDSLMLWWVGTGLILAWFVLWLVKPMGWIPMLLLSGIFILIVQVAAYRKTKSHR* |
Ga0079215_103342502 | 3300006894 | Agricultural Soil | MLWVVGAGLILLWLILTLFMPRGWVPLLLLSGICVLIVQIAAYRKTKSTRRRGDTVTR* |
Ga0079215_114260851 | 3300006894 | Agricultural Soil | MLWWIGAGLIVLWAILSLFAYRGWVPLLLLSGICVLIVQTAAYRKTKTHR* |
Ga0075419_100283333 | 3300006969 | Populus Rhizosphere | MLWVIGAGLILGWVILSLFAPRAWSPLLLLSGICVLIVQIAAYRKTRVHR* |
Ga0079218_114514122 | 3300007004 | Agricultural Soil | MLWVIGAGLIILWLVLTLFMPRGWVPLLLLSGITVLIIQIAAYRKTKSTRGHGDAETR* |
Ga0105240_101030382 | 3300009093 | Corn Rhizosphere | MLWWIGAGLILGWGVLTLFAHKGWAPLLLLSGICCLIIQIAAYRKTKYQRIASKE* |
Ga0105247_106283642 | 3300009101 | Switchgrass Rhizosphere | MLWWVGSGLILAWLILRFVKPMGWIPMLLLSGICVLIIQLAAHRKTKSVK* |
Ga0105247_111835472 | 3300009101 | Switchgrass Rhizosphere | MLWWLGSGLILAWFVLWLVRPMGWIPMLLLSGIYCLIVQIAAYRKTKSHRSH* |
Ga0105247_115990672 | 3300009101 | Switchgrass Rhizosphere | MLWWVGAGLILAWIILRLVAPMGWIPMLLLSGVCVLIVQIAAYRKTKASLRNDN* |
Ga0105243_102992072 | 3300009148 | Miscanthus Rhizosphere | MLWWVGTGLILAWFVLWLVRPMGWIPMLLLSGIFILIVQIAAYRKTKSHR* |
Ga0105243_109728182 | 3300009148 | Miscanthus Rhizosphere | MLWWVGAGLIVAWIILRLVAPMGWIPMLLLSGVCVLIIQIAAYRKTKSHR* |
Ga0105243_112429002 | 3300009148 | Miscanthus Rhizosphere | GSGLILAWLILRFVKPMGWIPMLLLSGICVLIIQTAAYRKRRATDKHG* |
Ga0111538_127809841 | 3300009156 | Populus Rhizosphere | MLWWVGTGLILAWFVLWLVKPMGWIPMLLLSGIFILIVQVAA |
Ga0075423_102277572 | 3300009162 | Populus Rhizosphere | MLWWVGTGLILGWIILTLFSPRGWAPLLLLSGICCFIIQIAAYRKTKIHKSQR* |
Ga0105242_129330852 | 3300009176 | Miscanthus Rhizosphere | MLWWLGTGLILAWAVLRLVKPMGWIPMLLLSGICCLIIQIAAYRKTKNHRSH* |
Ga0105237_111398262 | 3300009545 | Corn Rhizosphere | MLWWVGTGLIFAWFVLWLVRPMGWIPTLLLSGICCLIIQIAAYRKTKSHR* |
Ga0105249_116105122 | 3300009553 | Switchgrass Rhizosphere | MLWWLGTGLIFAWFVLWLVRPMGWIPTLLLSGICCLIIQIAAYRKTKSHR* |
Ga0126307_109637202 | 3300009789 | Serpentine Soil | MLWWVGTGLILAWVILRLVKPSGWIPILLLSGIYCLIIQIAAYRKTKSHR* |
Ga0126308_112123271 | 3300010040 | Serpentine Soil | MLWWIGAGLIVLWAILSLFAYRGWVPLLLLSGICVLIVQTAAYRKTKSHR* |
Ga0126314_101209782 | 3300010042 | Serpentine Soil | MLWWVGSGLILAWVILRLVKPSGWIPMLLLAGICCLIIQIAAYRKTKSHR* |
Ga0126311_10000003251 | 3300010045 | Serpentine Soil | MLWWVGSGLILAWLILRFVKPMGWIPILLLSGICVLIIQIAAYRKTKSHR* |
Ga0126311_100455323 | 3300010045 | Serpentine Soil | MHWWVGIGLILAWVILRLVAPSGWIPMLLLAGICVLIIQVAAYRKTKSHRSP* |
Ga0126382_116126782 | 3300010047 | Tropical Forest Soil | VGSGLILAWLILRFVKPMGWIPMLLLSGICVLIIQIAAYRKTRIHRFHRLSVAFSLAVGS |
Ga0126320_10537762 | 3300010146 | Soil | MLWWVGSGLILAWLILRFVKPMGWIPMLLLSGICVLIIQIAAYRKRRATDKH |
Ga0126372_107023551 | 3300010360 | Tropical Forest Soil | RDSLMLWWVGTGLILAWAVLRLVKPMGWIPMLLISGICVLIIQTAAYRKTKNHRSH* |
Ga0134126_100353013 | 3300010396 | Terrestrial Soil | MLWWVGSGLIVAWFILWLVKPSGWIPMLLLSGICCLIIQIAAYRKTKSHR* |
Ga0134126_111935812 | 3300010396 | Terrestrial Soil | MLWWVGSGLILAWFILWLVKPSGWIPMLLLSGICCLIIQIAAYRRTKSHR* |
Ga0134124_108386031 | 3300010397 | Terrestrial Soil | GSGLILAWLILRFGKPAGWIPMLLLSGICCLIIQIAAYRKTRSHR* |
Ga0134124_120900642 | 3300010397 | Terrestrial Soil | GSGLILAWFVLRLVRPMGWIPMLLLSGIYCLIVQIAAYRKTKSHRSH* |
Ga0134127_100211633 | 3300010399 | Terrestrial Soil | MLWWVGTGLIVAWIILELFAPRGWIHLLLLSGLCCLIVQIAAYRKIKSLKSRR* |
Ga0134127_100748502 | 3300010399 | Terrestrial Soil | MLWWVGSGLILAWLILRFVKPAGWIPMLLLSGICCLIIQIAAYRKTRSHR* |
Ga0134127_103546513 | 3300010399 | Terrestrial Soil | MLWWVGAGLILAWGILSLFAPKGWAPLLLLSGICCLIIQIAAYRKTKYQRATSKD* |
Ga0134127_106360531 | 3300010399 | Terrestrial Soil | MLWWVGSGLILAWLILRFVKPMGWIPMLLLSGICVLI |
Ga0134127_129528032 | 3300010399 | Terrestrial Soil | GSGLILAWLILRFVKPMGWIPMLLISGISILIIQLAAYRKTKSVK* |
Ga0134122_103415911 | 3300010400 | Terrestrial Soil | QRDSVMLWVVGAGLIAAWGVLTLFAPKGWAPLLLLSGICCLIIQIAAYRKKKVHRYHR* |
Ga0134122_114293112 | 3300010400 | Terrestrial Soil | MLWVIGAGLIVLWAILSLFAPRGWAPLLLLSGICVLIVQIAAYR |
Ga0134121_100026722 | 3300010401 | Terrestrial Soil | MLWWVGSGLILAWLILRLVKPMGWIPMLLLSGVCVLIIQLAAYRKTKSVK* |
Ga0105246_120665771 | 3300011119 | Miscanthus Rhizosphere | GLILAWFVLWLVRPMGWIPTLLLSGICCLIIQIAAYRKTKSHR* |
Ga0150985_1058710852 | 3300012212 | Avena Fatua Rhizosphere | MLWWVGSGLILAWLILRFVKPMGWIPMLLLSGICVLIIQIAAYRKRRA |
Ga0150985_1165162961 | 3300012212 | Avena Fatua Rhizosphere | MLWWVGTGLILAWAVLRLVKPMGWIPMLLLSGICCLIIQIAAYRKTK |
Ga0150985_1207299952 | 3300012212 | Avena Fatua Rhizosphere | MLWWLGIGLILSWFVLWLVKPMGWIPMLLLSGIFVLIVQIAAYRKTKSHR* |
Ga0150984_1097982862 | 3300012469 | Avena Fatua Rhizosphere | MLWWVGTGLILAWAVLRLVKPMGWIPMLLLSGICCLIIQIAAYRKTKSHR* |
Ga0150984_1127168992 | 3300012469 | Avena Fatua Rhizosphere | MLWWVGSGLILAWLILRFVKPMGWIPMLLLSGICVLIIQLAAYRKTKSVK* |
Ga0157299_101975651 | 3300012899 | Soil | WLILRFVKPMGWIPMLLLSGICVLIIQIAAYRKTKIHR* |
Ga0157372_101977591 | 3300013307 | Corn Rhizosphere | MLWWIGAGLILGWGVLTLFTHKGWAPLLLLSGICCLIIQIAAYRKTKYQRIASKE* |
Ga0157375_110152212 | 3300013308 | Miscanthus Rhizosphere | MLWWVGAGLILAWAVLRLVKPMGWIPMLLLSGICCLIIQIAAYRKTKNH |
Ga0157375_124616252 | 3300013308 | Miscanthus Rhizosphere | MLWVVGSGLILAWLILRFVKPMGWIPMLLLSGICVLIIQTAAYRKTKRHR* |
Ga0120188_10072512 | 3300013760 | Terrestrial | MLWVIGAGLIFLWLVLTLFMPRGWVPLLLLSGICVLIVQIAAYRKTKVHR* |
Ga0163163_119589412 | 3300014325 | Switchgrass Rhizosphere | GLILAWFVLRLVRPMGWIPMLLLSGIYCLIVQIAAYRKTKSHRSH* |
Ga0163163_130565922 | 3300014325 | Switchgrass Rhizosphere | WVVGSGLILAWLILRFVKPMGWIPMLLLSGICVLIIQTAAYRKTKSHR* |
Ga0157377_104848891 | 3300014745 | Miscanthus Rhizosphere | SLMLWWVGSGLILAWLILRFVKPMGWIPMLLLSGICVLIIQIAAYRKARNHRFRR* |
Ga0132257_1037478432 | 3300015373 | Arabidopsis Rhizosphere | MLWWVGSGLILAWFILCFVKPMGWIPMLLLSGICCLIIQIAAYRRTKSHR* |
Ga0190265_106593102 | 3300018422 | Soil | MLWVVGAGLILLWLILTLFMPRGWVPLLLLSGICVLIVQIAAYRKTKSHT |
Ga0190268_116692852 | 3300018466 | Soil | MLWWVGIGLILAWVILRLVAPSGWIPMLLLAGICVLIIQIA |
Ga0207697_100833772 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MLWWVGSGLILAWLILRFVKPMGWIPMLLISGISILIIQLAAYRKTKSVK |
Ga0207656_100006883 | 3300025321 | Corn Rhizosphere | MLWVVGAGLIAAWGVLTLFAPKGWAPLLLLSGICCLIIQIAAYRKKKVHRYHR |
Ga0207642_101712231 | 3300025899 | Miscanthus Rhizosphere | MLWWVGSGLILAWLILRFVKPMGWIPMLLLSGICVLIIQIAAYRK |
Ga0207710_100022054 | 3300025900 | Switchgrass Rhizosphere | MLWWVGSGLILAWLILRLVKPMGWIPMLLLSGICVLIIQIAAYRKTKSHR |
Ga0207643_100226763 | 3300025908 | Miscanthus Rhizosphere | MLWVIGSGLIVSWIVLTLFAPRGWAPLLLLSGICVLVVQIAAYRKTKVHR |
Ga0207643_100566003 | 3300025908 | Miscanthus Rhizosphere | MLWWVGAGLILAWIILRLIAPMGWIPMLLLSGVCVLIIQIAAYRKTKSHR |
Ga0207643_101656802 | 3300025908 | Miscanthus Rhizosphere | MLWWVGSGLILAWLILRFVKPMGWIPMLLLSGICVLIIQIAAYRKTKSHR |
Ga0207654_103620832 | 3300025911 | Corn Rhizosphere | LQAERDSLMLWWVGSGLILAWLILRFVKPMGWIPMLLLSGICVLIIQIAAYRKTKSHRSS |
Ga0207654_105055652 | 3300025911 | Corn Rhizosphere | MLWWVGSGLILAWLILRFVKPMGWIPMLLISGVSVLIIQLAAYRKTKSVK |
Ga0207695_101078432 | 3300025913 | Corn Rhizosphere | MLWWIGAGLILGWGVLTLFAHKGWAPLLLLSGICCLIIQIAAYRKTKYQRIASKE |
Ga0207694_100147145 | 3300025924 | Corn Rhizosphere | MLWWVGSGLILAWLILRFVKPMGWIPMLLLSGICVLVIQTAAYRKTRIHR |
Ga0207650_10000027102 | 3300025925 | Switchgrass Rhizosphere | MLWWVGSGLILAWLILRFVKPMGWIPMLLISGISVLIIQLAAYRKTKSVK |
Ga0207650_109549382 | 3300025925 | Switchgrass Rhizosphere | MLWWVGSGLILAWFVLRLVRPMGWIPMLLLSGIYCLIVQIAAYRKTKSHRSH |
Ga0207709_101923682 | 3300025935 | Miscanthus Rhizosphere | MLWWVGTGLILAWFVLWLVRPMGWIPMLLLSGIFILIVQIAAYRKTKSHR |
Ga0207709_114240402 | 3300025935 | Miscanthus Rhizosphere | MLWWVGAGLILAWIILRLVAPMGWIPMLLLSGVCVLIIQIAAYRKTKSHR |
Ga0207689_106107392 | 3300025942 | Miscanthus Rhizosphere | MLWWVGAGLILAWIILRLVAPMGWIPMLLLSGVCVLIIQIAAYRKTKASLRNDN |
Ga0207689_108670982 | 3300025942 | Miscanthus Rhizosphere | GLILAWLILRFVKPMGWIPMLLISGISILIIQLAAYRKTKSVK |
Ga0207689_111469961 | 3300025942 | Miscanthus Rhizosphere | MLWWVGSGLILAWLILRFVKPMGWIPMLLLSGICVLIIQTA |
Ga0207640_108029162 | 3300025981 | Corn Rhizosphere | MLWWVGAGLILAWGILSLFAPKGWAPLLLLSGICCLIIQIAAYRKTKYQRTASKD |
Ga0207640_116846051 | 3300025981 | Corn Rhizosphere | MLWWVGTGLILAWFVLWLVKPMGWIPMLLLSGIFILIVQVAAYRKTKSHR |
Ga0207677_122172621 | 3300026023 | Miscanthus Rhizosphere | LQAERDSLMLWWVGTGLILAWAVLRLVKPMGWIPMLLLSGICCLIIQIAAYRKTKNHRSH |
Ga0207674_110839472 | 3300026116 | Corn Rhizosphere | LRFVKPMGWIPMLLLSGICVLIIQIAAYRKTKSHR |
Ga0207698_123294912 | 3300026142 | Corn Rhizosphere | AERDSLMLWWVGSGLILAWLILRFVKPMGWIPMLLLSGICVLIIQTAAYRKTKSHR |
Ga0209177_100399262 | 3300027775 | Agricultural Soil | MLWLVGSGLILAWFILWLVKPSGWIPMLLLSGLFILIIQIAAYRKTKSHR |
Ga0207428_101480081 | 3300027907 | Populus Rhizosphere | MLWWIGAGLILGWGVLTLFAPKGWAPLLLLSGICCLIIQIAAYRKTKSTGFHK |
Ga0209382_101136793 | 3300027909 | Populus Rhizosphere | MLWVVGAGLILGWGILSLFAPRAWSPLLLLSGITVLIIQIAAYRKTRMHRSVD |
Ga0268264_100470564 | 3300028381 | Switchgrass Rhizosphere | MLWWVGSGLILAWLILRFVKPMGWIPMLLLSGICVLIIQIAAYRKTKSHRSS |
Ga0268264_111426692 | 3300028381 | Switchgrass Rhizosphere | MLWWVGTGLILAWAVLRLVKPMGWIPMLLLSGICCLIIQIAAYRKTKNHRSH |
Ga0268264_122584981 | 3300028381 | Switchgrass Rhizosphere | MLWWVGIGLILAWFVLWLVKPMGWIPMLLLAGICVLIIQIAAYRKTKSHR |
Ga0268386_1000013419 | 3300030619 | Soil | MLWWIGAGLIILWAVLALFAYRGWVPLLLLSGICVLIVQIAAYRKTNRARAASGDWQ |
Ga0310888_106974161 | 3300031538 | Soil | MLWWVGSGLILAWLILRFVKPMGWIPMLLLSGICVLIIQTAAYRKTKSHR |
Ga0310813_107250222 | 3300031716 | Soil | MLWWVGTGLILAWVIMRVVAPRGWIPVLLLSGICVLIIQVAAYRKTKSHRSPR |
⦗Top⦘ |