| Basic Information | |
|---|---|
| Family ID | F054326 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 140 |
| Average Sequence Length | 45 residues |
| Representative Sequence | WLTPGIRLLAVVAFVWLCVSGRWGWRSRSAASSGRLPELLPTT |
| Number of Associated Samples | 125 |
| Number of Associated Scaffolds | 140 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 94.29 % |
| Associated GOLD sequencing projects | 118 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (72.857 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.857 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.714 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.143 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 42.25% β-sheet: 0.00% Coil/Unstructured: 57.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 140 Family Scaffolds |
|---|---|---|
| PF01935 | DUF87 | 4.29 |
| PF04978 | DUF664 | 0.71 |
| PF11941 | DUF3459 | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 72.86 % |
| All Organisms | root | All Organisms | 27.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001686|C688J18823_10654918 | Not Available | 669 | Open in IMG/M |
| 3300004082|Ga0062384_100722810 | Not Available | 688 | Open in IMG/M |
| 3300004092|Ga0062389_103874861 | Not Available | 562 | Open in IMG/M |
| 3300004092|Ga0062389_104544186 | Not Available | 522 | Open in IMG/M |
| 3300005176|Ga0066679_10207107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1252 | Open in IMG/M |
| 3300005178|Ga0066688_10289092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 1056 | Open in IMG/M |
| 3300005434|Ga0070709_11539943 | Not Available | 540 | Open in IMG/M |
| 3300005435|Ga0070714_101513553 | Not Available | 655 | Open in IMG/M |
| 3300005435|Ga0070714_101820203 | Not Available | 594 | Open in IMG/M |
| 3300005435|Ga0070714_102011433 | Not Available | 563 | Open in IMG/M |
| 3300005439|Ga0070711_100854314 | Not Available | 774 | Open in IMG/M |
| 3300005541|Ga0070733_10187449 | Not Available | 1351 | Open in IMG/M |
| 3300005557|Ga0066704_10957260 | Not Available | 529 | Open in IMG/M |
| 3300005576|Ga0066708_10241324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1146 | Open in IMG/M |
| 3300005602|Ga0070762_10491965 | Not Available | 803 | Open in IMG/M |
| 3300005610|Ga0070763_10895585 | Not Available | 528 | Open in IMG/M |
| 3300006050|Ga0075028_100307714 | Not Available | 885 | Open in IMG/M |
| 3300006162|Ga0075030_100409385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 1080 | Open in IMG/M |
| 3300006172|Ga0075018_10143918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 1095 | Open in IMG/M |
| 3300006175|Ga0070712_101883110 | Not Available | 524 | Open in IMG/M |
| 3300006176|Ga0070765_101023752 | Not Available | 781 | Open in IMG/M |
| 3300006573|Ga0074055_11832603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 1051 | Open in IMG/M |
| 3300006575|Ga0074053_11786756 | Not Available | 864 | Open in IMG/M |
| 3300006755|Ga0079222_11637294 | Not Available | 613 | Open in IMG/M |
| 3300006755|Ga0079222_12030543 | Not Available | 566 | Open in IMG/M |
| 3300006804|Ga0079221_10238759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 1024 | Open in IMG/M |
| 3300006854|Ga0075425_100964577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 973 | Open in IMG/M |
| 3300006881|Ga0068865_101778236 | Not Available | 557 | Open in IMG/M |
| 3300006914|Ga0075436_100858459 | Not Available | 678 | Open in IMG/M |
| 3300009090|Ga0099827_10070493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2696 | Open in IMG/M |
| 3300009098|Ga0105245_13090484 | Not Available | 516 | Open in IMG/M |
| 3300009683|Ga0116224_10618654 | Not Available | 518 | Open in IMG/M |
| 3300009698|Ga0116216_10976573 | Not Available | 506 | Open in IMG/M |
| 3300009700|Ga0116217_10981236 | Not Available | 517 | Open in IMG/M |
| 3300009824|Ga0116219_10251795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 1002 | Open in IMG/M |
| 3300010048|Ga0126373_12797028 | Not Available | 545 | Open in IMG/M |
| 3300010333|Ga0134080_10104494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1168 | Open in IMG/M |
| 3300010337|Ga0134062_10147098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 1045 | Open in IMG/M |
| 3300010343|Ga0074044_10725383 | Not Available | 649 | Open in IMG/M |
| 3300010358|Ga0126370_12058807 | Not Available | 559 | Open in IMG/M |
| 3300010375|Ga0105239_11241197 | Not Available | 859 | Open in IMG/M |
| 3300010376|Ga0126381_103343723 | Not Available | 632 | Open in IMG/M |
| 3300010865|Ga0126346_1329537 | Not Available | 607 | Open in IMG/M |
| 3300010880|Ga0126350_10546142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2112 | Open in IMG/M |
| 3300011106|Ga0151489_1531783 | Not Available | 549 | Open in IMG/M |
| 3300012205|Ga0137362_10607604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 943 | Open in IMG/M |
| 3300012207|Ga0137381_10463885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1105 | Open in IMG/M |
| 3300012207|Ga0137381_11767798 | Not Available | 508 | Open in IMG/M |
| 3300012359|Ga0137385_11312306 | Not Available | 586 | Open in IMG/M |
| 3300012360|Ga0137375_11454261 | Not Available | 506 | Open in IMG/M |
| 3300012683|Ga0137398_10831930 | Not Available | 645 | Open in IMG/M |
| 3300012924|Ga0137413_10384130 | Not Available | 1005 | Open in IMG/M |
| 3300012929|Ga0137404_10449861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 1143 | Open in IMG/M |
| 3300014326|Ga0157380_10547069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 1135 | Open in IMG/M |
| 3300014497|Ga0182008_10887512 | Not Available | 524 | Open in IMG/M |
| 3300015356|Ga0134073_10115237 | Not Available | 812 | Open in IMG/M |
| 3300016371|Ga0182034_10872282 | Not Available | 773 | Open in IMG/M |
| 3300016422|Ga0182039_12031234 | Not Available | 529 | Open in IMG/M |
| 3300017821|Ga0187812_1189995 | Not Available | 657 | Open in IMG/M |
| 3300017924|Ga0187820_1128045 | Not Available | 750 | Open in IMG/M |
| 3300017937|Ga0187809_10091206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1013 | Open in IMG/M |
| 3300017946|Ga0187879_10264416 | Not Available | 957 | Open in IMG/M |
| 3300017955|Ga0187817_10112816 | Not Available | 1717 | Open in IMG/M |
| 3300017972|Ga0187781_10707601 | Not Available | 729 | Open in IMG/M |
| 3300017995|Ga0187816_10284635 | Not Available | 724 | Open in IMG/M |
| 3300018001|Ga0187815_10465123 | Not Available | 541 | Open in IMG/M |
| 3300018085|Ga0187772_11445551 | Not Available | 511 | Open in IMG/M |
| 3300020069|Ga0197907_10262192 | Not Available | 559 | Open in IMG/M |
| 3300020581|Ga0210399_10952815 | Not Available | 694 | Open in IMG/M |
| 3300020582|Ga0210395_11161038 | Not Available | 568 | Open in IMG/M |
| 3300021362|Ga0213882_10530871 | Not Available | 506 | Open in IMG/M |
| 3300021401|Ga0210393_11427283 | Not Available | 552 | Open in IMG/M |
| 3300021560|Ga0126371_10461691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1416 | Open in IMG/M |
| 3300024288|Ga0179589_10082410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1283 | Open in IMG/M |
| 3300025906|Ga0207699_10027751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3138 | Open in IMG/M |
| 3300025912|Ga0207707_11645100 | Not Available | 504 | Open in IMG/M |
| 3300025929|Ga0207664_10202729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1713 | Open in IMG/M |
| 3300026322|Ga0209687_1151679 | Not Available | 746 | Open in IMG/M |
| 3300026356|Ga0257150_1064151 | Not Available | 552 | Open in IMG/M |
| 3300027297|Ga0208241_1036428 | Not Available | 766 | Open in IMG/M |
| 3300027609|Ga0209221_1145235 | Not Available | 592 | Open in IMG/M |
| 3300027696|Ga0208696_1096273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 986 | Open in IMG/M |
| 3300027884|Ga0209275_10369292 | Not Available | 806 | Open in IMG/M |
| 3300028047|Ga0209526_10812399 | Not Available | 578 | Open in IMG/M |
| 3300028906|Ga0308309_10740505 | Not Available | 854 | Open in IMG/M |
| 3300029910|Ga0311369_10112611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2709 | Open in IMG/M |
| 3300029943|Ga0311340_10115820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2904 | Open in IMG/M |
| 3300029999|Ga0311339_11945599 | Not Available | 505 | Open in IMG/M |
| 3300030617|Ga0311356_10671667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 995 | Open in IMG/M |
| 3300030618|Ga0311354_10620192 | Not Available | 1047 | Open in IMG/M |
| 3300031446|Ga0170820_11476339 | Not Available | 636 | Open in IMG/M |
| 3300031543|Ga0318516_10735377 | Not Available | 559 | Open in IMG/M |
| 3300031546|Ga0318538_10087244 | Not Available | 1593 | Open in IMG/M |
| 3300031640|Ga0318555_10691688 | Not Available | 551 | Open in IMG/M |
| 3300031708|Ga0310686_104238035 | Not Available | 743 | Open in IMG/M |
| 3300031708|Ga0310686_106745962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1052 | Open in IMG/M |
| 3300031708|Ga0310686_115371007 | Not Available | 690 | Open in IMG/M |
| 3300031713|Ga0318496_10263348 | Not Available | 951 | Open in IMG/M |
| 3300031718|Ga0307474_10873212 | Not Available | 712 | Open in IMG/M |
| 3300031718|Ga0307474_11208087 | Not Available | 598 | Open in IMG/M |
| 3300031723|Ga0318493_10286722 | Not Available | 886 | Open in IMG/M |
| 3300031723|Ga0318493_10720992 | Not Available | 559 | Open in IMG/M |
| 3300031723|Ga0318493_10784585 | Not Available | 536 | Open in IMG/M |
| 3300031724|Ga0318500_10588165 | Not Available | 563 | Open in IMG/M |
| 3300031748|Ga0318492_10587951 | Not Available | 594 | Open in IMG/M |
| 3300031751|Ga0318494_10033994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2624 | Open in IMG/M |
| 3300031751|Ga0318494_10359213 | Not Available | 843 | Open in IMG/M |
| 3300031753|Ga0307477_10428413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 904 | Open in IMG/M |
| 3300031771|Ga0318546_11236928 | Not Available | 524 | Open in IMG/M |
| 3300031792|Ga0318529_10209686 | Not Available | 904 | Open in IMG/M |
| 3300031793|Ga0318548_10227977 | Not Available | 915 | Open in IMG/M |
| 3300031796|Ga0318576_10446131 | Not Available | 611 | Open in IMG/M |
| 3300031798|Ga0318523_10030012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2457 | Open in IMG/M |
| 3300031798|Ga0318523_10182110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 1048 | Open in IMG/M |
| 3300031805|Ga0318497_10229739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 1027 | Open in IMG/M |
| 3300031835|Ga0318517_10483781 | Not Available | 558 | Open in IMG/M |
| 3300031890|Ga0306925_10327642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1646 | Open in IMG/M |
| 3300031897|Ga0318520_10686597 | Not Available | 639 | Open in IMG/M |
| 3300031910|Ga0306923_12245277 | Not Available | 546 | Open in IMG/M |
| 3300031912|Ga0306921_10848259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 1040 | Open in IMG/M |
| 3300031912|Ga0306921_12573930 | Not Available | 526 | Open in IMG/M |
| 3300032039|Ga0318559_10357126 | Not Available | 680 | Open in IMG/M |
| 3300032060|Ga0318505_10524520 | Not Available | 558 | Open in IMG/M |
| 3300032064|Ga0318510_10496645 | Not Available | 528 | Open in IMG/M |
| 3300032064|Ga0318510_10520340 | Not Available | 517 | Open in IMG/M |
| 3300032065|Ga0318513_10239009 | Not Available | 879 | Open in IMG/M |
| 3300032066|Ga0318514_10313737 | Not Available | 829 | Open in IMG/M |
| 3300032067|Ga0318524_10201623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 1017 | Open in IMG/M |
| 3300032068|Ga0318553_10381857 | Not Available | 738 | Open in IMG/M |
| 3300032076|Ga0306924_12052505 | Not Available | 588 | Open in IMG/M |
| 3300032076|Ga0306924_12209006 | Not Available | 561 | Open in IMG/M |
| 3300032174|Ga0307470_10752389 | Not Available | 749 | Open in IMG/M |
| 3300032180|Ga0307471_102348511 | Not Available | 673 | Open in IMG/M |
| 3300032205|Ga0307472_102002593 | Not Available | 580 | Open in IMG/M |
| 3300032770|Ga0335085_11414691 | Not Available | 728 | Open in IMG/M |
| 3300032805|Ga0335078_11811387 | Not Available | 663 | Open in IMG/M |
| 3300032828|Ga0335080_11763090 | Not Available | 605 | Open in IMG/M |
| 3300032892|Ga0335081_10052820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. col6 | 6354 | Open in IMG/M |
| 3300032955|Ga0335076_10565252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 1020 | Open in IMG/M |
| 3300033818|Ga0334804_027838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1849 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.86% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.71% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.29% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.29% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.57% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.57% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.86% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.14% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.14% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.14% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.14% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.14% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.43% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.43% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.43% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.71% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.71% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.71% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.71% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.71% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.71% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.71% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.71% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010865 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026356 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033818 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-M | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J18823_106549182 | 3300001686 | Soil | WLTPAVRLLAAVALVWFCISGRRGWRSQSAPSSGRLPELLPMN* |
| Ga0062384_1007228102 | 3300004082 | Bog Forest Soil | GTWLTPGVRLLATVALVWLCVSGRWGWRPRAAASAGRQAELLPLT* |
| Ga0062389_1038748611 | 3300004092 | Bog Forest Soil | LADIGQFDGAWLTPGVRLLATVALVWLCVWGHWGWRSGSAASTGRLAELAPLT* |
| Ga0062389_1045441861 | 3300004092 | Bog Forest Soil | ADIGQFDGAWLTPGIRLLAAVALVWLCLSGRWGWRSGSAASAGQLPELAPVT* |
| Ga0066679_102071071 | 3300005176 | Soil | FNGTWLTPGIRLLAAVALVWFCVSGRRGWRSRSAAASGQLPELLPTT* |
| Ga0066688_102890922 | 3300005178 | Soil | PGIRLLAAVALVWFCVWGRWGWRSRSAATSGRLPELLPTT* |
| Ga0070709_115399431 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LGQFNGTWLTPSVRLLAAVAFVWFCVSGRWGWRSRSAAASGRLPELLPTT* |
| Ga0070714_1015135532 | 3300005435 | Agricultural Soil | FDGMWLTPAVRLLAAVALVWFCVSGPPGWRSRSQPAPGQLPELLRTN* |
| Ga0070714_1018202032 | 3300005435 | Agricultural Soil | GQFNGTWLTPSVRLLAAVAFVWFCVSGRWGWRSRSAAASGRLPELLPTT* |
| Ga0070714_1020114332 | 3300005435 | Agricultural Soil | LGQFNGTWLTPGIRLLAAVAFVWFCVSGRWGWRSRSAAASGRLPELLPAS* |
| Ga0070711_1008543142 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | YDITQFDGMWLTPAVRLLSAVALVWFCVSGPPGWRSRSQPAPGQLPELLRTN* |
| Ga0070733_101874491 | 3300005541 | Surface Soil | RLAAAAALVWLCVSGRWGWRSRPVSQADQLPELLPLT* |
| Ga0066704_109572601 | 3300005557 | Soil | LAAVALVWFCVWGRWGWRSRSAATSGRLPELLPTT* |
| Ga0066708_102413242 | 3300005576 | Soil | LAAVALVWFCVSGRRGWRSRSAAASGQLPELLPTT* |
| Ga0070762_104919652 | 3300005602 | Soil | PGVRLLAAVALVWLCVSGRWGWRSRSVPSQGRQPELLPLT* |
| Ga0070763_108955851 | 3300005610 | Soil | ATVALVWLCLSGRWGWRSASAASAGRLPELLPAT* |
| Ga0075028_1003077141 | 3300006050 | Watersheds | LYDLGQFNGTWLTPSVRLLAAVAFVWFCVSGRWGWRSRSAAASGRLPELLPTT* |
| Ga0075030_1004093852 | 3300006162 | Watersheds | LYDLGQFNGTWLTPTIRLLAAVAFVWLCVSGRWGWRSVSAASSGRLPELLPTT* |
| Ga0075018_101439182 | 3300006172 | Watersheds | DLGQFNGTWLTPGIRLLAAVALVWLCVWRRWGWRTRSAAASGQLPELLPTT* |
| Ga0070712_1018831101 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | YDIVQFDGMWLTPAVRLLAAVALVWFCVSGRRGWRSQPAPSPGRLPELLPTN* |
| Ga0070765_1010237521 | 3300006176 | Soil | QFDGAWLTPGVRLAATVALVWLCLTGHWGWRPAAAAAAGRLPELLPAT* |
| Ga0074055_118326031 | 3300006573 | Soil | YDLGQFNGTWLTPGIRLLAAVALVWFCVSGRRGWRSRSAAASGRLPELLPAS* |
| Ga0074053_117867561 | 3300006575 | Soil | RLLAAVALVWLCVSGRWGWRSRSAASPGRLPELLPTT* |
| Ga0079222_116372942 | 3300006755 | Agricultural Soil | AVRLLAAVALVWFCVSGRPGWRSRPQLAPGQLPELLRTN* |
| Ga0079222_120305431 | 3300006755 | Agricultural Soil | TQFDGMWLTPAVRLLAAVALVWFCVSGPPGWRSRSQPAPGQLPELLRTN* |
| Ga0079221_102387591 | 3300006804 | Agricultural Soil | LAQFNGTWLTPGIRLLAAVAFVWFCVSGRWGWRSRSAAASGRLPELLPTT* |
| Ga0075425_1009645772 | 3300006854 | Populus Rhizosphere | MWLTPAVRLLAAVALVWFCVSGPPGWRSRSQPAPGQLPELLRTN* |
| Ga0068865_1017782362 | 3300006881 | Miscanthus Rhizosphere | WLTPGIRLLAAVALVWFCVSGRWGWRSRSATASGQLPELLPAR* |
| Ga0075436_1008584592 | 3300006914 | Populus Rhizosphere | LGQFNGTWLTPGVRLLAAVVLVWFCVWGRWGWRSRPAATSGRLPELLPTT* |
| Ga0099827_100704931 | 3300009090 | Vadose Zone Soil | QFNGTWLTPGVRLLAAVALVWFCASGRRGWRSRSAASSGRLPELLPTT* |
| Ga0105245_130904842 | 3300009098 | Miscanthus Rhizosphere | RLLAAVAFVWFCVSGRWGWRSRSAAASGRLPELLPTT* |
| Ga0116224_106186541 | 3300009683 | Peatlands Soil | DVGQFNGTWLTPGIRLAAAAALVWLCVSGHWGWHSRPVAPADQLPELLPLT* |
| Ga0116216_109765732 | 3300009698 | Peatlands Soil | LLAAIAFVWLCVSGRWGWRSVSAGSCGRLPELLPMT* |
| Ga0116217_109812362 | 3300009700 | Peatlands Soil | VRLLAAVAFVWLCVSGRWGWRSVPAASAGRLPELLPMT* |
| Ga0116219_102517952 | 3300009824 | Peatlands Soil | VRLIATVALVWLCLSGRWGWRSEPAPASGRLPELLPAT* |
| Ga0126373_127970282 | 3300010048 | Tropical Forest Soil | PGIRLLAAAAFVWFCLSGRWGWRSRSAASSGRLPELLPTT* |
| Ga0134080_101044942 | 3300010333 | Grasslands Soil | RLLAAVALVWFCVSGRWGWRSRSAAASGRLPELLPAS* |
| Ga0134062_101470981 | 3300010337 | Grasslands Soil | NGTWLTPGIRLLAAVALVWFCVSGRWGWRSPTASASGRLPELLPTT* |
| Ga0074044_107253831 | 3300010343 | Bog Forest Soil | WLTPTVRLLAVVAFVWLCVSGRWGWRSVSPTSSGRLPELLPMT* |
| Ga0126370_120588072 | 3300010358 | Tropical Forest Soil | DLGQFNGIWLTPSIRLLAAVALVWFCVSGRRGWRSRSASASGRLPELLPAS* |
| Ga0105239_112411972 | 3300010375 | Corn Rhizosphere | VRLLAAVALVWFCVSGRWGWRSRSAAASGQLPELLPAR* |
| Ga0126381_1033437232 | 3300010376 | Tropical Forest Soil | LAAGAFVWFCVSGPRGRSRSAASSGRLPELLPTT* |
| Ga0126346_13295372 | 3300010865 | Boreal Forest Soil | LGQFDGAWLTPGVRLLATVALVWLCLSGRWGWRSASAASPGRLPELLPAT* |
| Ga0126350_105461422 | 3300010880 | Boreal Forest Soil | VRLLAAVALVWFCVSGRRGWRSQALPSSGRLPELLPMN* |
| Ga0151489_15317832 | 3300011106 | Soil | FNGTWLTPGIRLLAAVALVWFCVSGRWGWRSRSAAASGRLPELLPAR* |
| Ga0137362_106076041 | 3300012205 | Vadose Zone Soil | NGAWLTPGIRLLATVALVWLCVSGRWGWRSRSATSSGRLPELLPLT* |
| Ga0137381_104638851 | 3300012207 | Vadose Zone Soil | TAQFNGMWLTPVVRLLAAVALVWFCVSGRRGWRSRPEPSSGRLPELLPTT* |
| Ga0137381_117677982 | 3300012207 | Vadose Zone Soil | LLAAVALVWFCVSGRWGWRSRSATASGRLPELLPTT* |
| Ga0137385_113123062 | 3300012359 | Vadose Zone Soil | VRLLAAAALVWFCVSGRRGWRSRSAASSGRLPELLPMT* |
| Ga0137375_114542612 | 3300012360 | Vadose Zone Soil | GQFNGTWLTPGIRLLAAVALVWFCVSGRRGWRSRSAAASGRLPELLPAR* |
| Ga0137398_108319302 | 3300012683 | Vadose Zone Soil | PGIRLLAAVALVWFCVSGRRGWRSRSGAASGRLPELLPAS* |
| Ga0137413_103841302 | 3300012924 | Vadose Zone Soil | WLYDLGQFNGTWLTPGIRLLAAVALVWFCVSGRWGWRSRSATASGRLPELLPTT* |
| Ga0137404_104498612 | 3300012929 | Vadose Zone Soil | AVRLLAAAALVWFCVSGRRGWRSRAEQSPGRLPELLRTS* |
| Ga0157380_105470692 | 3300014326 | Switchgrass Rhizosphere | YDLGQFNGTWLTPGIRLLAAVAFVWFCVSGRWGWRSRLAAASGRLPELLPAS* |
| Ga0182008_108875121 | 3300014497 | Rhizosphere | PGIRLLAAVALVWFCVSGRRGWRSRSASDSGRLPELLPAR* |
| Ga0134073_101152372 | 3300015356 | Grasslands Soil | IRLLAAVALVWFCVSGRWGWRSGSAAASGRLPELLPAR* |
| Ga0182034_108722821 | 3300016371 | Soil | EPHWLGDIAQFDGAWLTPGVRLLATLALVWLCLSGRWGWRSAPAASAGRRPELLPAT |
| Ga0182039_120312341 | 3300016422 | Soil | TPGIRLLAVVAFVWFCVSGRWGWRSRSAASSGRLPELLPTT |
| Ga0187812_11899952 | 3300017821 | Freshwater Sediment | LGDIAQFDGAWLTPGVRLLATVALVWLCLSGRWGWRSASAASSGRRPELLPAT |
| Ga0187820_11280452 | 3300017924 | Freshwater Sediment | TQFDGAWLTPGVRLLTTVALVWLCLSGRWGWRSAVTAASGRLPELLPAT |
| Ga0187809_100912062 | 3300017937 | Freshwater Sediment | IATVALVWLCLSGRWGWRSAPAPSSGRLPELLPAT |
| Ga0187879_102644161 | 3300017946 | Peatland | LTPSVRLLATVALVWLCVWGHWGWRSGSAASTGRLAELAPLT |
| Ga0187817_101128162 | 3300017955 | Freshwater Sediment | LTPGVRLIATVALVWLCLSGRWGWRSAPAPASGRLPELLPAT |
| Ga0187781_107076012 | 3300017972 | Tropical Peatland | WLTPGVRLIATVALVWLCLSGRWCWRPEPALSSGRLPELLPAT |
| Ga0187816_102846351 | 3300017995 | Freshwater Sediment | ITQFDGAWLTPGIRLLTTVALVWLCLSGRWGWRSAAAASSGRLPELVPTA |
| Ga0187815_104651232 | 3300018001 | Freshwater Sediment | FDGAWLTPGNRLLTTVALVWLCLSGRWGWRSAAAASSGRLPELLPAA |
| Ga0187772_114455512 | 3300018085 | Tropical Peatland | LAAAAALVWLCVSGRWGWRSRPVTQADQLPELLPLA |
| Ga0197907_102621921 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | TWLTPGIRLLAAVAFVWFCVSGRWGWRSRSAAASGRLPELLPAS |
| Ga0210399_109528151 | 3300020581 | Soil | GTWLTPGIRLLAVVAFVWLCVSGRWGWRSRSAASPGRLPELLPAT |
| Ga0210395_111610381 | 3300020582 | Soil | QFNGTWLTPGVRLAAAAALVWLCVSGRWGWRSRPVAPADQLPELVPLT |
| Ga0213882_105308712 | 3300021362 | Exposed Rock | HWLYDIIQFDGMWLTPAVRLVTAVTLVWFCVSGPRGWRSRSQPAPGQLPELLRTN |
| Ga0210393_114272832 | 3300021401 | Soil | LTPGVRLLATVALVWLCLSGRWGWRSTSAVSPGRLPELLPAT |
| Ga0126371_104616912 | 3300021560 | Tropical Forest Soil | LAAVALVWFCVSGRPDWRSRSEPASGQLPELLRTN |
| Ga0179589_100824102 | 3300024288 | Vadose Zone Soil | RHVATPGIRLLAAVALVWFCVSGRRGWRSRSAAASGRLPELLPAS |
| Ga0207699_100277512 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | WLTPAVRLLGAVALVWFCVSGPPGWRSRSQPAPGQLPELLRTN |
| Ga0207707_116451002 | 3300025912 | Corn Rhizosphere | GTWLTPGVRLLAAVALVWFCVSGRWGWRSRSVADSGQLPELLPAR |
| Ga0207664_102027291 | 3300025929 | Agricultural Soil | PSVRLLAAVAFVWFCVSGRWGWRSRSAAASGRLPELLPTT |
| Ga0209687_11516791 | 3300026322 | Soil | FNGTWLTPGIRLLAAVALVWFCVSGRRGWRSRSAAASGQLPELLPTT |
| Ga0257150_10641511 | 3300026356 | Soil | HWLADLGQFDGAWLTPGVRLLATVALVWLCLSGRWGWRSASAVSPGRLPELLPTT |
| Ga0208241_10364282 | 3300027297 | Forest Soil | NWLYDLGQFNGTWLTPTVRLLAAVAFVWLCVSGRWGWRSVSAASSGRLPELLPVT |
| Ga0209221_11452352 | 3300027609 | Forest Soil | YDIAQFDGTWLTPTVRLLAAAALVWLCVWGRWRWSPRSPASSGRLPELLPLS |
| Ga0208696_10962732 | 3300027696 | Peatlands Soil | IAQFDGAWLTPGVRLIATVALVWLCLSGRWGWRSEPAPASGRLPELLPAT |
| Ga0209275_103692922 | 3300027884 | Soil | LTPGVRLLAAVALVWLCVSGRWGWRSRSVPSQGRQPELLPLT |
| Ga0209526_108123991 | 3300028047 | Forest Soil | QFNGTWLTPTIRLLAAVAFVWLCVSGRWGWRSVPAASSGRLPELLPTA |
| Ga0308309_107405051 | 3300028906 | Soil | DGAWLTPGARLAATVALVWLCLTGHWGWRPAAAAAAGRLPELLPAT |
| Ga0311369_101126113 | 3300029910 | Palsa | ANLGQFDGAWLTPGVRLLAAVALVWLCLSGRWGWRSVSTASPGRLPELLPAT |
| Ga0311340_101158201 | 3300029943 | Palsa | FTPAVRFLAVVALVWLCVSGRWGWRSRSVAASGRLPELLPVT |
| Ga0311339_119455992 | 3300029999 | Palsa | VVQFDGSWLTPAVRFLAVVALVWLCVSGRWGWRSRSVASSGRLPELLPVT |
| Ga0311356_106716672 | 3300030617 | Palsa | GQFDGAWLTPAVRLLAAAALVWFCVSGRWGWRSRPAEAAGRQPELLRQT |
| Ga0311354_106201921 | 3300030618 | Palsa | DVVQFDGSWLTPAVRFLAVVALVWLCVSGRWGWRSRSVASSGRLPELLPVT |
| Ga0170820_114763391 | 3300031446 | Forest Soil | PGIRLLAAVALVWLCVWRRWGWRTRSAAASGQLPELLPTT |
| Ga0318516_107353771 | 3300031543 | Soil | PWLYDIAQFNGTWLTPGIRLLTTVALVWLCVSGRWGWRSEPAASPGRLPELLPAT |
| Ga0318538_100872441 | 3300031546 | Soil | LAQFNGTWLTPGIRLLAAAAFVWFCLSGRWGWRSRSAASSGRLPELLPTT |
| Ga0318555_106916882 | 3300031640 | Soil | LGDIAQFDGAWLTPGVRLLATAALVWLCLSGRWGWRSAPASSSGRRPELQPAT |
| Ga0310686_1042380351 | 3300031708 | Soil | LAAVALVWLCVSGRWGWRSRSEASTGRRPELLPLT |
| Ga0310686_1067459622 | 3300031708 | Soil | LGQFDGAWLTPGVRLLATVALVWLCLSGRWGWRSAPPVSAGRLPELLPAT |
| Ga0310686_1153710072 | 3300031708 | Soil | DLGQFDGAWLTPGVRLLATVALVWLCLSGRWGWRSGSAVSPGRLPELLPAT |
| Ga0318496_102633481 | 3300031713 | Soil | YDIAQFNGMWLTPGIRLLTTAALVWLCVSGRWGWRSAPAASSGRLPELLPII |
| Ga0307474_108732121 | 3300031718 | Hardwood Forest Soil | RLLAAVALVWFCLWGRWGWRSQSSAASGRLPELLPTT |
| Ga0307474_112080872 | 3300031718 | Hardwood Forest Soil | YDLGQFNGTWLTPGIRLLAAVALVWFCVSGRRGWRSRSAAASGRLPELLPAS |
| Ga0318493_102867222 | 3300031723 | Soil | IAQFDGAWLTPGVRLLATAALVWLCLSGRWGWRSAPASSSGRRPELQPAT |
| Ga0318493_107209921 | 3300031723 | Soil | GDIAQFDGAWLTPGVRLLATLALVWLCLSGRWGWRSAPAASAGRRPELLPAT |
| Ga0318493_107845852 | 3300031723 | Soil | FNGAWLTPGIRLLAAAAFVWLCVSGRWGWRPAPAASWGRVPELLPTT |
| Ga0318500_105881652 | 3300031724 | Soil | RLLATVALVWLCLSGRWGWRSAPAAPADRRPELLPAT |
| Ga0318492_105879511 | 3300031748 | Soil | PGVRLLATVALVWLCLSGRWGWRSARAASSGKRPELLPAT |
| Ga0318494_100339941 | 3300031751 | Soil | LLATAALVWLCLSGRWGWRSAPAASSGRRPELLPAT |
| Ga0318494_103592132 | 3300031751 | Soil | PGIRLLAVVAFAWFCVSGRWGWRSRSAESSGRLPELLPTT |
| Ga0307477_104284131 | 3300031753 | Hardwood Forest Soil | ITQFDGEWLTPGVRLLTTVALVWLCLSGRWGWRSAVPASSGRLPELLPTA |
| Ga0318546_112369281 | 3300031771 | Soil | IRLLAVVAFVWLCVSGRWGWRSRSAASSGRLPELLPTT |
| Ga0318529_102096862 | 3300031792 | Soil | VRLLATAALVWLCLSGRWGWRSAPAAASGRRPELLPAT |
| Ga0318548_102279772 | 3300031793 | Soil | EPHWLGDIAQFDGAWLTPGVRLLATAALVWLCLSGRWGWRSAPAASSGRRPELLPAT |
| Ga0318576_104461311 | 3300031796 | Soil | PGVRLLATAALVWLCLSGRWGWRSAPAASSGRRPELLPAT |
| Ga0318523_100300122 | 3300031798 | Soil | HWLGDVAQFDGAWLTPGVRLLATAALVWLCLSGRWGWRSAPAASSGRRPELLPAT |
| Ga0318523_101821101 | 3300031798 | Soil | LYDIAQFNGMWLTPGIRLLTTAALVWLCVSGRWGWRSAPAASSGRLPELLPII |
| Ga0318497_102297392 | 3300031805 | Soil | LGQFDGTWFTPGIRLLAVVAFVWFCISGRWGWRSRSAPSSGRLPELLPTT |
| Ga0318517_104837811 | 3300031835 | Soil | FNGTWLTPGIRLLTTVALVWLCVSGRWGWRSEPAASPGRLPELLPAT |
| Ga0306925_103276422 | 3300031890 | Soil | LAVVAFVWFCISGRWGWRSRSAPSSGRLPELLPTT |
| Ga0318520_106865971 | 3300031897 | Soil | AQFDGAWLTPGVRLVATVALVWLCLSGRWGWRSAPAATSGRRPELLPAT |
| Ga0306923_122452771 | 3300031910 | Soil | GTWLTPGIRLLAAVAFVWLCGSGRWGWRSAPAASWGRVPELLPTA |
| Ga0306921_108482592 | 3300031912 | Soil | LAAAAFVWFCLSGRWGWRSRSAASSGRLPELLPTT |
| Ga0306921_125739302 | 3300031912 | Soil | QFNGTWFTPGIRLLAVVAFAWFCVSGRWGWRSRSADSAGRLPELLPTT |
| Ga0318559_103571261 | 3300032039 | Soil | LYDIAQFNGMWLTPGIRLLTTAALVWLCVSGRWGWRSAPAASSGRLPELLPMT |
| Ga0318505_105245202 | 3300032060 | Soil | FDGAWLTPGVRLLATVALVWLCLSGRWGWRSAPAAASGRRPELLPAT |
| Ga0318510_104966451 | 3300032064 | Soil | VQFDGAWLTPGVRLLATAALVWLCLSGRWGWRSAPAAASGRRPELLPAT |
| Ga0318510_105203402 | 3300032064 | Soil | EPYWLGDVAQFDGAWLTPGVRLLATAALVWLCLSGRWGWRSAPAASSGRRPELLPAT |
| Ga0318513_102390091 | 3300032065 | Soil | LGQFNGIWLTPGIRLLAVVAFVWFCVSGRWGWRSRSAASSGRLPELLPTT |
| Ga0318514_103137372 | 3300032066 | Soil | TWFTPGIRLLAVVAFVWFCISGRWGWRSRSAPSSGRLPELLPTT |
| Ga0318524_102016232 | 3300032067 | Soil | TPGVRLLAAVALVWLCVRGRWGWRSVPAAPPGRLPQLLPAS |
| Ga0318553_103818571 | 3300032068 | Soil | FNGTWLTPGVRLLATAAFVWLCVSGQWGWRSEPAATPGRLPELLPAS |
| Ga0306924_120525051 | 3300032076 | Soil | WLTPGIRLLAVVAFVWLCVSGRWGWRSRSAASSGRLPELLPTT |
| Ga0306924_122090061 | 3300032076 | Soil | GIRLLTTVALVWLCLSGRWGWRSAVPASSGRLPELLPTA |
| Ga0307470_107523891 | 3300032174 | Hardwood Forest Soil | DLGQFNGTWLTPGIRLLAAVALVWFCVSGRWGWRSRSAAASGRLPELLPAR |
| Ga0307471_1023485112 | 3300032180 | Hardwood Forest Soil | NGTWLTPAVRLLAAVAFVWFCVSGPRGRSRSGASSGRLPELLPTP |
| Ga0307472_1020025932 | 3300032205 | Hardwood Forest Soil | NGTWLTPGIRLLAVVALVWLCVSGRWGWRSRSAASPGRLPELLPAT |
| Ga0335085_114146911 | 3300032770 | Soil | DIAQFNGMWLTPGIRLLTTAALVWLCVSGRWGWRPASAASSGRLPELLPVT |
| Ga0335078_118113871 | 3300032805 | Soil | LLAVVAFVWLCVSGRWGWRSRSAASSGRLPELLPTT |
| Ga0335080_117630902 | 3300032828 | Soil | GTWFTPGIRLLAVVAFVWFCVSGRWGWRSRSAASSGRLPELLPTT |
| Ga0335081_100528201 | 3300032892 | Soil | QFNGTWLTPGVRLLTTVALVWLCVSGRWGWRSAPAAAPGRLPELLPTV |
| Ga0335076_105652521 | 3300032955 | Soil | AGIAQFDGAWLTPVVRLLATVALVWLCLSGRWGWRSEATASSGRRPELLPAA |
| Ga0334804_027838_1717_1848 | 3300033818 | Soil | WLTPAVRLLAAMALVWLCVSGRWGWRSRSVASSGRLPELLPLS |
| ⦗Top⦘ |