| Basic Information | |
|---|---|
| Family ID | F054307 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 140 |
| Average Sequence Length | 39 residues |
| Representative Sequence | EQLWGQAHADVIKNGMKPADAVDKAFKRCNEIFAKVAM |
| Number of Associated Samples | 121 |
| Number of Associated Scaffolds | 140 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.86 % |
| % of genes from short scaffolds (< 2000 bps) | 95.00 % |
| Associated GOLD sequencing projects | 117 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.64 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.143 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.857 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.571 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.857 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.39% β-sheet: 0.00% Coil/Unstructured: 60.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 140 Family Scaffolds |
|---|---|---|
| PF00528 | BPD_transp_1 | 24.29 |
| PF13416 | SBP_bac_8 | 7.86 |
| PF03824 | NicO | 2.86 |
| PF01370 | Epimerase | 2.14 |
| PF07883 | Cupin_2 | 1.43 |
| PF01925 | TauE | 0.71 |
| PF04255 | DUF433 | 0.71 |
| PF00196 | GerE | 0.71 |
| PF03755 | YicC_N | 0.71 |
| PF00389 | 2-Hacid_dh | 0.71 |
| PF01545 | Cation_efflux | 0.71 |
| PF10518 | TAT_signal | 0.71 |
| PF03466 | LysR_substrate | 0.71 |
| PF00005 | ABC_tran | 0.71 |
| PF00999 | Na_H_Exchanger | 0.71 |
| PF13495 | Phage_int_SAM_4 | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 140 Family Scaffolds |
|---|---|---|---|
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.71 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.71 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.71 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.71 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.71 |
| COG1561 | Endoribonuclease YloC, YicC family | Translation, ribosomal structure and biogenesis [J] | 0.71 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.71 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.71 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.71 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.71 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.14 % |
| Unclassified | root | N/A | 12.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10276851 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300004080|Ga0062385_10931821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 578 | Open in IMG/M |
| 3300004152|Ga0062386_101095415 | Not Available | 661 | Open in IMG/M |
| 3300005329|Ga0070683_101340299 | Not Available | 688 | Open in IMG/M |
| 3300005344|Ga0070661_101721094 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300005437|Ga0070710_10073910 | All Organisms → cellular organisms → Bacteria | 1972 | Open in IMG/M |
| 3300005456|Ga0070678_100454686 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300005468|Ga0070707_102222309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 516 | Open in IMG/M |
| 3300005529|Ga0070741_10360181 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300005541|Ga0070733_10512689 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300005541|Ga0070733_10652979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 706 | Open in IMG/M |
| 3300005548|Ga0070665_100438990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65 | 1315 | Open in IMG/M |
| 3300005591|Ga0070761_10365486 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300005602|Ga0070762_10596800 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300005614|Ga0068856_102640052 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300005616|Ga0068852_102141761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 581 | Open in IMG/M |
| 3300005764|Ga0066903_102958203 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300005764|Ga0066903_105536935 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300005764|Ga0066903_108975301 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300006028|Ga0070717_10104001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2415 | Open in IMG/M |
| 3300006028|Ga0070717_11567401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300006028|Ga0070717_11921439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300006050|Ga0075028_100837007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 563 | Open in IMG/M |
| 3300006052|Ga0075029_101194849 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300006059|Ga0075017_101017269 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300006059|Ga0075017_101181347 | Not Available | 599 | Open in IMG/M |
| 3300006102|Ga0075015_100618526 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300006172|Ga0075018_10760859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300006174|Ga0075014_100158897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1110 | Open in IMG/M |
| 3300006175|Ga0070712_100802296 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300006358|Ga0068871_100929239 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 807 | Open in IMG/M |
| 3300006358|Ga0068871_101664181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 605 | Open in IMG/M |
| 3300006954|Ga0079219_11715736 | Not Available | 583 | Open in IMG/M |
| 3300009093|Ga0105240_10737996 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300009098|Ga0105245_10279454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1631 | Open in IMG/M |
| 3300009101|Ga0105247_11854563 | Not Available | 503 | Open in IMG/M |
| 3300009176|Ga0105242_12015529 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300009644|Ga0116121_1204656 | Not Available | 628 | Open in IMG/M |
| 3300009665|Ga0116135_1466328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 520 | Open in IMG/M |
| 3300010154|Ga0127503_10377041 | All Organisms → cellular organisms → Bacteria | 1688 | Open in IMG/M |
| 3300010154|Ga0127503_11123995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 619 | Open in IMG/M |
| 3300010369|Ga0136643_10742535 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300010379|Ga0136449_102121131 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300010379|Ga0136449_103150690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 639 | Open in IMG/M |
| 3300011120|Ga0150983_16603018 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300012209|Ga0137379_11696776 | Not Available | 528 | Open in IMG/M |
| 3300012212|Ga0150985_104085831 | Not Available | 541 | Open in IMG/M |
| 3300012212|Ga0150985_110242867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 579 | Open in IMG/M |
| 3300012212|Ga0150985_112994290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 836 | Open in IMG/M |
| 3300012212|Ga0150985_114480442 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300012350|Ga0137372_10720770 | Not Available | 721 | Open in IMG/M |
| 3300012958|Ga0164299_10561240 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300013105|Ga0157369_10738544 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300013307|Ga0157372_12517747 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300014493|Ga0182016_10261198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1079 | Open in IMG/M |
| 3300014501|Ga0182024_12434850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 566 | Open in IMG/M |
| 3300014657|Ga0181522_10223213 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300015206|Ga0167644_1018597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3119 | Open in IMG/M |
| 3300015371|Ga0132258_13134927 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300015372|Ga0132256_103925534 | Not Available | 500 | Open in IMG/M |
| 3300015373|Ga0132257_101855620 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300016341|Ga0182035_11769629 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300016371|Ga0182034_11940449 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300016445|Ga0182038_11664111 | Not Available | 575 | Open in IMG/M |
| 3300016445|Ga0182038_12158631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300017975|Ga0187782_11282596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300018469|Ga0190270_10818077 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300019183|Ga0184601_134708 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300019240|Ga0181510_1067504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 809 | Open in IMG/M |
| 3300019244|Ga0180111_1144817 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300019256|Ga0181508_1220682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila | 2557 | Open in IMG/M |
| 3300019260|Ga0181506_1260246 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300019268|Ga0181514_1247812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 588 | Open in IMG/M |
| 3300020076|Ga0206355_1561322 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300020076|Ga0206355_1661837 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300021180|Ga0210396_10304124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila | 1411 | Open in IMG/M |
| 3300021401|Ga0210393_10408212 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| 3300021406|Ga0210386_11387438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300021474|Ga0210390_10181108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila | 1780 | Open in IMG/M |
| 3300021477|Ga0210398_10856173 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300021560|Ga0126371_11505864 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300021860|Ga0213851_1806253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 724 | Open in IMG/M |
| 3300022467|Ga0224712_10143872 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300022505|Ga0242647_1018132 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300022522|Ga0242659_1047344 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300022522|Ga0242659_1113038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300022527|Ga0242664_1045015 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300022530|Ga0242658_1230389 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300022532|Ga0242655_10125038 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300022557|Ga0212123_10747092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 596 | Open in IMG/M |
| 3300025906|Ga0207699_11214915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300025928|Ga0207700_10846551 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300025929|Ga0207664_11939153 | Not Available | 512 | Open in IMG/M |
| 3300025938|Ga0207704_11081893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 681 | Open in IMG/M |
| 3300025939|Ga0207665_10075713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2306 | Open in IMG/M |
| 3300025944|Ga0207661_11547196 | Not Available | 607 | Open in IMG/M |
| 3300025960|Ga0207651_10430923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense | 1128 | Open in IMG/M |
| 3300025960|Ga0207651_10627188 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300026023|Ga0207677_11120422 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300026041|Ga0207639_10757944 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300026116|Ga0207674_10499321 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
| 3300027703|Ga0207862_1047132 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
| 3300027783|Ga0209448_10202243 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300027895|Ga0209624_11065737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300027908|Ga0209006_10031392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila | 4817 | Open in IMG/M |
| 3300027908|Ga0209006_10420930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1122 | Open in IMG/M |
| 3300028379|Ga0268266_10431368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65 | 1250 | Open in IMG/M |
| 3300028873|Ga0302197_10483109 | Not Available | 541 | Open in IMG/M |
| 3300028876|Ga0307286_10032035 | All Organisms → cellular organisms → Bacteria | 1737 | Open in IMG/M |
| 3300029943|Ga0311340_10409815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103 | 1243 | Open in IMG/M |
| 3300029945|Ga0311330_10995370 | Not Available | 620 | Open in IMG/M |
| 3300029952|Ga0311346_10780804 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300029953|Ga0311343_10302773 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
| 3300029953|Ga0311343_10983541 | Not Available | 665 | Open in IMG/M |
| 3300029990|Ga0311336_10708209 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300030578|Ga0210275_10276076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 576 | Open in IMG/M |
| 3300030738|Ga0265462_12223270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300031232|Ga0302323_100201132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2013 | Open in IMG/M |
| 3300031521|Ga0311364_10776174 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300031525|Ga0302326_10484025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila | 1883 | Open in IMG/M |
| 3300031525|Ga0302326_11871779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 782 | Open in IMG/M |
| 3300031543|Ga0318516_10694712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 578 | Open in IMG/M |
| 3300031715|Ga0307476_11375864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300031744|Ga0306918_10990093 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300031768|Ga0318509_10709843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300031777|Ga0318543_10330319 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300031942|Ga0310916_11454794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300032001|Ga0306922_11823938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300032009|Ga0318563_10088513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila | 1625 | Open in IMG/M |
| 3300032074|Ga0308173_11777322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 581 | Open in IMG/M |
| 3300032160|Ga0311301_12459268 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300032261|Ga0306920_103232205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 609 | Open in IMG/M |
| 3300032515|Ga0348332_10579734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila | 1916 | Open in IMG/M |
| 3300032756|Ga0315742_12709679 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300032892|Ga0335081_11824912 | Not Available | 657 | Open in IMG/M |
| 3300032896|Ga0335075_10729773 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300032898|Ga0335072_11268959 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 648 | Open in IMG/M |
| 3300034643|Ga0370545_169384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 510 | Open in IMG/M |
| 3300034644|Ga0370548_123038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 544 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.43% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.29% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.57% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.86% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.86% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.86% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.86% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.14% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.14% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.14% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.14% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.14% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.14% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 1.43% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.43% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.43% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.43% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.43% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.43% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.43% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.71% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.71% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.71% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.71% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.71% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.71% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.71% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.71% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.71% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.71% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.71% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.71% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.71% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010369 | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 3) | Host-Associated | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015206 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8B, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019183 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZA1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019240 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019244 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT293_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019256 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019260 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019268 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021856 | Metatranscriptome of freshwater microbial communities from post-fracked creek in Pennsylvania, United States - LL:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022505 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028873 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030578 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO105-VCO054SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032756 | Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300034643 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_102768511 | 3300001356 | Peatlands Soil | VSAEQLWGQCHADVIKNAMTPAAAVDKAFKRAEAIFSKVSFA* |
| Ga0062385_109318211 | 3300004080 | Bog Forest Soil | VSAEQLWGVMYADVIKDAMKPAEAVAKAFRRAEAIFSQYVFE* |
| Ga0062386_1010954152 | 3300004152 | Bog Forest Soil | VNAEQLWGRAYADVIKDGATPTAAVDNAFKRAEAIFAKFTFG* |
| Ga0070683_1013402992 | 3300005329 | Corn Rhizosphere | AEQLWGQCHADVIKGGMKPSDAIDKAFKRCNEIFAKIQI* |
| Ga0070661_1017210941 | 3300005344 | Corn Rhizosphere | GQANAEQLWGQAHADVIKNGMKPADAVDKAFKRCNEIFAKVAM* |
| Ga0070710_100739101 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | PAWGQVSAEQLWGVAYADVIKNGMKPTEAVDKAFKRAEAVFSRYTFD* |
| Ga0070678_1004546861 | 3300005456 | Miscanthus Rhizosphere | AEQLWTQACADVIKNGMTVQAAVDKAIKRAEAIFAKVTF* |
| Ga0070707_1022223091 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | AWGQVSSEQLWGQAHADVIKNGMTAQAAVDKAFKRVEAIFSKYTFG* |
| Ga0070741_103601811 | 3300005529 | Surface Soil | LWGQAHADVIKNGMTPQQAVDKAFKRAEQIFSQVTF* |
| Ga0070733_105126891 | 3300005541 | Surface Soil | WGVAHADVIKNNMTPAAAVDKAFQRAEVIFKRYTVE* |
| Ga0070733_106529791 | 3300005541 | Surface Soil | AEQLWGNAHADVIKNGMTPAAAVDKAFRRAEAIFEKYTLG* |
| Ga0070665_1004389901 | 3300005548 | Switchgrass Rhizosphere | AEQLWGQAHADVIKNGMTPTAAVDKAFKRMETIFARFTFE* |
| Ga0070761_103654862 | 3300005591 | Soil | GQAHADVIKNGMKVADAVDKAFKRANQIFANMTFD* |
| Ga0070762_105968001 | 3300005602 | Soil | AEQLWGQAHADVIKNGMKVADAVDKAFKRCNEIFAKVVM* |
| Ga0068856_1026400521 | 3300005614 | Corn Rhizosphere | PAWGQANAEQLWGQAHADVIKNNMKVADAVDKAFKRVAEVFAKFEHA* |
| Ga0068852_1021417612 | 3300005616 | Corn Rhizosphere | EQLWGQAHADVIKNGMKPADAVDKAFKRCNEIFAKVAM* |
| Ga0066903_1029582032 | 3300005764 | Tropical Forest Soil | AEQLWGQAHADVIKSGMKPADAIDKAFKRCNEIFAQITI* |
| Ga0066903_1055369352 | 3300005764 | Tropical Forest Soil | LWGQAHADVIKNGMTPEQAIDKAFKRAEAIFSAVTF* |
| Ga0066903_1089753012 | 3300005764 | Tropical Forest Soil | LWGQAHADVIKNGMTPEQAIDKAFKRAEQIFSQVTF* |
| Ga0070717_101040013 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | QLWGNCHADVIKNGLTPSAAVDKAFKRAEAIFAKYTFG* |
| Ga0070717_115674012 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LWGQAHADVIKSGMKPADAVDKAFKRCAEIFAKVVM* |
| Ga0070717_119214391 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | NAEQLWGQCHADVIKGGMKVADAVDKAFKRANAIFAKVVL* |
| Ga0075028_1008370071 | 3300006050 | Watersheds | LWGQAQADVIKGNMKVADAVDKAFKRGNEIFARITI* |
| Ga0075029_1011948492 | 3300006052 | Watersheds | GQANAEQLWGQAHADVIKNGMKPADAIDKAFKRCNEIFAKVET* |
| Ga0075017_1010172691 | 3300006059 | Watersheds | AEQVWGVAHADVIKNNMKVADAIDKAFRRCNEVFAKITI* |
| Ga0075017_1011813471 | 3300006059 | Watersheds | GQVGAEQLWGVAHADVIKNAMTPAAAVDKAFKRADAVTFG* |
| Ga0075015_1006185262 | 3300006102 | Watersheds | WGQFEAEQVWGVAHADVIKNNMKVADAIDKAFRRCNEVFAKITI* |
| Ga0075018_107608592 | 3300006172 | Watersheds | GQAHADVIKNGMKVADAVDKAFKRCNEIFAKVVL* |
| Ga0075014_1001588972 | 3300006174 | Watersheds | GVAYADVLKGGMTPQAAVDKAFRRAEAIFANYTFG* |
| Ga0070712_1008022962 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | AEQLWGQAHADVIKSNMKPADAIDKAFKRCNEIFAKITI* |
| Ga0068871_1009292391 | 3300006358 | Miscanthus Rhizosphere | QAHADVIKNGMTPTAAIDKAFKRMETIFARFTFE* |
| Ga0068871_1016641812 | 3300006358 | Miscanthus Rhizosphere | WGQAHADVIKNGMKPADAVDKAFKRCNEIFAKVAM* |
| Ga0079219_117157362 | 3300006954 | Agricultural Soil | QIWGQAHADVIKSGMKPADAIDKAFKRCKEIFAKITI* |
| Ga0105240_107379961 | 3300009093 | Corn Rhizosphere | NAEQLWGQAHADVIKNNMKAADAVDKALKRFKQIFAKMEV* |
| Ga0105245_102794541 | 3300009098 | Miscanthus Rhizosphere | QANAEQLWGQAHADVIKNGMKPADAGDKAFKRCNEIFAKVAM* |
| Ga0105247_118545631 | 3300009101 | Switchgrass Rhizosphere | RAHADVIKNNMKPADAVDKAFKRFEEIFAKVSFT* |
| Ga0105242_120155292 | 3300009176 | Miscanthus Rhizosphere | EQVWGQAHADVIKGNMKVSDAIDKAFKRANEVFAKITI* |
| Ga0116121_12046561 | 3300009644 | Peatland | EQIWGVAHSDVTKDGMKVADAVDKAFRRADAIFAKYTLG* |
| Ga0116135_14663282 | 3300009665 | Peatland | QVQAEQLWMQSVADIIKNGMTAQAAVDKAFRRAEAIFTKFTFG* |
| Ga0127503_103770411 | 3300010154 | Soil | WGNCHADVIKNGMTPAAAVDKAFKRAEAIFAKFTFG* |
| Ga0127503_111239951 | 3300010154 | Soil | GQAHADVIKNNMKPADAIDKAFKRCNDIFTKMVM* |
| Ga0136643_107425351 | 3300010369 | Termite Gut | SEQLWGQAHADVIKNGMTPEQAIDKAFKRAEAIFSAVTF* |
| Ga0136449_1021211312 | 3300010379 | Peatlands Soil | LWGTAHADVIKNGMKVSDAVDKAFKRGNEIFAKITI* |
| Ga0136449_1031506902 | 3300010379 | Peatlands Soil | GQLSAEQLWGQAHADVIKNGMTPAAAIDKAFKRAEQIFAQYTVG* |
| Ga0150983_166030181 | 3300011120 | Forest Soil | LWGTAHADVIKNGMTASDAIDKAFKRAERIFSNYTMG* |
| Ga0137379_116967761 | 3300012209 | Vadose Zone Soil | CDAEQIWGQAHADVIKNSMTPAAAIDKAFKRCNQIFAKIVI* |
| Ga0150985_1040858311 | 3300012212 | Avena Fatua Rhizosphere | LWGQAHADVIKNGMTPTAAVDKAFKRMETIFSKYTFG* |
| Ga0150985_1102428671 | 3300012212 | Avena Fatua Rhizosphere | AEQLWGQCHADVIKNSMKVADAVDKAFRRAEQVFAKFSHA* |
| Ga0150985_1129942902 | 3300012212 | Avena Fatua Rhizosphere | VNGEQIWGQCHADVIKNAMTPAQAVDKAFKRANQIFAKMLQG* |
| Ga0150985_1144804421 | 3300012212 | Avena Fatua Rhizosphere | ANAEQLWGQAHADVIKNKMEPVAAVDKAFKRFNEIFSKVSFT* |
| Ga0137372_107207702 | 3300012350 | Vadose Zone Soil | EQIWGQAHADVIKNSMTPAAAIDKAFKRCNQIFAKIVI* |
| Ga0164299_105612401 | 3300012958 | Soil | WGQFEAEQVWGLAHADVIKNNMKVADAVDKAFKRANEVFAKITI* |
| Ga0157369_107385442 | 3300013105 | Corn Rhizosphere | WGQAHADVIKNGMKPADAVDKAFKRANEIFAKMAT* |
| Ga0157372_125177472 | 3300013307 | Corn Rhizosphere | WGQAHADVIKNGMKPAAAVDKAFKRANEIFAKMAT* |
| Ga0182016_102611981 | 3300014493 | Bog | NAEQLWGLAHADVIKNGMTPAAAVDRAFRRMEAIFSKFTFE* |
| Ga0182024_124348502 | 3300014501 | Permafrost | SPAWGQANAEQLWGQAHADVIKSNMKVADAVDKAFKRCNEIFSKVIM* |
| Ga0181522_102232131 | 3300014657 | Bog | VSAEQIWTQSHADVIKNGMKVSDAVDKAFKRAEQIFARVTYD* |
| Ga0167644_10185971 | 3300015206 | Glacier Forefield Soil | GQANAEQLWGQAHADVIKNGMKVADAVDKAFKRCNEIFAKMVM* |
| Ga0132258_131349272 | 3300015371 | Arabidopsis Rhizosphere | EQLWGNCHADVIKNGMTPNAAVDKAFRRMEAIFAKFTFE* |
| Ga0132256_1039255341 | 3300015372 | Arabidopsis Rhizosphere | EAEQVWGLAHADVIKNNMKVADAVDKAFKRANEVFAKITI* |
| Ga0132257_1018556201 | 3300015373 | Arabidopsis Rhizosphere | QLWGQAHADVIKSNMKPADAIDKAFKRCNEIFAKITI* |
| Ga0182035_117696291 | 3300016341 | Soil | QIWGNCHSDVIKNGMTPAAAVDKAFKRVEAIFAKFTFG |
| Ga0182034_119404491 | 3300016371 | Soil | SAEQIWGNCHADVIKNGMTPAAAVDKAFKRVEAIFAKFTFG |
| Ga0182038_116641112 | 3300016445 | Soil | LGSAHADVIKNEMKPADAVDKAFERAEAIFAKVSFG |
| Ga0182038_121586311 | 3300016445 | Soil | EQLWGQAHADVIKNGMKPADAVDKAFKRCTEIFAKITI |
| Ga0187782_112825961 | 3300017975 | Tropical Peatland | AWGQASAEQLWGQAHADVIKNGMKVTEAVDKAFKRCSEIFARLST |
| Ga0190270_108180771 | 3300018469 | Soil | EQIWGQCHADVIKNGMTPQQAVDKAFKRVESIFTKFAVG |
| Ga0184601_1347081 | 3300019183 | Soil | WGQAHADVIKNGMKVADAVDKAFKRCNAIFSRLTM |
| Ga0181510_10675042 | 3300019240 | Peatland | ANAEQLWGQAHADVIKNGVKVADAVDKAFKRCEEIFAKVVM |
| Ga0180111_11448172 | 3300019244 | Groundwater Sediment | NAEQVWGQCHADVVKNGLTPTQAVDKAFKRADAIFTKFSFG |
| Ga0181508_12206823 | 3300019256 | Peatland | AEQLWGQAHADVIKNGMTASAAVDKAFRRAETIFAKFTFG |
| Ga0181506_12602461 | 3300019260 | Peatland | VNAEQLWGTAHADVIKNGMTPAAAVDKAFRRAEAIFAKFTFG |
| Ga0181514_12478121 | 3300019268 | Peatland | GQANAEQLWGQAHADVIKNGMKVADAVDKAFKRCNEIFAKVIM |
| Ga0206355_15613221 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | QLWGQCHADVIKNGMKVADAVDKAFKRCNEVFARVAL |
| Ga0206355_16618371 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | EQLWTQACADVIKNGMTVQAAVGKAIKRAEEIFAKVTF |
| Ga0210396_103041241 | 3300021180 | Soil | QASAEQLWGQAHADVIKNGMKVADAVDKAFKRCNEVFSKVVM |
| Ga0210393_104082122 | 3300021401 | Soil | EQLWGQAHADVIKNGMKVADAVDKAFKRCNEIFAKVVM |
| Ga0210386_113874381 | 3300021406 | Soil | AEQLWGQAHADVIKNGMKVSDAVDKAFKRCSEVFAKVAM |
| Ga0210390_101811083 | 3300021474 | Soil | ANAEQLWGQAHADVIKNGMKVADAVDKAFKRCNEIFAKVVM |
| Ga0210398_108561733 | 3300021477 | Soil | QICAEQLWGVAHADVVKQAMTPAAAVDKAFRRAEAIFERFTFG |
| Ga0126371_115058642 | 3300021560 | Tropical Forest Soil | PAWGQCGAEQLWGQAHADVIKNGMKVADAVDKALKRHKEIFAKMSA |
| Ga0213850_14867613 | 3300021856 | Watersheds | FMSSVADVVKNGMTPQAALDKAFKRANEIFAKFVFA |
| Ga0213851_18062532 | 3300021860 | Watersheds | WGVAHADVIKNGMTPADAVDKASRRAEAIFAKYTFG |
| Ga0224712_101438721 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | WTQCHADVIKNGMTPAQAVDKCLKRAEAIFSKVSFG |
| Ga0242647_10181322 | 3300022505 | Soil | WGQAHADVIKNGMKVADAVDKAFKRCNEIFAKVIM |
| Ga0242659_10473442 | 3300022522 | Soil | LWGQAHADVIKNGMTPAAAVDKAFSRAEAIFAKYTFG |
| Ga0242659_11130381 | 3300022522 | Soil | PAWGQANAEQLWGQAHADVIKNGMKVSDAVDKAFKRCSEVFAKVAM |
| Ga0242664_10450151 | 3300022527 | Soil | QLWGQAHADVIKNGMKVADAVDKAFKRCNEIFAKVIM |
| Ga0242658_12303892 | 3300022530 | Soil | WGQAHADVIKNGMRPSEAVDKAFKRMQAIFSKFTFD |
| Ga0242655_101250381 | 3300022532 | Soil | AEQLWGVAHADVIKNGMTPAAAIDKAFKRADAIFAKYTFG |
| Ga0212123_107470922 | 3300022557 | Iron-Sulfur Acid Spring | NAEQLWGQAHADVIKNGMKVADAVDKAFKRTEQIFAKMTFG |
| Ga0207699_112149151 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | AEQLWGQAHADVIKSNMKPADAIDKAFKRCNEIFAKITI |
| Ga0207700_108465512 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | EQLWGNCHADVIKNGMTPAAAVDKAFKRAEAIFAKFTFG |
| Ga0207664_119391531 | 3300025929 | Agricultural Soil | AWGLSNSEQLWGRAHADVIKSGIKPADAVDKAFKRFDEIFAKVSFS |
| Ga0207704_110818932 | 3300025938 | Miscanthus Rhizosphere | WGQAHADVIKNGMTPTAAVDKAFKRMETIFARFTFE |
| Ga0207665_100757131 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | WGQVSAEQLWGNCHADVIKNGMTPAAAVDKAFKRAEAIFAKFTFG |
| Ga0207661_115471962 | 3300025944 | Corn Rhizosphere | DAEQLWGQCHADVIKGGMKPSDAIDKAFKRCNEIFAKIQI |
| Ga0207651_104309233 | 3300025960 | Switchgrass Rhizosphere | WGQCDAEQLWGQAHADVIKGGMKPADAVDKAFKRCNAIFAKIQI |
| Ga0207651_106271881 | 3300025960 | Switchgrass Rhizosphere | NAEQLWGQAHADVIKNGMKPADAVDKAFKRCNEIFAKVAM |
| Ga0207677_111204221 | 3300026023 | Miscanthus Rhizosphere | GQVAAEQLWTQACADVIKNGMTVQAAVDKAIKRAEAIFAKVTF |
| Ga0207639_107579441 | 3300026041 | Corn Rhizosphere | EQLWGQAHADVIKNGMKPADAVDKAFKRCNEIFAKVAM |
| Ga0207674_104993211 | 3300026116 | Corn Rhizosphere | AEQLWGNCHADVIKNGMTPSAAIDKAFKRAEAIFAKYTFG |
| Ga0207862_10471321 | 3300027703 | Tropical Forest Soil | WGQAHADVIKNGMTPEQAIDKAFKRAEQIFSQVTF |
| Ga0209448_102022431 | 3300027783 | Bog Forest Soil | LWGQAHADVIKNGMKVADAVDKAFKRCNEIFAKITI |
| Ga0209624_110657372 | 3300027895 | Forest Soil | PAWGQANAEQLWGQAHADVIKNGMKVADAVDKAFKRCNEIFAKVVM |
| Ga0209006_100313921 | 3300027908 | Forest Soil | AEQLWGNCHADVIKNGMTPAAAVDKAFTRAEAIFAKFTFG |
| Ga0209006_104209301 | 3300027908 | Forest Soil | WGQAHADVIKNGMTLAAAVDKAFSRMERIFSEYTFD |
| Ga0268266_104313681 | 3300028379 | Switchgrass Rhizosphere | NAEQLWGQAHADVIKNGMTPTAAVDKAFKRMETIFARFTFE |
| Ga0302197_104831091 | 3300028873 | Bog | WGQAHADVIKNGLKPADAVDKAFRRAETIFAKFTFG |
| Ga0307286_100320351 | 3300028876 | Soil | MRRRQLWGQAHADVIKNGMTPAAAIDKAFKRCNEIFTKIVI |
| Ga0311340_104098152 | 3300029943 | Palsa | INAEQLWSVAHADVIKNRMTPVDAVDKAFRRAEAIFAKFTFR |
| Ga0311330_109953702 | 3300029945 | Bog | QVSAEQLWGQAHADVIKDGIKPADAVDKAFRRAETIFAKFTFG |
| Ga0311346_107808042 | 3300029952 | Bog | WGQAHADVIKNGMTPAQAIDKAFKRTEQIFAKMTFD |
| Ga0311343_103027732 | 3300029953 | Bog | AEQLWGVAHADVIRNGMTASDAVDKAFRRAETIFTRFTFG |
| Ga0311343_109835411 | 3300029953 | Bog | NAEQLWGVAHADVIKNGMTPAAAVDKAFRRAEAIFAKFTFG |
| Ga0311336_107082091 | 3300029990 | Fen | WGQAQADVIKGGMTAAAAIDKAFKRADQIFTKYPT |
| Ga0210275_102760761 | 3300030578 | Soil | QLWGVAHADVIKNGMTPTDAVDKAFRRAEAIFAKFTFG |
| Ga0265462_122232702 | 3300030738 | Soil | WGQAHADVIKNGMKPAEAVDKAFKRTEQIFAKMTFG |
| Ga0302323_1002011323 | 3300031232 | Fen | VCAEQVWGQAQADVIKGGMTAAAAIDKAFKRADQIFAKYPT |
| Ga0311364_107761741 | 3300031521 | Fen | WGQAQADVIKGGMTAAAAIDKAFKRADQIFAKYPT |
| Ga0302326_104840251 | 3300031525 | Palsa | QIWGQAHADVIKNSMKAADAVDKAFKRASQIFASMVM |
| Ga0302326_118717792 | 3300031525 | Palsa | GQANAEQLWGQAHADVIKNGMKVADAVDKAFRRTEQIFAKMTFG |
| Ga0318516_106947121 | 3300031543 | Soil | WGQAHADVIKNGMTPTAAIDKAFKRCNEIFAKITI |
| Ga0307476_113758642 | 3300031715 | Hardwood Forest Soil | QVWGQAHADVIKNGMTPEQAIDKAFKRAEAIFSTVTF |
| Ga0306918_109900932 | 3300031744 | Soil | IWGQAHADVIKNGMTPEQAIDKAFKRAEQIFSQVTF |
| Ga0318509_107098431 | 3300031768 | Soil | GQCDAEQLWGQAHADVIKNGMKPADAVDKAFKRCTEIFAKITI |
| Ga0318543_103303191 | 3300031777 | Soil | QLWGQAHADVIKNGMKVADAVDKAFKRCNEIFARVVM |
| Ga0310916_114547941 | 3300031942 | Soil | PLRGQAQADVIKNGKKVADAVDKAFKRCNEIFARVVM |
| Ga0306922_118239381 | 3300032001 | Soil | LWGQAHADVIKNGMKVADAVDKAFKRCNEIFARVVM |
| Ga0318563_100885133 | 3300032009 | Soil | AEQLWGQAHADVIKNGMKVADAVDKAFKRCNEIFARVVM |
| Ga0308173_117773221 | 3300032074 | Soil | WGQANAEQLWGQAHADVIKNSMKPADAVDKAFKRANEIFARMAT |
| Ga0311301_124592682 | 3300032160 | Peatlands Soil | GLAHADVIKNGMTPAAAVDKAFKRAEAIFTKFTFG |
| Ga0306920_1032322052 | 3300032261 | Soil | EQLWGQAHADVIKNGMKVADAVDKAFKRCNEIFARVVM |
| Ga0348332_105797343 | 3300032515 | Plant Litter | NAEHLWGVCHADVIKNGMTPAQAVDKCFSRVEAIFAKFTFG |
| Ga0315742_127096791 | 3300032756 | Forest Soil | GQVNAEQLFGQCHADVIKNGMTPAAAVDKAFRRAEAIFAKFTFG |
| Ga0335081_118249121 | 3300032892 | Soil | CDAEQLWGQAHADVIKNGATPAASIDKAFKRCNEIFAKITI |
| Ga0335075_107297732 | 3300032896 | Soil | WGQANAEQLWGQAHADVIKNGMKVSDAVDKAFKRCNEIFSRVEM |
| Ga0335072_112689592 | 3300032898 | Soil | LWGQAEADVIKSNMTPEAAVDKAFRRAEQIFSRYKIGET |
| Ga0370545_169384_2_139 | 3300034643 | Soil | AYGQVAAEQLWTQACADVIKNGMTVQVAVNKAIKRAEEIFAKVTF |
| Ga0370548_123038_425_544 | 3300034644 | Soil | AEQLWGQASADVIKGNMKPADAVDKAFKRGNEIFARIVI |
| ⦗Top⦘ |