NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F054286

Metagenome / Metatranscriptome Family F054286

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F054286
Family Type Metagenome / Metatranscriptome
Number of Sequences 140
Average Sequence Length 38 residues
Representative Sequence MATAEAKLHVSEFTNEPFIDFSNAENRKRMEAALAKV
Number of Associated Samples 124
Number of Associated Scaffolds 140

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 97.14 %
% of genes near scaffold ends (potentially truncated) 99.29 %
% of genes from short scaffolds (< 2000 bps) 89.29 %
Associated GOLD sequencing projects 114
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (79.286 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(25.000 % of family members)
Environment Ontology (ENVO) Unclassified
(24.286 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(55.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 23.08%    β-sheet: 0.00%    Coil/Unstructured: 76.92%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 140 Family Scaffolds
PF00202Aminotran_3 5.71
PF03544TonB_C 5.71
PF05899Cupin_3 4.29
PF03551PadR 2.86
PF05960DUF885 2.86
PF04255DUF433 2.14
PF10077DUF2314 2.14
PF00583Acetyltransf_1 2.14
PF01878EVE 1.43
PF00753Lactamase_B 1.43
PF06146PsiE 1.43
PF00578AhpC-TSA 1.43
PF00903Glyoxalase 1.43
PF08238Sel1 1.43
PF00561Abhydrolase_1 0.71
PF01476LysM 0.71
PF10518TAT_signal 0.71
PF07927HicA_toxin 0.71
PF13442Cytochrome_CBB3 0.71
PF00069Pkinase 0.71
PF01268FTHFS 0.71
PF07719TPR_2 0.71
PF02517Rce1-like 0.71
PF13444Acetyltransf_5 0.71
PF13289SIR2_2 0.71
PF12852Cupin_6 0.71
PF04140ICMT 0.71
PF01571GCV_T 0.71
PF01850PIN 0.71
PF08388GIIM 0.71
PF13545HTH_Crp_2 0.71
PF01593Amino_oxidase 0.71
PF12680SnoaL_2 0.71
PF13376OmdA 0.71
PF13432TPR_16 0.71
PF11146DUF2905 0.71
PF00072Response_reg 0.71
PF01925TauE 0.71

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 140 Family Scaffolds
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 5.71
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 2.86
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 2.86
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 2.86
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 2.86
COG4805Uncharacterized conserved protein, DUF885 familyFunction unknown [S] 2.86
COG2442Predicted antitoxin component of a toxin-antitoxin system, DUF433 familyDefense mechanisms [V] 2.14
COG1673Predicted RNA-binding protein, contains PUA-like EVE domainGeneral function prediction only [R] 1.43
COG2947Predicted RNA-binding protein, contains EVE domainGeneral function prediction only [R] 1.43
COG3223Phosphate starvation-inducible membrane PsiE (function unknown)General function prediction only [R] 1.43
COG0730Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 familyInorganic ion transport and metabolism [P] 0.71
COG1266Membrane protease YdiL, CAAX protease familyPosttranslational modification, protein turnover, chaperones [O] 0.71
COG1724Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase familyGeneral function prediction only [R] 0.71
COG2759Formyltetrahydrofolate synthetaseNucleotide transport and metabolism [F] 0.71
COG4449Predicted protease, Abi (CAAX) familyGeneral function prediction only [R] 0.71


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms79.29 %
UnclassifiedrootN/A20.71 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664022|INPgaii200_c0957920Not Available649Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101160953Not Available630Open in IMG/M
3300001174|JGI12679J13547_1005205All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300002245|JGIcombinedJ26739_101117244All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300004152|Ga0062386_100164963All Organisms → cellular organisms → Bacteria1733Open in IMG/M
3300004152|Ga0062386_101547848Not Available553Open in IMG/M
3300005179|Ga0066684_10590242All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae746Open in IMG/M
3300005447|Ga0066689_10570928All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300005537|Ga0070730_10648083Not Available672Open in IMG/M
3300005541|Ga0070733_10607990All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300005556|Ga0066707_10503335All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae786Open in IMG/M
3300005557|Ga0066704_10825242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Ectobacillus → Ectobacillus panaciterrae576Open in IMG/M
3300005602|Ga0070762_10748342Not Available658Open in IMG/M
3300005610|Ga0070763_10953265All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → unclassified Paenibacillus → Paenibacillus sp. A9512Open in IMG/M
3300005921|Ga0070766_11224227Not Available520Open in IMG/M
3300005993|Ga0080027_10028625All Organisms → cellular organisms → Bacteria1987Open in IMG/M
3300006034|Ga0066656_10805429All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300006173|Ga0070716_100556660All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300006791|Ga0066653_10614591All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae553Open in IMG/M
3300006797|Ga0066659_11414193All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300006852|Ga0075433_11468795All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300007265|Ga0099794_10350359All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300009038|Ga0099829_10064534All Organisms → cellular organisms → Bacteria2759Open in IMG/M
3300009088|Ga0099830_10281946All Organisms → cellular organisms → Bacteria → Acidobacteria1322Open in IMG/M
3300009088|Ga0099830_11509600All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium559Open in IMG/M
3300009089|Ga0099828_11211273All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300009143|Ga0099792_10480016All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium775Open in IMG/M
3300010159|Ga0099796_10586371All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300010321|Ga0134067_10005362All Organisms → cellular organisms → Bacteria → Acidobacteria3419Open in IMG/M
3300010358|Ga0126370_10125553All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1828Open in IMG/M
3300010360|Ga0126372_11695283Not Available673Open in IMG/M
3300010361|Ga0126378_10571000All Organisms → cellular organisms → Bacteria → Acidobacteria1245Open in IMG/M
3300010366|Ga0126379_11890207Not Available700Open in IMG/M
3300010376|Ga0126381_103495346Not Available617Open in IMG/M
3300011269|Ga0137392_10612216All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium904Open in IMG/M
3300011271|Ga0137393_10238103All Organisms → cellular organisms → Bacteria1543Open in IMG/M
3300012096|Ga0137389_10973924Not Available727Open in IMG/M
3300012096|Ga0137389_11615997All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300012200|Ga0137382_11168969All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300012202|Ga0137363_11036159All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium697Open in IMG/M
3300012203|Ga0137399_10983782All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium710Open in IMG/M
3300012206|Ga0137380_11182262All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300012349|Ga0137387_11017736All Organisms → cellular organisms → Bacteria → Acidobacteria594Open in IMG/M
3300012351|Ga0137386_10373242All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1027Open in IMG/M
3300012357|Ga0137384_10148721All Organisms → cellular organisms → Bacteria1960Open in IMG/M
3300012361|Ga0137360_10880576All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium772Open in IMG/M
3300012363|Ga0137390_11315185All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria668Open in IMG/M
3300012923|Ga0137359_11714080Not Available516Open in IMG/M
3300012927|Ga0137416_10554537All Organisms → cellular organisms → Bacteria → Acidobacteria996Open in IMG/M
3300012929|Ga0137404_10298042All Organisms → cellular organisms → Bacteria1398Open in IMG/M
3300012930|Ga0137407_10589204All Organisms → cellular organisms → Bacteria1043Open in IMG/M
3300012930|Ga0137407_10786511All Organisms → cellular organisms → Bacteria898Open in IMG/M
3300012960|Ga0164301_11874423All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300012961|Ga0164302_11902037All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300012975|Ga0134110_10049713All Organisms → cellular organisms → Bacteria → Acidobacteria1653Open in IMG/M
3300014153|Ga0181527_1213669All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium797Open in IMG/M
3300014164|Ga0181532_10185206All Organisms → cellular organisms → Bacteria1229Open in IMG/M
3300014169|Ga0181531_10119863All Organisms → cellular organisms → Bacteria1580Open in IMG/M
3300015264|Ga0137403_11329287All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium565Open in IMG/M
3300016294|Ga0182041_11798675All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300016422|Ga0182039_12258717Not Available502Open in IMG/M
3300017928|Ga0187806_1313894Not Available555Open in IMG/M
3300017974|Ga0187777_11397102All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300017975|Ga0187782_11208296Not Available592Open in IMG/M
3300018043|Ga0187887_10844508All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium542Open in IMG/M
3300018088|Ga0187771_11549355Not Available562Open in IMG/M
3300018090|Ga0187770_10886444Not Available716Open in IMG/M
3300018090|Ga0187770_11623048Not Available528Open in IMG/M
3300020579|Ga0210407_10943954All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300020580|Ga0210403_10005493All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae10745Open in IMG/M
3300020582|Ga0210395_10089437All Organisms → cellular organisms → Bacteria2273Open in IMG/M
3300020583|Ga0210401_10006449All Organisms → cellular organisms → Bacteria11894Open in IMG/M
3300020583|Ga0210401_10018116All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis6792Open in IMG/M
3300021088|Ga0210404_10581457All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300021088|Ga0210404_10611638All Organisms → cellular organisms → Bacteria → Acidobacteria619Open in IMG/M
3300021088|Ga0210404_10625384All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300021168|Ga0210406_10029147All Organisms → cellular organisms → Bacteria5012Open in IMG/M
3300021168|Ga0210406_10157412All Organisms → cellular organisms → Bacteria1904Open in IMG/M
3300021170|Ga0210400_10294552All Organisms → cellular organisms → Bacteria → Acidobacteria1331Open in IMG/M
3300021170|Ga0210400_10451530All Organisms → cellular organisms → Bacteria → Acidobacteria1060Open in IMG/M
3300021170|Ga0210400_10646782Not Available871Open in IMG/M
3300021171|Ga0210405_10544885All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300021178|Ga0210408_10171039All Organisms → cellular organisms → Bacteria → Acidobacteria1725Open in IMG/M
3300021406|Ga0210386_11119556All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300021407|Ga0210383_11794267Not Available500Open in IMG/M
3300021475|Ga0210392_10126599All Organisms → cellular organisms → Bacteria1717Open in IMG/M
3300021478|Ga0210402_11851608All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300021560|Ga0126371_10134802Not Available2513Open in IMG/M
3300021560|Ga0126371_10603202All Organisms → cellular organisms → Bacteria → Acidobacteria1247Open in IMG/M
3300024330|Ga0137417_1311699All Organisms → cellular organisms → Bacteria → Proteobacteria4518Open in IMG/M
3300024330|Ga0137417_1479689All Organisms → cellular organisms → Bacteria1496Open in IMG/M
3300025419|Ga0208036_1041117All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium821Open in IMG/M
3300025914|Ga0207671_10302652Not Available1263Open in IMG/M
3300025916|Ga0207663_11268435All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium593Open in IMG/M
3300025929|Ga0207664_11641550All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium565Open in IMG/M
3300025939|Ga0207665_10012435All Organisms → cellular organisms → Bacteria5591Open in IMG/M
3300026281|Ga0209863_10046369All Organisms → cellular organisms → Bacteria1296Open in IMG/M
3300026309|Ga0209055_1055303All Organisms → cellular organisms → Bacteria → Acidobacteria1697Open in IMG/M
3300026317|Ga0209154_1166727All Organisms → cellular organisms → Bacteria → Acidobacteria898Open in IMG/M
3300026318|Ga0209471_1143012All Organisms → cellular organisms → Bacteria → Acidobacteria997Open in IMG/M
3300026331|Ga0209267_1066120All Organisms → cellular organisms → Bacteria → Acidobacteria1591Open in IMG/M
3300026475|Ga0257147_1016228All Organisms → cellular organisms → Bacteria1021Open in IMG/M
3300026551|Ga0209648_10477379All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300026557|Ga0179587_11053691All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300027071|Ga0209214_1038571All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300027512|Ga0209179_1116686All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300027574|Ga0208982_1134646Not Available507Open in IMG/M
3300027591|Ga0209733_1006812All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2952Open in IMG/M
3300027643|Ga0209076_1101601Not Available816Open in IMG/M
3300027671|Ga0209588_1013999All Organisms → cellular organisms → Bacteria2453Open in IMG/M
3300027671|Ga0209588_1023719All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1935Open in IMG/M
3300027674|Ga0209118_1206687Not Available527Open in IMG/M
3300027768|Ga0209772_10160909All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium706Open in IMG/M
3300027795|Ga0209139_10240602All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300027842|Ga0209580_10208495All Organisms → cellular organisms → Bacteria → Acidobacteria970Open in IMG/M
3300027846|Ga0209180_10460469Not Available716Open in IMG/M
3300027846|Ga0209180_10779796All Organisms → cellular organisms → Bacteria → Acidobacteria513Open in IMG/M
3300027857|Ga0209166_10340798Not Available784Open in IMG/M
3300028906|Ga0308309_11459284All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300029636|Ga0222749_10443657All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium694Open in IMG/M
3300030862|Ga0265753_1127111Not Available538Open in IMG/M
3300031057|Ga0170834_105337650All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300031057|Ga0170834_105636922All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300031231|Ga0170824_117647054All Organisms → cellular organisms → Bacteria → Proteobacteria658Open in IMG/M
3300031561|Ga0318528_10809473Not Available501Open in IMG/M
3300031564|Ga0318573_10279256All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300031682|Ga0318560_10363102All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis783Open in IMG/M
3300031715|Ga0307476_10076884All Organisms → cellular organisms → Bacteria2324Open in IMG/M
3300031744|Ga0306918_11078605All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300031753|Ga0307477_10206045All Organisms → cellular organisms → Bacteria1367Open in IMG/M
3300031754|Ga0307475_11493855All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300031770|Ga0318521_10468913All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300031890|Ga0306925_11232289All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300032001|Ga0306922_10048728All Organisms → cellular organisms → Bacteria4379Open in IMG/M
3300032076|Ga0306924_10168251All Organisms → cellular organisms → Bacteria2514Open in IMG/M
3300032091|Ga0318577_10160140All Organisms → cellular organisms → Bacteria1073Open in IMG/M
3300032205|Ga0307472_102757618All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300032782|Ga0335082_11135620Not Available648Open in IMG/M
3300032783|Ga0335079_10663344All Organisms → cellular organisms → Bacteria1094Open in IMG/M
3300033290|Ga0318519_10188339All Organisms → cellular organisms → Bacteria1172Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil25.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil19.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.29%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.29%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.29%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.57%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.86%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.86%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.86%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.86%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.14%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.14%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.14%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.43%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.43%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil1.43%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.71%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.71%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.71%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.71%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.71%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.71%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.71%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001174Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025419Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026281Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300026475Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-AEnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027071Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027512Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027574Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027591Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027643Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027674Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027795Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030862Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPgaii200_095792022228664022SoilMATAEPRLQKPEFVNEPFVDFSKQENRAAMEAALGKVA
INPhiseqgaiiFebDRAFT_10116095313300000364SoilMATAETKLHKTEFTNEPFVDFSRPENRTAMEGALKKV
JGI12679J13547_100520513300001174Forest SoilMATAEAKLHVPEFTNEPFIDFSNAENRKRMETALAKVKAEFG
JGIcombinedJ26739_10111724423300002245Forest SoilMATAEAKLQVPEFTNEPFIDFSNADNRKKMEEALKKVH
Ga0062386_10016496333300004152Bog Forest SoilMATAKAKLKVKEFTNERFIDFSTAANRKKMEQALAKVKAEFG
Ga0062386_10154784823300004152Bog Forest SoilMATAKAKLKVKEFTNEPFIDFSNAANRKKMEQALAKVKAEFG
Ga0066684_1059024223300005179SoilMATAEIRLQKPEFVNEAFVDFTRPENRTAMEGALKKVASEFGRE
Ga0066689_1057092823300005447SoilMVTVERKIQRGEFSNEPFVNFSMPENRKAMEDALKKVAGE
Ga0070730_1064808313300005537Surface SoilMATAEAKLHVAEFTNEPFIDFSNAENRKRMEAALAKVK
Ga0070733_1060799023300005541Surface SoilMATAEAKLQVAEFTNEPFVDFSKPENKKAMEEALK
Ga0066707_1050333523300005556SoilMATAEVKLKKTEFTNEPFVDFSKPENRAAMEAALKKVAS
Ga0066704_1082524213300005557SoilMATAESTIRHTEFTNEPFIDFSKPENRRAMEAALKKVA
Ga0070762_1074834213300005602SoilMATAERFHLTEFTNEAFVDFSRPENKSAMEAALAK
Ga0070763_1095326513300005610SoilMATAEKTVHVSEFTNETFIDFSKPENRKRMEDALK
Ga0070766_1122422713300005921SoilMATAETTLRVGDFINEAFVDFSRPENKAAMEAALK
Ga0080027_1002862513300005993Prmafrost SoilMATAGQLQITEFSNEAFVDFTRPENRTAMEAALAKV
Ga0066656_1080542923300006034SoilMATAEQKLRVSEFTNEPFVDFSKAENRKAMEEALKKVAGEF
Ga0070716_10055666023300006173Corn, Switchgrass And Miscanthus RhizosphereMATAEAKVQVGEFTNEPFVDFSKAENRVSMEAALKKV
Ga0066653_1061459123300006791SoilVATAEQKLPISEFTNEPFIDFSKPENRKRMEDALKK
Ga0066659_1141419323300006797SoilMATAEQTVHVSEFTNELFIDFSKPENRSRMEDALKKV
Ga0075433_1146879523300006852Populus RhizosphereMATAEIKLKKTEFTNEPFVDFSKSENRAAMEAALKKVA
Ga0099794_1035035913300007265Vadose Zone SoilMATAEQVVHVSEFTNEPFIDFTKPENRARMEEALKKVR
Ga0099829_1006453433300009038Vadose Zone SoilMATAEQKLRLPEFSNEPFIDFSEPENRKRMEEALKK
Ga0099830_1028194623300009088Vadose Zone SoilMATAETKVQVSEFVNEAFIDFSRPENRKRMEEALA
Ga0099830_1150960013300009088Vadose Zone SoilMATAEQIVHVSEFTNEPFIDFTKAENRGRMEEALKKVKAE
Ga0099828_1121127313300009089Vadose Zone SoilMATAEQKIHVTEFTNEPFIDFSEPENRKHMEDALKKVPSEFG
Ga0099792_1048001623300009143Vadose Zone SoilMATAETKPQVSEFLNEPFIDFSRAENKTRMEEALKKV
Ga0099796_1058637123300010159Vadose Zone SoilMATAETKPQVSEFLNEPFIDFSRAENKTRMEEALKKVAAELG
Ga0134067_1000536213300010321Grasslands SoilVATAEQKLHLTEFTNEPFIDFSKPENRKRMEDALKK
Ga0126370_1012555323300010358Tropical Forest SoilLRRDFTVATAEQKLHISEFTNEPFIDFSKPENRKRMEEALK
Ga0126372_1169528313300010360Tropical Forest SoilMATAEAKLHKSDFTKEPYVDCTKAENRASMEAALR
Ga0126378_1057100023300010361Tropical Forest SoilMATAEQKLHISEFTNEPFIDFSKPENRKRMEEALKQV
Ga0126379_1189020713300010366Tropical Forest SoilMATAEAKLHKTEFTNEPFVDFTTAENRAAMEAALKTV
Ga0126381_10349534623300010376Tropical Forest SoilMATAEVKLQKPEFVNEPFVDFSKSENRAAMEAALKKAAEEF
Ga0137392_1061221613300011269Vadose Zone SoilMATAEQVVHVSEFTNEPFIDFTKAENRGRMEEALKKVRG
Ga0137393_1023810323300011271Vadose Zone SoilMATAEAKLHVAEFANEPFIDFSNAENRKRMEAALAKVK
Ga0137389_1097392423300012096Vadose Zone SoilMVTAEVKIQRGEFANEPFVDFSKPENRKAMEDALKKVA
Ga0137389_1161599713300012096Vadose Zone SoilMATAETKLHLLEFTNEPYVDFSKPENRKKMVDALKKVA
Ga0137382_1116896923300012200Vadose Zone SoilMATAEQVVHVSEFTNEAFIDFTKADNRARMQEVLKKV
Ga0137363_1103615913300012202Vadose Zone SoilLEIEEEGVMATAEQVVHVSEFTNEPFIDFMKAENRARMEEALKKVKAEF
Ga0137399_1098378223300012203Vadose Zone SoilMATAEKTLHVSEFTNEPFIDFSKPENRKRMEDALK
Ga0137380_1118226213300012206Vadose Zone SoilMATAEQKIHVTEFTNEPFTDFSKPENRARMEEALKKV
Ga0137387_1101773623300012349Vadose Zone SoilLQDEEGSVMATAEQVVHVSEFTNEAFIDFTKAENRARMEAAL
Ga0137386_1037324213300012351Vadose Zone SoilMATAEQTVHVSEFTNELFIDFSKPENRSRMEDALKKVK
Ga0137384_1014872133300012357Vadose Zone SoilMATAETRLQKPEFVNEPFVDFTKAENRAAMEAALKKVAS
Ga0137360_1088057623300012361Vadose Zone SoilLEIEEEGVMATAEQVVHVSEFTNEAFIDFTKAENRARMEEALKKVKAEFG
Ga0137390_1131518523300012363Vadose Zone SoilMATAEAKLHVAEFANEPFIDFSNAENRKRMEAALAK
Ga0137359_1171408023300012923Vadose Zone SoilMATAETRLQKAEFGNEAFMDFTKGENRAAMEATLKKVAAEFGRE
Ga0137416_1055453713300012927Vadose Zone SoilMATAEKIVHVSEFTNEPFIDFTKAENRTRMQEALKKVKAE
Ga0137404_1029804233300012929Vadose Zone SoilMATAEAKLHVAEFTNEPFIDFSNAENRKRMEAALAKVKA
Ga0137407_1058920433300012930Vadose Zone SoilMATAEAKLHVSEFTNEPFIDFSNAENRKRMEAALAKV
Ga0137407_1078651113300012930Vadose Zone SoilMATAEQIVHVSEFTNEPFIDFTKAENRTRMQEALKKVKAE
Ga0164301_1187442313300012960SoilMATADAKVRVSEFTNEPFVDFSRPENRAAMEAALKKV
Ga0164302_1190203713300012961SoilMMATAETKVQVSEFTNEPFLDFSKAENRVPMEAALKKVASE
Ga0134110_1004971343300012975Grasslands SoilMATAEKIVHVSEFTNEPFIDFTKPENRTRMEEALKK
Ga0181527_121366913300014153BogMATAKAKLKVREFTNEPLTDFSNAVNRKKMEKALKK
Ga0181532_1018520613300014164BogMATSKAKLHGHVAEFTNEPFIDFSKPENKKKMEAALKRVRAE
Ga0181531_1011986313300014169BogMLGGNRAMATAEAKLHMSEFANEPFVDFSVPENKRAMEAALAKVAG
Ga0137403_1132928713300015264Vadose Zone SoilMATAETKPQVSEFVNEPFIDFSRPENKARMEEALKKVAAE
Ga0182041_1179867513300016294SoilMATAEAKITVPEFSNEPFIDFSNADNRKKMEEALKKVAS
Ga0182039_1225871713300016422SoilMATAEAKLHKPDFANEPFVDFSKPENRRAMEAALKKVA
Ga0187806_131389423300017928Freshwater SedimentMATAEAKLHVPEFTNEPFIDFSNAENRKRMEAALAK
Ga0187777_1139710213300017974Tropical PeatlandMATAEAKLHVPEFTNEPFIDFSTPENQKKMEEALKKV
Ga0187782_1120829613300017975Tropical PeatlandMATSKAKLRGHAREFTNEPFIDFSKPENKKKMEAA
Ga0187887_1084450823300018043PeatlandMATAKAKLKVKAFTNEPFIDFSNPTNKKKMEQALAKV
Ga0187771_1154935513300018088Tropical PeatlandMASVDTKVQLPEFTNEPFINFSGAENRKRMEDALKKVA
Ga0187770_1088644413300018090Tropical PeatlandMATAKGKVQVREFRNEPLTDFSNVANRKKMEKALKKVA
Ga0187770_1162304823300018090Tropical PeatlandMATVEPKVQRPEFANEPFIDFSSAENRKRMEEALKKV
Ga0210407_1094395413300020579SoilMGTAEAKLHVAEFTNEPFIDFSNAENRKRMEAALAKVK
Ga0210403_1000549313300020580SoilMATAEAKIHVSEFSNEPFIDFSKPENRKAMEDALKKVAS
Ga0210395_1008943713300020582SoilMATAEAKIHVSEFSNEPFIDFSKPENRKAMEDALKKV
Ga0210401_1000644913300020583SoilMATAEAKLHVPEFTNEPFIDFSNAENRKRMEAALAKVKA
Ga0210401_1001811673300020583SoilMATAEAKLHVPEFTNEPFIDFSKPDNRKKMEEALK
Ga0210404_1058145723300021088SoilMATAETKPQASEFVNEPFIDFSRPENRKRMEEALKKVAG
Ga0210404_1061163823300021088SoilMATAEQIVHVSEFANEAFIDFTKAENRSHMEAALKKVKAEFG
Ga0210404_1062538413300021088SoilMATAETKVQASEFVNEPFIDFSQPANRSRMEEALKKV
Ga0210406_1002914773300021168SoilMATAEAKLHVPEFTNEPFIDFSNAENRKRMEAALAKVK
Ga0210406_1015741233300021168SoilMATAEAKLHVAEFTNEPFIDFSNAENRKRMEVALA
Ga0210400_1029455223300021170SoilMATAEQIVHVSEFANEAFIDFTKAENRSHMEAALKKVKAEF
Ga0210400_1045153033300021170SoilMATAEQVVHVSEFTNEPFIDFTKAENRARMEEALKKVRG
Ga0210400_1064678213300021170SoilMATAEAKIHVSEFTNEPFIDFSKPENRKAMEDALKKVATE
Ga0210405_1054488523300021171SoilMATAESKLRISEFTNEPFVDFSRRENKRAMEAALKKVEA
Ga0210408_1017103943300021178SoilMATAETKIQVSEFTNEPFIDFSKPENRAAMEAALKKVA
Ga0210386_1111955613300021406SoilMATAETTVRVSDFANEPFVDFSRPENQAAMAAALKKVAA
Ga0210383_1179426723300021407SoilMATAETTIKRPEFTNEAFVDFSRPENKAAMEAALAK
Ga0210392_1012659913300021475SoilMATAEAKLHVAEFTNEPFIDFSNAENRKRMEAALVKVKAE
Ga0210402_1185160823300021478SoilMATAESKPHVSEFVNEPFIDFSRPENRKRMQEALTKVAG
Ga0126371_1013480243300021560Tropical Forest SoilMATADAKVHVTEFTNEPFIDFSNAENRKKMEEALKKVRG
Ga0126371_1060320213300021560Tropical Forest SoilMATAEAKITVPEFTNEPFIDFSNAENRKKMEEALKKVA
Ga0137417_131169983300024330Vadose Zone SoilMATAEQTVHVSEFTNEPFIDFSKPENRSRMEAALKKAK
Ga0137417_147968913300024330Vadose Zone SoilMATAEQTVHVSEFTNEPFIDFTKPENRSRMEEALK
Ga0208036_104111723300025419PeatlandMATAKAKLKVKEFTNEPFIDFSTAANRKKMEAALAKVKA
Ga0207671_1030265223300025914Corn RhizosphereMGAIMATAEAKLHKTEFTNETFVDFTKAENKAAMEAAL
Ga0207663_1126843513300025916Corn, Switchgrass And Miscanthus RhizosphereMATAEAKVQVSEFTNEPFVDFSKAENRASMEAALKKVADELG
Ga0207664_1164155013300025929Agricultural SoilMATAETRLQKPEFVNEAFIDFAKAENRAAMEAALKKVASE
Ga0207665_1001243553300025939Corn, Switchgrass And Miscanthus RhizosphereMATAETRLQKPEFVNEPFVDFTKAENHAAMEAALKKVA
Ga0209863_1004636933300026281Prmafrost SoilMATAGQLQITEFSNEAFVDFTRPENRTAMEAALAKVA
Ga0209055_105530313300026309SoilMATAEKIVHVSEFTNEPFIDFSKPENRTRMQEALK
Ga0209154_116672713300026317SoilMATAEKIVHVSEFTNEPFIDFSKPENRTRMQEALKQGKAEF
Ga0209471_114301233300026318SoilMATAEKIVHVSEFTNEPFIDFSKPENRTRMQEALKK
Ga0209267_106612043300026331SoilMATAEKIVHVSEFTNEPFIDFTKPENRTRMEEALKKV
Ga0257147_101622833300026475SoilMATAETRLQKPEFVNEAFIDFTKAENRAAMEAALKKVAAEF
Ga0209648_1047737913300026551Grasslands SoilMATAETKPQVSEFVNEPFIDFSRPENHKRMEEALKKV
Ga0179587_1105369123300026557Vadose Zone SoilMATAETRLQKPEFVNEAFIDFTKAENRAAMEAALKKVAA
Ga0209214_103857123300027071Forest SoilMATAETRLQKPEFVNEAFIDFTKAENRAAMEAALK
Ga0209179_111668623300027512Vadose Zone SoilMATAETKPQFSEFVNEPFLDFSRPENRKRMEDALAKVAAEFG
Ga0208982_113464623300027574Forest SoilMATAETTIKRPEFTNEAFVDFSRPENKAAMDAALAKVK
Ga0209733_100681213300027591Forest SoilMATAETKPQVSEFVNEPFIDFSRPENRARMEEALKKVA
Ga0209076_110160123300027643Vadose Zone SoilMATAEQIVHVSEFANEAFIDFTKAENRSHMEAALKKV
Ga0209588_101399963300027671Vadose Zone SoilMATAEQVVHVSEFTNEPFIDFSKAENRGRMEEALKKV
Ga0209588_102371953300027671Vadose Zone SoilMATAEQIVHVSEFTNEPFIDFTKAENRGRMEEALKKVKAEF
Ga0209118_120668713300027674Forest SoilMATAEAKLGLKEFTNEPFVDFSTAENRKKMEEALKQVAS
Ga0209772_1016090913300027768Bog Forest SoilMATAETTLHVSEFINEPFVDFSKHENKKSMEEALKK
Ga0209139_1024060213300027795Bog Forest SoilMATAETTVRVGDFANEPFVDFSRPENQAAMAAALG
Ga0209580_1020849523300027842Surface SoilMATAETKPQASEFVNEPFLDFSRPETRKRMEDALAKL
Ga0209180_1046046923300027846Vadose Zone SoilMVTAEVKIQRGEFTNEPFVDFSKPENRKAMEDALKKV
Ga0209180_1077979623300027846Vadose Zone SoilMATAEQIVHVSEFTNEPFIDFTKAENRGRMEEALKKVRG
Ga0209166_1034079823300027857Surface SoilMATAEAKLHKAEFTNEPFVDFSKPENRAAMEAALKKVA
Ga0308309_1145928413300028906SoilMATAEKTVHVSEFTNETFIDFSKPENRKRMEDALKKVKSE
Ga0222749_1044365713300029636SoilMATAEQIVQVSEFTNEPFIDFTKGENRSRMEEALKKVKAE
Ga0265753_112711123300030862SoilMATAEAKIQMSEFTNEPFVDFSKLENRKAMEYALKKFAS
Ga0170834_10533765013300031057Forest SoilMATAEAKIHVSEFSNEPFIDFSKSENRKAMEDALKKVA
Ga0170834_10563692213300031057Forest SoilMATAESKIHVSEFTNEPFVDFSKLDNKQAMRAALKKVEAEFG
Ga0170824_11764705413300031231Forest SoilMATAETSLQKSEFVNEPFVDFAKAENRDAMLAALKKV
Ga0318528_1080947323300031561SoilMATAEAKITVPEFTNEPFIDFSNAENRKKMEEALKKV
Ga0318573_1027925633300031564SoilMATAEVKLPVKEFTNEPFIDFSNAENRKKMEEALKK
Ga0318560_1036310213300031682SoilVATAEQTLPISEFTNEPFIDFSKPENRKRMEDALKKV
Ga0307476_1007688413300031715Hardwood Forest SoilMATAEAKIQVSEFTNEPFVDFSKPENRKAMEDALKKV
Ga0306918_1107860513300031744SoilMATAEAKITVPEFTNEPFIDFSNAENRKKMEEALKK
Ga0307477_1020604513300031753Hardwood Forest SoilVATAEQKLHLTEFTNEPFIDFSKPENRKRMEEALKKA
Ga0307475_1149385523300031754Hardwood Forest SoilMATAEAKIQVSEFTNEPFVDFSKSENRKATEDALKKVASEF
Ga0318521_1046891313300031770SoilMATAEVKLPVKEFTNEPFIDFSNAENRKKMEEALKQV
Ga0306925_1123228913300031890SoilMATAEVKLPVKEFTNEPFIDFSNAENRKKMEEALKKV
Ga0306922_1004872843300032001SoilMATAEVKLPVKEFTNEPFIDFSNAENRKKMEEALKQ
Ga0306924_1016825133300032076SoilVATAEQKPLISEFANEPFIDFSKPENRKRMEDALK
Ga0318577_1016014033300032091SoilMATAEAKITVPEFSNEPFIDFSNADNRKKMEEALKKVASE
Ga0307472_10275761813300032205Hardwood Forest SoilMATAETKPQVSEFVNEPFIDFSRPENKARMEEALKKVA
Ga0335082_1113562023300032782SoilMATADAKVHVTEFTNEPFIDFSNPDNRKKMEEALRK
Ga0335079_1066334413300032783SoilMATAEAKIQMTEFVNEPFVDFSKPENRQAMQAALKKVA
Ga0318519_1018833933300033290SoilMATAEVKLPVKEFTNEPFIDFSNAENRKKMEEALKKVSLEFGHE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.