| Basic Information | |
|---|---|
| Family ID | F054285 |
| Family Type | Metagenome |
| Number of Sequences | 140 |
| Average Sequence Length | 41 residues |
| Representative Sequence | LTNFATLTRMRIQLTLRNKMFLFFSVIMPFGFFFLYAGVFAK |
| Number of Associated Samples | 120 |
| Number of Associated Scaffolds | 140 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.29 % |
| % of genes near scaffold ends (potentially truncated) | 97.14 % |
| % of genes from short scaffolds (< 2000 bps) | 93.57 % |
| Associated GOLD sequencing projects | 113 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.571 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.429 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.571 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.29% β-sheet: 0.00% Coil/Unstructured: 45.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 140 Family Scaffolds |
|---|---|---|
| PF13732 | DUF4162 | 78.57 |
| PF01035 | DNA_binding_1 | 7.14 |
| PF00005 | ABC_tran | 5.00 |
| PF13304 | AAA_21 | 4.29 |
| PF10431 | ClpB_D2-small | 1.43 |
| PF13231 | PMT_2 | 0.71 |
| PF01740 | STAS | 0.71 |
| PF11937 | DUF3455 | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 140 Family Scaffolds |
|---|---|---|---|
| COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 7.14 |
| COG3695 | Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain | Transcription [K] | 7.14 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918007|ConsensusfromContig80776 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300000955|JGI1027J12803_101040148 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
| 3300000955|JGI1027J12803_107463201 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101444739 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300002557|JGI25381J37097_1020108 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300002909|JGI25388J43891_1029319 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300002914|JGI25617J43924_10304930 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300004080|Ga0062385_10930995 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300005175|Ga0066673_10534780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 688 | Open in IMG/M |
| 3300005332|Ga0066388_103538013 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300005454|Ga0066687_10626351 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300005468|Ga0070707_100672553 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300005541|Ga0070733_10888109 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300005542|Ga0070732_10870187 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300005548|Ga0070665_100459123 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
| 3300005559|Ga0066700_10743236 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300005561|Ga0066699_10109209 | All Organisms → cellular organisms → Bacteria | 1837 | Open in IMG/M |
| 3300005610|Ga0070763_10446661 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300005764|Ga0066903_101553645 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
| 3300006173|Ga0070716_100586702 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300006755|Ga0079222_10894427 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300006755|Ga0079222_11735721 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300006796|Ga0066665_11542052 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300006797|Ga0066659_10996549 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300006854|Ga0075425_101697142 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300006893|Ga0073928_10658223 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300009143|Ga0099792_10904761 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300009631|Ga0116115_1044845 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
| 3300010320|Ga0134109_10051280 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300010360|Ga0126372_10269756 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
| 3300010360|Ga0126372_11927384 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300010362|Ga0126377_13347245 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300010398|Ga0126383_10082285 | All Organisms → cellular organisms → Bacteria | 2815 | Open in IMG/M |
| 3300010398|Ga0126383_12272036 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300012189|Ga0137388_10361109 | All Organisms → cellular organisms → Bacteria | 1341 | Open in IMG/M |
| 3300012582|Ga0137358_10253187 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300012971|Ga0126369_11666477 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300012972|Ga0134077_10204529 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300014157|Ga0134078_10037365 | All Organisms → cellular organisms → Bacteria | 1625 | Open in IMG/M |
| 3300015241|Ga0137418_10266523 | All Organisms → cellular organisms → Bacteria | 1445 | Open in IMG/M |
| 3300016371|Ga0182034_11615479 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300016371|Ga0182034_11656489 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300016422|Ga0182039_11963535 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300017654|Ga0134069_1217751 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300017930|Ga0187825_10003945 | All Organisms → cellular organisms → Bacteria | 4875 | Open in IMG/M |
| 3300017934|Ga0187803_10211025 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300017959|Ga0187779_10057947 | All Organisms → cellular organisms → Bacteria | 2270 | Open in IMG/M |
| 3300017972|Ga0187781_10477057 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300018012|Ga0187810_10353197 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300018433|Ga0066667_12272893 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300018482|Ga0066669_10411673 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300019888|Ga0193751_1101667 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300020010|Ga0193749_1015918 | All Organisms → cellular organisms → Bacteria | 1470 | Open in IMG/M |
| 3300020140|Ga0179590_1078951 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300020170|Ga0179594_10112312 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300020170|Ga0179594_10146225 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300020579|Ga0210407_10518798 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300020579|Ga0210407_11475984 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300020580|Ga0210403_10159686 | All Organisms → cellular organisms → Bacteria | 1845 | Open in IMG/M |
| 3300020583|Ga0210401_10668753 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300020583|Ga0210401_10856893 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300021171|Ga0210405_10107954 | All Organisms → cellular organisms → Bacteria | 2197 | Open in IMG/M |
| 3300021171|Ga0210405_10341994 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300021180|Ga0210396_10611963 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300021401|Ga0210393_10347565 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
| 3300021401|Ga0210393_11310520 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300021402|Ga0210385_10083486 | All Organisms → cellular organisms → Bacteria | 2198 | Open in IMG/M |
| 3300021404|Ga0210389_11308313 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300021406|Ga0210386_10288864 | All Organisms → cellular organisms → Bacteria | 1404 | Open in IMG/M |
| 3300021420|Ga0210394_10319835 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
| 3300021432|Ga0210384_10337153 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
| 3300021474|Ga0210390_11161986 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300021475|Ga0210392_10014723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4293 | Open in IMG/M |
| 3300021475|Ga0210392_11085102 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300021478|Ga0210402_10142723 | All Organisms → cellular organisms → Bacteria | 2177 | Open in IMG/M |
| 3300021478|Ga0210402_10862650 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300021559|Ga0210409_10317359 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
| 3300021559|Ga0210409_10476478 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300021560|Ga0126371_11152745 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300024330|Ga0137417_1325005 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
| 3300024330|Ga0137417_1388991 | All Organisms → cellular organisms → Bacteria | 1851 | Open in IMG/M |
| 3300025898|Ga0207692_10723759 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300025915|Ga0207693_11370601 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300025933|Ga0207706_11517100 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300025939|Ga0207665_10104395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1983 | Open in IMG/M |
| 3300026360|Ga0257173_1072785 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300026515|Ga0257158_1116426 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300026557|Ga0179587_10416384 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300027039|Ga0207855_1058278 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300027583|Ga0209527_1128930 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300027587|Ga0209220_1123394 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300027605|Ga0209329_1008903 | All Organisms → cellular organisms → Bacteria | 1871 | Open in IMG/M |
| 3300027633|Ga0208988_1062147 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300027643|Ga0209076_1181764 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300027748|Ga0209689_1078316 | All Organisms → cellular organisms → Bacteria | 1758 | Open in IMG/M |
| 3300027783|Ga0209448_10278849 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300027829|Ga0209773_10056006 | All Organisms → cellular organisms → Bacteria | 1597 | Open in IMG/M |
| 3300027829|Ga0209773_10268429 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300027846|Ga0209180_10617364 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300027862|Ga0209701_10330607 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300027889|Ga0209380_10819175 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300027903|Ga0209488_10921036 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300028379|Ga0268266_10681300 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300028536|Ga0137415_10586148 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300028536|Ga0137415_11392728 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300028746|Ga0302233_10039289 | All Organisms → cellular organisms → Bacteria | 1976 | Open in IMG/M |
| 3300028795|Ga0302227_10281383 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300028806|Ga0302221_10062797 | All Organisms → cellular organisms → Bacteria | 1683 | Open in IMG/M |
| 3300028906|Ga0308309_11802745 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300030399|Ga0311353_11157650 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300031122|Ga0170822_16386236 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300031240|Ga0265320_10481641 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300031546|Ga0318538_10160915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas oryzae → Xanthomonas oryzae pv. oryzae → Xanthomonas oryzae pv. oryzae KACC 10331 | 1189 | Open in IMG/M |
| 3300031573|Ga0310915_10011876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5081 | Open in IMG/M |
| 3300031715|Ga0307476_10590521 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300031718|Ga0307474_11630600 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300031720|Ga0307469_10257008 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
| 3300031720|Ga0307469_10516826 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300031720|Ga0307469_11367534 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300031740|Ga0307468_101510697 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300031754|Ga0307475_10343366 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
| 3300031754|Ga0307475_10632243 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300031794|Ga0318503_10102393 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300031820|Ga0307473_10326899 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300031845|Ga0318511_10324520 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300031879|Ga0306919_10616371 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300031910|Ga0306923_10580275 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300031941|Ga0310912_11474057 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300031946|Ga0310910_10346254 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300031954|Ga0306926_11198750 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300032008|Ga0318562_10469883 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300032044|Ga0318558_10530079 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300032063|Ga0318504_10190204 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300032160|Ga0311301_10048762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 9785 | Open in IMG/M |
| 3300032174|Ga0307470_10675656 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300032180|Ga0307471_100784655 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300032205|Ga0307472_101565366 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300032205|Ga0307472_102205279 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300032770|Ga0335085_11764142 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300033405|Ga0326727_10489520 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.57% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.43% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 9.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.29% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.57% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.57% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.57% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.86% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.86% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.14% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.43% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.43% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.43% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.43% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.71% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.71% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.71% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.71% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.71% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.71% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020010 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027039 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A_all_C_02659030 | 2140918007 | Soil | LNNFIALTRMRIQLTIRNKMFLFFSVIMPFGFFFLYA |
| JGI1027J12803_1010401483 | 3300000955 | Soil | LTNLVTLTRMRVQLALRNKMFFFFSIILPLGFFFLYCGVF |
| JGI1027J12803_1074632011 | 3300000955 | Soil | LTNLATLTRVRMQLALRNKMFFFFSVVMPLGFFFLYAGV |
| JGIcombinedJ26739_1014447392 | 3300002245 | Forest Soil | LTNLVTLTRVRMQLALRNKMFFFFSVIMPLAFFFLYAGIFAKGVAK |
| JGI25381J37097_10201082 | 3300002557 | Grasslands Soil | LTNFATLTRMRIQLTLRNKMFLFFSVIMPFGFFFLYAGVFGRG |
| JGI25388J43891_10293191 | 3300002909 | Grasslands Soil | LTNFATLTRMRIQLTLRNKMFLFFSVIMPFGFFFLYAGVFGR |
| JGI25617J43924_103049301 | 3300002914 | Grasslands Soil | LSNFASLTRMRIQLALRNRMFFFFSVVFPLGMFFLYAGIFAK |
| Ga0062385_109309951 | 3300004080 | Bog Forest Soil | LKNFATLTRMRIQLTLRNKMFLFFSVIMPFGFFFLYAGIFARGIPRQ |
| Ga0066673_105347802 | 3300005175 | Soil | LTNLLTLTRMRIQLALRNKMFFFFSLVMPLGFFFLYSGVFAKGIP* |
| Ga0066388_1035380131 | 3300005332 | Tropical Forest Soil | LTNLIILTRMRVRLALRNKMFFFFSIVMPLGFFFLYSSIFAKGEP |
| Ga0066687_106263512 | 3300005454 | Soil | LSNFASLTRMRIHLALRNKMFFFFSVIFPLGMFFVYSGIFAKSHPREV |
| Ga0070707_1006725531 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LTNLLTLTRMRVRLALRNKMFFFFSIVMPLGFFFLYAGVFARGEPTV |
| Ga0070733_108881091 | 3300005541 | Surface Soil | LSNFATLTRTRILLAMRNKMFFFFSVIFPLGMFFLYCGIFARSNPH |
| Ga0070732_108701872 | 3300005542 | Surface Soil | LSNFVSLTRTRIQLGLRNKMWFFFSVIFPLGMFFLYCGIFARS |
| Ga0070665_1004591233 | 3300005548 | Switchgrass Rhizosphere | LTNLLALTRMRVRLALRNKMFFFFSIVMPLGFFFLYSAVFAKSVPQK |
| Ga0066700_107432361 | 3300005559 | Soil | LSNFASLTRTRILLALRNKMFFFFSVVFPLGMFFLYAG |
| Ga0066699_101092091 | 3300005561 | Soil | LTNFATLTRMRIQLTLRNKMFLFFSVIMPFGFFFL |
| Ga0070763_104466611 | 3300005610 | Soil | LTNLVTLTRVRMMLALRNKMFFFFSVIMPLGFFFLYAGVFAKG |
| Ga0066903_1015536451 | 3300005764 | Tropical Forest Soil | LRNLLTLTRMRVRLALRNKMFFFFSIVMPLGFFFLYSAVFAKSVPRDVQY |
| Ga0070716_1005867021 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LTNLLTLTRMRVRLALRNKMFFFFSIVMPLGFFFLYAGVF |
| Ga0079222_108944271 | 3300006755 | Agricultural Soil | LSNFASLTRTRILLAMRNKMFFFFSVVFPLGMFFLYAGIFAKG |
| Ga0079222_117357212 | 3300006755 | Agricultural Soil | LSNFVSLTRTRILLALRNKMFFFFSVVFPLGMFFLYAGIFA |
| Ga0066665_115420521 | 3300006796 | Soil | LSNFASLTRTRILLALRNKMFFFFSVVFPLGMFFLYAGI |
| Ga0066659_109965492 | 3300006797 | Soil | LTNLLTLTRMRVQLALRNKMFFFFSIIMPLGFFFLYSSVFAKGI |
| Ga0075425_1016971422 | 3300006854 | Populus Rhizosphere | LTNLLTLTRMRVRLALRNKMFFFFSIIMPIGFFFLYS |
| Ga0073928_106582232 | 3300006893 | Iron-Sulfur Acid Spring | LKNFAALTRMRIQLTIRNRMFLFFSVIMPFAFFFL |
| Ga0099792_109047611 | 3300009143 | Vadose Zone Soil | LSNFASLTRMRIQLALRNKMFFFFSVVFPLGMFFLYAGIF |
| Ga0116115_10448452 | 3300009631 | Peatland | MKYFRQLTRMRILLTLRNRTFLFFVIIMPLGFFFLYSGVF |
| Ga0134109_100512803 | 3300010320 | Grasslands Soil | LSNFASLTRTRILLALRNKMFFFFSVVFPLGMFFLY |
| Ga0126372_102697563 | 3300010360 | Tropical Forest Soil | LTNLATLTRMRVRLALRNKMFFFFSIVMPLGFFFL |
| Ga0126372_119273842 | 3300010360 | Tropical Forest Soil | LTNLATLTRTRMVLALRNKMFFFFSVIMPLMFFFLYAGVFAKGDPH |
| Ga0126377_133472451 | 3300010362 | Tropical Forest Soil | LTNLITLTRMRVRLALRNKMFFFFSIVMPLGFFFLYSSI |
| Ga0126383_100822851 | 3300010398 | Tropical Forest Soil | LTNLFTLTAMRVRLALRNKMFFFFSIVMPMVFFFLY |
| Ga0126383_122720361 | 3300010398 | Tropical Forest Soil | LSNFASLTRTRIQLAMRNKMFFFFSVVFPLAMFFLYAGIF |
| Ga0137388_103611091 | 3300012189 | Vadose Zone Soil | LRNFASLTRMRIKLALRNKMFFFFSVIFPLGMFFV |
| Ga0137358_102531872 | 3300012582 | Vadose Zone Soil | LSNLVSLTRMRIQLALRNKMFFFFSVIFPLGMFFLYAGIFAKG |
| Ga0126369_116664771 | 3300012971 | Tropical Forest Soil | LTNLVILTRMRMRLAMRNKMFFFFSVVMPFVIFFLYM |
| Ga0134077_102045291 | 3300012972 | Grasslands Soil | LSNFASLTRTRILLALRNKMFFFFSVIFPLGMFFLYAGIFARSNPRAVS |
| Ga0134078_100373651 | 3300014157 | Grasslands Soil | LSNFASLTRTRILLALRNKMFFFFSVIFPLGMFFLYAGIFARSNPRAV |
| Ga0137418_102665232 | 3300015241 | Vadose Zone Soil | LSNFASLTRTRILLALRNKMFFFFSVVFPLGMFFLYAGIFARXXXRC* |
| Ga0182034_116154792 | 3300016371 | Soil | LTNLLTLTRTRMILALRNKMFFFFSVVMPLLFFFLYAGIFAKGDPNRV |
| Ga0182034_116564892 | 3300016371 | Soil | LTNLLTLTRMRMVLALRNKMFFFFSVVMPLLFFFLYAGIFAKGDPN |
| Ga0182039_119635351 | 3300016422 | Soil | LTNLVTLTRTRMVLALRNKMFFFFSVVMPLLFFFLYAGIFAK |
| Ga0134069_12177512 | 3300017654 | Grasslands Soil | LSNFASLTRTRILLALRNKMFFFFSVIFPLGMFFLYAGIFARS |
| Ga0187825_100039451 | 3300017930 | Freshwater Sediment | LTNLLSLTRMRVRLALRNKMFFFFSIVMPLGFFFLYSAIFAKGIPTEVQF |
| Ga0187803_102110251 | 3300017934 | Freshwater Sediment | LTNLITLTRTRMVLAIRNKMFFFFSVVMPLVFFFLYAGIFAKGDPNRV |
| Ga0187779_100579471 | 3300017959 | Tropical Peatland | LTNLLTLTRTRMVLALRNKMFFFFSVVMPLLFFFLYA |
| Ga0187781_104770571 | 3300017972 | Tropical Peatland | LTNLVTLTRTRMVLALRNKMFFFFSVVMPLAFFFLYAGVFAKGEPH |
| Ga0187810_103531973 | 3300018012 | Freshwater Sediment | LRNFATLTRMRIQLTLRNKMFLFFSVIMPFGFFFLYA |
| Ga0066667_122728931 | 3300018433 | Grasslands Soil | LSNFASLTRTRILLALRNKMFFFFSVVFPLGMFFL |
| Ga0066669_104116731 | 3300018482 | Grasslands Soil | LNHLFLLTGMRVRLALRNKMFFFFSIVMPLVFFFLYAAVF |
| Ga0193751_11016672 | 3300019888 | Soil | LTNLLTLTRMRVRLALRNKMFFFFSIVMPLGFFFLYAGVFA |
| Ga0193749_10159183 | 3300020010 | Soil | LTNLLTLTRMRVRLALRHKMFFFFSIVMPLGFFFLYAG |
| Ga0179590_10789512 | 3300020140 | Vadose Zone Soil | LTNFVTLTRMRIQLTLRNKMFLFFSVIMPFGFFFLYAGVFARGIPLV |
| Ga0179594_101123121 | 3300020170 | Vadose Zone Soil | LTNFATLTRMRIQLTLRNKMFLFFSVIMPFGFFFLY |
| Ga0179594_101462251 | 3300020170 | Vadose Zone Soil | LTNFLTLTRMRIQLTLRNKMFLFFSVIMPFGFFFLYAGVFARG |
| Ga0210407_105187982 | 3300020579 | Soil | LTNLVTLTRVRMMLALRNKMFFFFSVIMPLGFFFLYA |
| Ga0210407_114759842 | 3300020579 | Soil | LTNLLTLTRMRVQLALRNKMFFFFSLIMPLGFFFLYSSVFA |
| Ga0210403_101596861 | 3300020580 | Soil | LSNFVSLTRTRILLAMRNKMFFFFSVVFPLGMFFLYGGIFARG |
| Ga0210401_106687532 | 3300020583 | Soil | LTNFATLTRMRIQLTLRNKMFLFFSVIMPFGFFFLYAGVFAK |
| Ga0210401_108568931 | 3300020583 | Soil | LRNFATLTRMRIQLTLRNKMFLFFSVIMPFGFFFLYAGIFAK |
| Ga0210405_101079541 | 3300021171 | Soil | LTNLITLTGVRMRLALRNKMFFFFSVVMPLMFFFLYAGIFAKGDPNRVRFFLG |
| Ga0210405_103419942 | 3300021171 | Soil | LSNFASLTRTRIQLALRNKMFFFFSVVFPLGMFFLYAGIFARGNPLAVSY |
| Ga0210396_106119631 | 3300021180 | Soil | LKNFVALTRMRIQLTLRNKMFLFFSVIMPFGFFFL |
| Ga0210393_103475652 | 3300021401 | Soil | LTNLVTLTHMRVKLALRNKMFFFFSIVMPLGFFFLYAGVFAKGIPQ |
| Ga0210393_113105201 | 3300021401 | Soil | LTNFLTLTRMRVQLTLRNKMFLFFSVIMPFGFFFLYAGVF |
| Ga0210385_100834864 | 3300021402 | Soil | LTNFATLTRMRIQLTLRNKMFLFFSVIMPFGFFFLYAGV |
| Ga0210389_113083131 | 3300021404 | Soil | LKHFLTLTAMRIRLTLRNKMFLFFSVIMPFGFFFLYAGVFAKG |
| Ga0210386_102888641 | 3300021406 | Soil | LTNLATLTRVRMQLALRNKMFFFFSVVMPLGFFFLYAGVFAKSDP |
| Ga0210394_103198353 | 3300021420 | Soil | LTNLVTLTRVRMMLALRNKMFFFFSVIMPLGFFFLYAGV |
| Ga0210384_103371531 | 3300021432 | Soil | LKHFLPLTSMRIRLTLRNKMFLFFSVIMPFGFFFL |
| Ga0210390_111619861 | 3300021474 | Soil | LKHFLTLTAMRIRLTLRNKMFLFFSVIMPFGFFFLYAGVFAKGDP |
| Ga0210392_100147236 | 3300021475 | Soil | LTNLLTLTRMRVQLALRNKMFFFFSLIMPLGFFFLYSSVFAKGKPYGVAY |
| Ga0210392_110851022 | 3300021475 | Soil | LKHFLTLTAMRIRLTLRNRMFLFFSVIMPFGFFFLYAGVFAKG |
| Ga0210402_101427231 | 3300021478 | Soil | LTNFATLTRMRIRLTLRNKMFLFFSVIMPFGFFFLYAGVFAKGEPH |
| Ga0210402_108626502 | 3300021478 | Soil | LSNFASLTRTRIQLALRNKMFFFFSVVFPLGMFFLY |
| Ga0210409_103173591 | 3300021559 | Soil | LRNFASLTRTRIQLALRNKMFFFFSVIFPLGMFFLYAGIFARGNPRVVS |
| Ga0210409_104764781 | 3300021559 | Soil | LKNFAALTRMRIQLTLRNKMFLFFSVIMPYGFFFLYA |
| Ga0126371_111527452 | 3300021560 | Tropical Forest Soil | LSHLATLTRTRVRLALRNKMFFFFSVVMPLGFFLLYCGIFAKG |
| Ga0137417_13250054 | 3300024330 | Vadose Zone Soil | LTNFATLTRMRIQLTLRNRMFLFFSVVMPFGFFFLYAGVFARGIPR |
| Ga0137417_13889913 | 3300024330 | Vadose Zone Soil | MRIQLALRNKMFFFFSVIFPLGMFFVFSTIFAKSYPRALASSLGR |
| Ga0207692_107237592 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LTNLLTLTRMRVQLALRNKMFFFFSMVMPLGFFFLYSSVFA |
| Ga0207693_113706012 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LTNLATLTRVRMQLALRNKMFFFFSVVMPLGFFFLYAGVFAKS |
| Ga0207706_115171002 | 3300025933 | Corn Rhizosphere | LKHFLTLTRMRIRLTLRNKMFLFFSVIMPFGFFFLFAGII |
| Ga0207665_101043954 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LTNLLTLTRMRVQLALRNKMFFFFSMVMPLGFFFLYS |
| Ga0257173_10727852 | 3300026360 | Soil | LNNFTNLTRMRIQLALRNKMFFFFSVIFPLGMFFIYA |
| Ga0257158_11164262 | 3300026515 | Soil | LTNLLTLTRMRVRLALRNKMFFFFSIVMPLGFFFL |
| Ga0179587_104163841 | 3300026557 | Vadose Zone Soil | LTNFLALTRMRISLALRNKMFIFFSVVMPLGFFFLYC |
| Ga0207855_10582781 | 3300027039 | Tropical Forest Soil | LTNLVTLTRTRMVLALRNKMFFFFSVVMPLLFFFLYAGIFAKGDPNRVL |
| Ga0209527_11289301 | 3300027583 | Forest Soil | LTNFATLTRMRIQLTLRNKMFLFFSVIMPFGFFFLYAG |
| Ga0209220_11233942 | 3300027587 | Forest Soil | LSNFAALTRMRIQLTIRNKMFLFFSVIMPFGFFFLYAGVFAK |
| Ga0209329_10089033 | 3300027605 | Forest Soil | LTNFATLTRMRIQLTLRNKMFLFFSVIMPFGFFFLYA |
| Ga0208988_10621472 | 3300027633 | Forest Soil | LSNFAALTRMRIQLTIRNKMFLFFSVIMPFGFFFLYAGVFAKG |
| Ga0209076_11817642 | 3300027643 | Vadose Zone Soil | LRNFASLTRMRIQLALRNRMFFFFSVVFPLGMFFLYAGIFAKGNPRTV |
| Ga0209689_10783164 | 3300027748 | Soil | LSNFASLTRTRILLALRNKMFFFFSVIFPLGMFFLYA |
| Ga0209448_102788492 | 3300027783 | Bog Forest Soil | LNNFVTLTRMRIQLTLRNKMFLFFSVIMPFGFFFLYAGVFAKGIPR |
| Ga0209773_100560061 | 3300027829 | Bog Forest Soil | LRNFATLTRMRIQLTLRNKMFLFFSVIMPFGFFFL |
| Ga0209773_102684292 | 3300027829 | Bog Forest Soil | LTNFLTLTRMRLQLTLRNKMFIFFSVIMPFGFFFLYSGVFA |
| Ga0209180_106173641 | 3300027846 | Vadose Zone Soil | LSNFTNLTRMRIQLALRNKMFFFFSVIFPLGMFFVYSGIFAKGDP |
| Ga0209701_103306072 | 3300027862 | Vadose Zone Soil | LSNFASLTRMRIQLALRNKMFFFFSVIFPLGMFFLYAGIFAK |
| Ga0209380_108191751 | 3300027889 | Soil | LRNFATLTRMRIQLTLRNKMFLFFSVIMPFGFFFLYAGVFAKG |
| Ga0209488_109210362 | 3300027903 | Vadose Zone Soil | LSNFTNLTRMRIQLALRNKMFFFFSVIFPLGMFFIYA |
| Ga0268266_106813002 | 3300028379 | Switchgrass Rhizosphere | LTNLLALTRMRVRLALRNKMFFFFSIVMPLGFFFLYSAVFAKSVPQKVQ |
| Ga0137415_105861482 | 3300028536 | Vadose Zone Soil | LSNFASLTRTRIQLSLRNKMFFFFSVVFPLGMFFLY |
| Ga0137415_113927282 | 3300028536 | Vadose Zone Soil | LRNFASLTRMRIQLALRNKMFFFFSVVFPIGMFFLYAGIFAKGNPRV |
| Ga0302233_100392891 | 3300028746 | Palsa | LTNFLTLTRMRIELTLRNKMFLFFSVIMPFGFFFL |
| Ga0302227_102813832 | 3300028795 | Palsa | LSNFSALTRMRIQLATRNKMFFFFSVIFPIGMFFIYAG |
| Ga0302221_100627973 | 3300028806 | Palsa | LSNFSALTRMRIQLATRNKMFFFFSVIFPIGMFFIYAGIFAK |
| Ga0308309_118027452 | 3300028906 | Soil | LKHFLTLTAMRIRLTLRNKMFLFFSVIMPFGFFFLYAG |
| Ga0311353_111576502 | 3300030399 | Palsa | LTNFVSLTRMRIQLALRNRMFIFFSVIMPMGFFFLYSGVFAQS |
| Ga0170822_163862362 | 3300031122 | Forest Soil | LTNLLTLTRMRVRLALRNKMFFFFSIVMPLGFFFHYAGVFAKGVPLVV |
| Ga0265320_104816411 | 3300031240 | Rhizosphere | LTNFVTLTRMRIQLTLRNKMFLFFSVIMPFGFFFLYAGVFAKG |
| Ga0318538_101609151 | 3300031546 | Soil | LTNLLTLTRMRVRLALRNKMFFFFSVVMPLGFFFLYAAVFAK |
| Ga0310915_100118766 | 3300031573 | Soil | LTNLLTLTRTRMVLALRNKMFFFFSVVMPLLFFFLYAGIFA |
| Ga0307476_105905212 | 3300031715 | Hardwood Forest Soil | LKHFPTLTAMRIRLTLRNKMFLFFSVIMPFGFFFLYAGV |
| Ga0307474_116306001 | 3300031718 | Hardwood Forest Soil | LKNFAALTRMRIQLTLRNKMFIFFSVIMPFGFFFLYAGVFAK |
| Ga0307469_102570081 | 3300031720 | Hardwood Forest Soil | LRNFASLTRMRIQLAVRNKMFFFFSVVFPLGMFFLYAGIFAKGNPR |
| Ga0307469_105168261 | 3300031720 | Hardwood Forest Soil | LTNLLTLTRMRVRLALRNKMFFFFSIVMPLGFFFLYA |
| Ga0307469_113675341 | 3300031720 | Hardwood Forest Soil | LTNLFTLTRMRMQLALRNKMFFFFSLVMPIGFFFLYSGVFAKSD |
| Ga0307468_1015106971 | 3300031740 | Hardwood Forest Soil | LRNFAALTRMRILLALRNRMFFFFSAVFPLGMFFLYAGVFAKGNP |
| Ga0307475_103433661 | 3300031754 | Hardwood Forest Soil | LSNFAALTRMRIQLTIRNKMFLFFSVIMPFSFFFLYAGVF |
| Ga0307475_106322431 | 3300031754 | Hardwood Forest Soil | LTNLLTLTRMRVRLALRNKMFFFFSIVMPLGFFFLYAGV |
| Ga0318503_101023931 | 3300031794 | Soil | LTNLLTLTRMRMVLALRNKMFFFFSVVMPLLFFFLYAGIFAKGDP |
| Ga0307473_103268991 | 3300031820 | Hardwood Forest Soil | LTNFLTLTRMRIQLTLRNKMFLFFSVIMPFGFFFL |
| Ga0318511_103245202 | 3300031845 | Soil | LTNLLTLTRTRMVLALRNKMFFFFSVVMPLLFFFLY |
| Ga0306919_106163712 | 3300031879 | Soil | LTNLLTLTRTRMVLALRNKMFFFFSVVMPLLFFFLYAGIFAKGDPTR |
| Ga0306923_105802753 | 3300031910 | Soil | LTNLLTLTRTRMVLALRNKMFFFFSVVMPLLFFFLYAGIFAKGD |
| Ga0310912_114740572 | 3300031941 | Soil | LTNLVTLTRTRMVLALRNKMFFFFSVVMPLLFFFLYAGIFAKGDPNRVLVFL |
| Ga0310910_103462541 | 3300031946 | Soil | LTNLATLTRTRMVLALRNKMFFFFSVIMPLMFFFLYAGVFAKG |
| Ga0306926_111987502 | 3300031954 | Soil | LRNFLTLTRMRISLAFRNKMFFVFIIFMPIVLFFLYAGVFA |
| Ga0318562_104698832 | 3300032008 | Soil | LTNLLTLTRTRMVLALRNKMFFFFSVVMPLLFFFLYAGIFAKGDPNR |
| Ga0318558_105300792 | 3300032044 | Soil | LSHLATLTRTRVRLALRNKMFFFFSVVMPLGFYFLY |
| Ga0318504_101902042 | 3300032063 | Soil | LSHLATLTKTRVRLALRNKMFFFFSVVMPLGFFLL |
| Ga0311301_100487621 | 3300032160 | Peatlands Soil | LTNFATLTRMRIQLTLRNKMFLFFSVIMPFGFFFLYAGAFAQG |
| Ga0307470_106756562 | 3300032174 | Hardwood Forest Soil | LRNFLTLTRMRISLAFRNKMFFVFIIFMPLVFFFLYAGVF |
| Ga0307471_1007846552 | 3300032180 | Hardwood Forest Soil | LTNLLALTRMRVRLALRNKMFFFFSIVMPLGFFFLYSAV |
| Ga0307472_1015653662 | 3300032205 | Hardwood Forest Soil | LRNFASLTRMRIQLALRNRMFFFFSVVFPLGMFFLYAGIFA |
| Ga0307472_1022052792 | 3300032205 | Hardwood Forest Soil | LTNLLTLTRMRVRLALRNKMFFFFSIIMPIGFFFLYSGVFAKGEPIVV |
| Ga0335085_117641421 | 3300032770 | Soil | LTNLVTLTRMRVRLALRNKLFFFFSLVMPMVFFFLYSAVF |
| Ga0326727_104895201 | 3300033405 | Peat Soil | LTNLVTLTRVRMQLALRNKMFFFFSVIMPLGFFFLYA |
| ⦗Top⦘ |