| Basic Information | |
|---|---|
| Family ID | F054269 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 140 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MAENQPRKAGEYERPMTGTSSSMALIIGIIAVLAVIIVAVLFLR |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 140 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 89.21 % |
| % of genes near scaffold ends (potentially truncated) | 12.86 % |
| % of genes from short scaffolds (< 2000 bps) | 87.86 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (71.429 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (18.571 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.714 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.429 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.50% β-sheet: 0.00% Coil/Unstructured: 62.50% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 140 Family Scaffolds |
|---|---|---|
| PF09557 | DUF2382 | 49.29 |
| PF05957 | DUF883 | 1.43 |
| PF00106 | adh_short | 0.71 |
| PF07043 | DUF1328 | 0.71 |
| PF01609 | DDE_Tnp_1 | 0.71 |
| PF13359 | DDE_Tnp_4 | 0.71 |
| PF03631 | Virul_fac_BrkB | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 140 Family Scaffolds |
|---|---|---|---|
| COG4575 | Membrane-anchored ribosome-binding protein ElaB, inhibits growth in stationary phase, YqjD/DUF883 family | Translation, ribosomal structure and biogenesis [J] | 1.43 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.71 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.71 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.71 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.71 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.71 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.71 |
| COG5487 | Uncharacterized membrane protein YtjA, UPF0391 family | Function unknown [S] | 0.71 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 71.43 % |
| All Organisms | root | All Organisms | 28.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 18.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.57% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.57% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 6.43% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.00% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 3.57% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.86% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.14% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.14% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.14% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 2.14% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.43% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.43% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.43% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.43% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.43% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.71% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.71% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.71% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.71% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.71% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886013 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000596 | Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA no BrdU F1.4TC | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300004016 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz | Host-Associated | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006935 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A10 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010109 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010112 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010137 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010141 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030571 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb5 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030829 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030830 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031039 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 6C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SwBSRL2_0280.00007350 | 2162886013 | Switchgrass Rhizosphere | MAEQQPRKAGEYERPARRASRSTALIIGIIAVLVVIIVAVFFLP |
| INPgaii200_08585113 | 2228664022 | Soil | MAENQPRKAGEYERPMTGTSSSMALIIGIIAVLAVIIVAVLFLR |
| ICChiseqgaiiDRAFT_21227711 | 3300000033 | Soil | MAQNQPKKAGAYDRPLTGTARSMALTLGIIAVLAVSIVALLFLR* |
| INPhiseqgaiiFebDRAFT_1006139772 | 3300000364 | Soil | MAQNQPXKAGEYERPMTGTTSSMAIILGGIALLAVIIIALLFLR* |
| KanNP_Total_noBrdU_T14TCDRAFT_10091851 | 3300000596 | Soil | MAENQPRKAGEYERPMPGTANSMALIIGIIAVLAVIIVAVLFLR* |
| JGI11643J11755_111334541 | 3300000787 | Soil | MAHNQPKKAGAYDRPLTGTARSMALTLGIIAVLAVSIVALLFLR* |
| JGI11643J11755_117828841 | 3300000787 | Soil | MAENQPRKAGEYERPMTGTTSSMAFIIGGIALLAVIIIALLFLR* |
| JGI1027J12803_1032722421 | 3300000955 | Soil | MAQNQPRKAGEYERPMTGTSSSMALIIGIIALLAVIVVAVLFLR* |
| JGI1027J12803_1048731382 | 3300000955 | Soil | MAEHQPRKAGEYERPLTGTSSSLALIIGGISLLIVIIAALLFLR* |
| soilL2_100056553 | 3300003319 | Sugarcane Root And Bulk Soil | MAQNQPKKAGEYERPMTGASSSMAITIGIIAVLAVIVIAVLFLR* |
| soilL2_102624642 | 3300003319 | Sugarcane Root And Bulk Soil | MAENQPRKAGEYERPMTGTSSSLALIIGIIALLAVIIIAVLFLR* |
| JGI25405J52794_100979862 | 3300003911 | Tabebuia Heterophylla Rhizosphere | MAENQPRKAGEYERPMTGTTSSMAIILGGIALLAVIIIALLFLR* |
| Ga0058689_101205601 | 3300004016 | Agave | ENQPRKAGEYERPMTGTSSSMALIIGIIAVLAVIIVAVLFLR* |
| Ga0063356_1002636833 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MAQNAPKKAGEYERPMTGTSSSMAVMIGIIAVLAVIVIAALFLL* |
| Ga0063356_1008268253 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTQNQPQKAGEYERPMAGSSRSLALTIGIIAVVAFIVVAVLFLR* |
| Ga0063356_1011258562 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MAENQPRKAGEYERPMTGTTSSIAFILGGIALLAVIIIAFLFLR* |
| Ga0062595_1020807051 | 3300004479 | Soil | MAENQPRKDGEYERPGIGASSSTALTIGIIAVLAVIVIAVLFLR* |
| Ga0066395_103743942 | 3300004633 | Tropical Forest Soil | MAENQPRKAGEYERPMTGPTSSMAIIIGGIALLAVIIIALLFLR* |
| Ga0058859_100398681 | 3300004798 | Host-Associated | MAENQPRKAGEYERPGIGASSSTALTIGIIAVLAVIVIAVLFLR* |
| Ga0066679_101421293 | 3300005176 | Soil | MAEHQPQKAGEYERPMTGTSSSMALIMGIIALLAVIVIAVLFLR* |
| Ga0066690_102605813 | 3300005177 | Soil | MAEHQPQKAGEYERPMTGTSSSLAITIGIIAVLAVIIVAVLFLR* |
| Ga0065705_100485922 | 3300005294 | Switchgrass Rhizosphere | MAHNQPKKAGEYDRPLTGTARSMALTLGIIAVLAVSIVALLFLR* |
| Ga0065705_101838792 | 3300005294 | Switchgrass Rhizosphere | MAENQPRKAGEYERPMTGTTSSMALIIGGIALLAVIIIVLLFLR* |
| Ga0065705_102036262 | 3300005294 | Switchgrass Rhizosphere | MAEQQPRKAGEYERPARRASRSTALIIGIIAVLVVIIVAVFFLP* |
| Ga0066388_1004809625 | 3300005332 | Tropical Forest Soil | MAENQPRKAGEYERPMTGITSSMAMIIGGIALLAVIIIALLFLR* |
| Ga0066388_1017175652 | 3300005332 | Tropical Forest Soil | MAEHQPQKAGEYERPMTGTSSSMALIIGIIAVLAVIIAAVLFLR* |
| Ga0066388_1026083921 | 3300005332 | Tropical Forest Soil | MAENQPRKAGEYERPMTGTTSSMAIIIGGIALLAVIIIALLFLR* |
| Ga0066388_1028501501 | 3300005332 | Tropical Forest Soil | MAEHQPQKAGEYERPMTGTSSSMALIIGIIAVLAVIIAAVFFLR* |
| Ga0066661_103604452 | 3300005554 | Soil | MAENQPRKAGEYERPMTGTSSSMALIIGIMAVLAVIIVAVLFLR* |
| Ga0058697_100657003 | 3300005562 | Agave | MAENQPRKAGEYERPITGTSSSMALTIGLIAVLAVIVVAVLFLR* |
| Ga0058697_102092642 | 3300005562 | Agave | MADNQPRKAGEYERPMTGSSSSMALIIGVIALLVVIIVAVLFLR* |
| Ga0068859_1004908762 | 3300005617 | Switchgrass Rhizosphere | MAENQPRKAGEYERPGIGASSSTALTIRIIAVLAVIVIAVLFLR* |
| Ga0066905_1013073392 | 3300005713 | Tropical Forest Soil | MAENQPRKAGEYERPMTGTGSSMAMIIGGIALLAVIIIALLFLR* |
| Ga0066903_1029448282 | 3300005764 | Tropical Forest Soil | MAQNQPRKAGEYERPMTGTSSSMALIIGIIAVLAVIVIAVFFLR* |
| Ga0081455_100135019 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MAEHQPRKAGEYERPMTGASSSLALIIGGIALLIVIIAALLFLR* |
| Ga0081538_100592153 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MAENQPRKAGEYERPMTGTTSSMALILGGIALLAVIIIALLFLR* |
| Ga0081540_11094281 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MAENQPRKAGEYERPMTGTTSSMAMIIGGIALLAVIIIALLFLR* |
| Ga0081539_100214585 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MAENQPRKAGEYERPMTGTSSSMALIIGIIALLAVIVVAVLFLR* |
| Ga0081539_104816071 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MADNRPQKAGEYERPMTGSSSSLAIVIGIIAVLAVIIVAVLFLR* |
| Ga0075417_100066572 | 3300006049 | Populus Rhizosphere | MAENQPRKAGEYERPMTGTSSSMALIIGIIAVLAVIIVAVLFLR* |
| Ga0075417_100432383 | 3300006049 | Populus Rhizosphere | MAQNQPKKAGEYDRPMTGTARSMALTLGIIAVLAVSIVALLFLR* |
| Ga0075417_104739531 | 3300006049 | Populus Rhizosphere | MAQNQPRKAGEYERPMTGTSSSMALIIGIIAVLAVIVVAVLFLR* |
| Ga0075417_105552112 | 3300006049 | Populus Rhizosphere | MTGNQPKKAGEYERPTTGSSHSAALITGIIVVVAVIIAAVLYLR* |
| Ga0075432_103213192 | 3300006058 | Populus Rhizosphere | MAEHQPRKAGEYERPLTGTSSSLALIIGGIALLIVIIAALLFLR* |
| Ga0070716_1011584781 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VRMAENQPRKAGEYERPMTGTSSSMALIIGIIAVLAVIIVAVLFLR* |
| Ga0075427_100871121 | 3300006194 | Populus Rhizosphere | QPKKAGEYERPTTGSSHSAALITGIIVVVAVIIAAVLYLR* |
| Ga0066665_108241042 | 3300006796 | Soil | MAQNQPRKAGEYERPMTGTSSSLAITIGIIAVLAVIIVAVLFLR* |
| Ga0075428_1000965283 | 3300006844 | Populus Rhizosphere | MAENQPRKAGEYERPITGTGSSMAMIIGGIALLAVIIIALLFLR* |
| Ga0075428_1014873522 | 3300006844 | Populus Rhizosphere | MAESQPRKAGEYERPLKGTSRSLALIIGIIVVLAVIIAAVLYLR* |
| Ga0075421_1010653611 | 3300006845 | Populus Rhizosphere | MAQNQPRKAGEYERPMTGTSSSMALIIGIIAVLAVIVVAV |
| Ga0075421_1025776841 | 3300006845 | Populus Rhizosphere | MAENQPRKTGEYERPMTGTTSSMAFIIGGIALLAVIIIAFLFLR* |
| Ga0075429_1008163791 | 3300006880 | Populus Rhizosphere | MAEHQPRKAGEYERPTAGTSRSLALIIGIIVVLAVIIAAVLYLR* |
| Ga0075424_1018623531 | 3300006904 | Populus Rhizosphere | MADNQPRKAGEYERPRTGTASSMALLIGLIALLAVIIVAVLFLR* |
| Ga0081246_13382763 | 3300006935 | Tropical Rainforest Soil | MAQNQPRKAGEYERPATGTSSSMALIIGIIAVLAVIIIAVLFLR* |
| Ga0066710_1023366142 | 3300009012 | Grasslands Soil | MAEHQPQKAGEYERPMTGTSSSLAITIGIIAVLAVIIVAVLFLR |
| Ga0099829_108265791 | 3300009038 | Vadose Zone Soil | MAEHQPRKAGEYERPMTGTSSSMALTIGIIAVLAVIIVAVLFLR* |
| Ga0099830_115095292 | 3300009088 | Vadose Zone Soil | MAEHQPRKAGEYERPMTGTSSSMALTIGIIAVLAVIVVAVLFLR* |
| Ga0111539_102532273 | 3300009094 | Populus Rhizosphere | MAENQPRKAGEYERPMTGTGSSMAIIIGGIALLAVIIIALLFLR* |
| Ga0075418_101048291 | 3300009100 | Populus Rhizosphere | KAGEYERPITGTGSSMAMIIGGIALLAVIIIALLFLR* |
| Ga0075418_122921091 | 3300009100 | Populus Rhizosphere | MAESQPRKAGEYERPLKGASRSLALIIGIIVVLAVIIAAVLYLR* |
| Ga0075418_126038022 | 3300009100 | Populus Rhizosphere | MAENQPTKAGEYERPITGTGSSMAMIIGGIALLAVIIIALLFLR* |
| Ga0105247_101043173 | 3300009101 | Switchgrass Rhizosphere | MAENPPKKAGEYDRPAVSSSMALTIGIIAVLAVIVIAVLFLR* |
| Ga0114129_117488102 | 3300009147 | Populus Rhizosphere | MAQNQPRKAGEYERPMTGTSSSMALIIGIIAVLAVIVVAVFFLR* |
| Ga0114129_125828532 | 3300009147 | Populus Rhizosphere | AQNQPRKAGEYERPMTGTSSSMALIIGIIALLAVIVVAVLFLR* |
| Ga0126374_106447092 | 3300009792 | Tropical Forest Soil | MVQNQPRKAGEYERPMTGTSSSMALIIGIIALLAVIVVAVLFLR* |
| Ga0126313_112846031 | 3300009840 | Serpentine Soil | MAENQPRKAGEYERPGIGASGSTALTIGIIAVLAIIV |
| Ga0126315_101735932 | 3300010038 | Serpentine Soil | MAENQPRKAGEYERPRTGTSRSLALIIGIIAVLAVIVVAVLFLR* |
| Ga0126314_108415741 | 3300010042 | Serpentine Soil | MAENQPRKAGEYERPGIGASGSTALTIGIIAVLAIIVIAVLFLR* |
| Ga0126380_111243192 | 3300010043 | Tropical Forest Soil | MAEHQPQKAGEYERPMTGTSSSTALIIGIIAVLAVIVVAVLFLR* |
| Ga0126310_110385701 | 3300010044 | Serpentine Soil | MAEQQPRKAGEYERPTTRASRSTAFIIGIIAVLVVIILAVLFLR* |
| Ga0126384_116639111 | 3300010046 | Tropical Forest Soil | MAENQPRKAGEYERPMTGPTSSMVIIIGGIALLAVIIIALLFLR* |
| Ga0127497_10618301 | 3300010109 | Grasslands Soil | MAENQPRKAGEYERPMTGTSSSMALTIGIIAVLAVIVVAVLFLR* |
| Ga0127458_11211392 | 3300010112 | Grasslands Soil | RKAGEYERPMTGTSSSMALIIGIMAVLAVIIVAVLFLR* |
| Ga0126323_11834701 | 3300010137 | Soil | NAPKKAGEYERPMTGTSSSMAVLIGIIAVLAVIVIAVLFLR* |
| Ga0127499_10304631 | 3300010141 | Grasslands Soil | MAEHQPQKAGEYERPMTGTSSSLAITIGIIAVLAVIIVAVLFLRKEQ* |
| Ga0126321_10634521 | 3300010145 | Soil | MAENQPRKAGEYERPMTGTSSSMALTIGLIAVLAVIVVAVLFLR* |
| Ga0126321_12265621 | 3300010145 | Soil | MAEQQPRKAGEYERPTARASRSTALIIGLMAVLVVIILAVVFLR* |
| Ga0126321_13111592 | 3300010145 | Soil | LTKELRMAENQPRKAGEYERPMTGTSSSMALIIGIIAVLAVIIVAVLFLR* |
| Ga0126321_14129082 | 3300010145 | Soil | MAENQPRKAGEYERPMTGTSSSMAFIIGIIAVLAVIIVAVLFLR* |
| Ga0126321_14184933 | 3300010145 | Soil | MAENQPRKAGEYERPGIGASGSTALIIGIIAVLAVIVIAVLFLR* |
| Ga0126321_14425582 | 3300010145 | Soil | MEGNQPRKAGEYERPMTGTTSSMAIILGGIALLAVIIIALLFLR* |
| Ga0126321_14582311 | 3300010145 | Soil | MAEQQPRKAGEYERPATRASRSTALIIGLIAVLVVIILAVLFLR* |
| Ga0126321_14645841 | 3300010145 | Soil | MAENQPRKAGEYERPMTGTSSSMALIIGIIAVLAVIVVAVLFLR* |
| Ga0126370_104981542 | 3300010358 | Tropical Forest Soil | MAEKQPRKAGEYERPMTGPTSSMAIIIGGIALLAVIIIALLFLR* |
| Ga0126372_105005311 | 3300010360 | Tropical Forest Soil | MAEHQPQKAGEYERPMTGTSSSMALIIGIIAVLAVILAAIFFLR* |
| Ga0126372_106606143 | 3300010360 | Tropical Forest Soil | MAENQPKKAGEYERPMTGTTSSMALIIGGIALIAIIIIVLFFLR* |
| Ga0126377_106069153 | 3300010362 | Tropical Forest Soil | MAENQPRKAGEYERPMTGTSSSMALIIGGIALLAVIIIALLFLR* |
| Ga0126377_123028932 | 3300010362 | Tropical Forest Soil | MAQNQPRKAGEYERPMTGTSNSMALIIGIIALLAVIVVAVLFLR* |
| Ga0126377_127065362 | 3300010362 | Tropical Forest Soil | ENQPRKAGEYERPMTSTTSSMAMIIGGIALLAVIIIALLFLR* |
| Ga0126383_112765692 | 3300010398 | Tropical Forest Soil | MAQNQPRKAGEYERPMTGTSSSMALIIGIIALLAVIVVAILFLH* |
| Ga0134127_115184071 | 3300010399 | Terrestrial Soil | PRKAGEYERPGIGASSSTALTIGIIAVLAVIVIAVLFLR* |
| Ga0137364_105411241 | 3300012198 | Vadose Zone Soil | MAENQPRKAGEYERPMPGTANSMALIIGIIAVLAVIIVAILFLR* |
| Ga0150985_1079977811 | 3300012212 | Avena Fatua Rhizosphere | MAENQPRKAGEYERPMTGTSSSMAMIIGGIALLTVIIVALLFLR* |
| Ga0150985_1148331532 | 3300012212 | Avena Fatua Rhizosphere | MAENQPRKAGEYERPGIGASSSTVLTIGIVAVLAVIVIAVLFLR* |
| Ga0137371_102541503 | 3300012356 | Vadose Zone Soil | MAENQPRKAGEYERPMTGTSSSMALIIGVIALLAVIIVAVLFLR* |
| Ga0137361_104348551 | 3300012362 | Vadose Zone Soil | MAEHQPRKAGEYERPMIGTSSSMALTIGIIAVLAVIVVAVLFLR* |
| Ga0137396_102008901 | 3300012918 | Vadose Zone Soil | MAENQPKKAGEYERPMTGTSSSVAITLGIIAVLAVIIVAVLFLR* |
| Ga0126375_101609891 | 3300012948 | Tropical Forest Soil | MAENQPRKAGEYERPMTGPTSSMVITIGGIALLAVIIIALLFLR* |
| Ga0126375_107700351 | 3300012948 | Tropical Forest Soil | MAENQPRKAGEYERPMTGPTSSMVIIIGGIALLAVIIIALLFFR* |
| Ga0132258_100386248 | 3300015371 | Arabidopsis Rhizosphere | MADQPRKAGEYERPMTGTSSSMALIIGIIAVLAVIIVAVLFLR* |
| Ga0132258_109570033 | 3300015371 | Arabidopsis Rhizosphere | MAENQPRKAGEYERPMTGTASSMAIILGGIALLAVIIVALLFLR* |
| Ga0132255_1008889262 | 3300015374 | Arabidopsis Rhizosphere | MAENQPRKAGEYERPGIGASGSTALTIGIVAVLAVIVIAVLFLR* |
| Ga0182037_117554501 | 3300016404 | Soil | NQPRKAGEYERPMTGTTSSMAIILGGIALLAVIIIALLFLR |
| Ga0182039_112350651 | 3300016422 | Soil | MAENQPRKAGEYERPMTGTSSSLALILGGIALLAVIIIALLFLR |
| Ga0184635_104196501 | 3300018072 | Groundwater Sediment | MTENSPKKAGEYDRPAALSSTALTIGIIAVLVVIVVAVLFLR |
| Ga0190268_113326012 | 3300018466 | Soil | MTGNQPKKAGEYERPTTGTSHSAALMLGIIAVLAVIGVAVLFLR |
| Ga0184646_10041801 | 3300019259 | Groundwater Sediment | MTQNQPKKVGEYDRPVAHTSSSSALTIGIIAVLAIIVLAIFFLR |
| Ga0206356_114979973 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | HMAENQPRKAGEYERPGIGASSSTALTIGIIAVLAVIVIAVLFLR |
| Ga0206352_102374265 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | MAENQPRKAGEYERPGIGASSSTALTIGIIAVLAVIVIAVLFLR |
| Ga0209350_11422622 | 3300026277 | Grasslands Soil | MAENQPRKAGEYERPMTGTSSSMALIIGIMAVLAVIIVAVLFLR |
| Ga0209471_11937992 | 3300026318 | Soil | MAEHQPQKAGEYERPMTGTSSSMALIMGIIALLAVIVIAVLFLR |
| Ga0209814_101217081 | 3300027873 | Populus Rhizosphere | MAQNQPRKAGEYERPMTGTSSSMALIIGIIAVLAVIVVAVLFLR |
| Ga0209814_103060131 | 3300027873 | Populus Rhizosphere | MTGNQPKKAGEYERPTTGSSHSAALITGIIVVVAVIIAAVLYLR |
| Ga0209481_100472442 | 3300027880 | Populus Rhizosphere | MAQNQPKKAGEYDRPMTGTARSMALTLGIIAVLAVSIVALLFLR |
| Ga0209481_102775021 | 3300027880 | Populus Rhizosphere | MAEHQPRKAGEYERPLTGTSSSLALIIGGIALLIVIIAALLFLR |
| Ga0209481_102971791 | 3300027880 | Populus Rhizosphere | MAEHQPSKAGEYERPSTGTSRSLGLMIGIIVLLAVIIAAILFFR |
| Ga0209481_103294361 | 3300027880 | Populus Rhizosphere | MAENQPRKAGEYERPITGTGSSMAMIIGGIALLAVIIIALLFLR |
| Ga0209590_102878892 | 3300027882 | Vadose Zone Soil | MAEHQPRKAGEYERPMIGTSSSMALTIGIIAVLAVIVVAVLFLR |
| Ga0207428_104348571 | 3300027907 | Populus Rhizosphere | MAESQPRKAGEYERPLKGTSRSLALIIGIIVVLAVIIAAVLYLR |
| Ga0209382_105641052 | 3300027909 | Populus Rhizosphere | MAQNAPKKAGEYERPMTGTSSSMAVMIGIIAVLAVIVIAVLFLR |
| Ga0247827_111953292 | 3300028889 | Soil | MAENQPRKAGEYERPMTGTTSSIAFILGGIALLAVIIIAFLFLR |
| Ga0247652_11813422 | 3300030571 | Soil | MAEHQPQKAGAYERPLAGTSRPMAVTLSIIAVVAVI |
| Ga0308203_10264902 | 3300030829 | Soil | MAEHQPRKAGEYERPMIGTSSSIALTIGIIAVLAVIVVAVFFLR |
| Ga0308203_10392841 | 3300030829 | Soil | MADNQPRKAGEYERPMTGTASSMALVIGIIALLAVIIVAVLFLR |
| Ga0308205_10017923 | 3300030830 | Soil | MAEHQPRKAGEYERPMIGTSSAMALTIGIIAVLAVIVVAVFFLR |
| Ga0308205_10044231 | 3300030830 | Soil | MADNQPRKAGEYERPMTGTASSMALLIGIIALLAVIIVAVLFLR |
| Ga0308202_11114042 | 3300030902 | Soil | MAEHQPRKAGEYERPMLGTSSSMALTIGIIAVLAVIVVAVFFLR |
| Ga0308206_10129083 | 3300030903 | Soil | MADNQPRKAGEYERPMTGTSSSMALLIGLIALLAVIIVAVLFLR |
| Ga0308206_11194861 | 3300030903 | Soil | MAENQPRKAGEYERPMKGTSSSMAITIGIIVVLAVIVTAVFFLR |
| Ga0102760_108461761 | 3300031039 | Soil | MAENQPRKAGEYERPGIGASGSTALTIGIVAVLAIIVIAVLFLR |
| Ga0308204_100009635 | 3300031092 | Soil | MAENPPQKAGEYDRPAASSSTALTIGIIAVLVVIVVAVLFLR |
| Ga0308204_100078063 | 3300031092 | Soil | MTENQPRKAGEYERPMKGTSSSMAITIGIIVVLAVIVTAVFFLR |
| Ga0308204_103196131 | 3300031092 | Soil | ENQPRKAGEYERPMTGTTSSMALILGGIALIAVIIIALLFLR |
| Ga0308187_100750023 | 3300031114 | Soil | MAENQPRKAGEYEQPMTGTASSMAIIIGGIALLAVIIVALLFLR |
| Ga0310887_105898992 | 3300031547 | Soil | MAENQPTKAGEYERPITGTGSSMAMIIGGIALLAVIIIALLFLR |
| Ga0318546_110741062 | 3300031771 | Soil | MAENQPRKAGEYERPMTGTTSSMAIILGGIALLAVIIIALLFLR |
| Ga0307407_102193642 | 3300031903 | Rhizosphere | MAEQQPRKAGEYERPATRASRSTALIIGIIALLVVIILAVLFLR |
| Ga0307416_1002398452 | 3300032002 | Rhizosphere | MAEQQPRKAGEYERPATRAPRSTALIIGIIALLVVIILAVLFLR |
| Ga0268251_101599392 | 3300032159 | Agave | MAENQPRKAGEYERPMTGASSSMALTIGLIAVLAVIVVAVLFLR |
| Ga0310896_104063691 | 3300032211 | Soil | MAENQPRKAGEYERPMTGTTSSMAIIIGGIALLAVIIIALLFLR |
| ⦗Top⦘ |