NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F054262

Metagenome / Metatranscriptome Family F054262

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F054262
Family Type Metagenome / Metatranscriptome
Number of Sequences 140
Average Sequence Length 42 residues
Representative Sequence VPSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRLIDG
Number of Associated Samples 129
Number of Associated Scaffolds 140

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 74.10 %
% of genes near scaffold ends (potentially truncated) 97.14 %
% of genes from short scaffolds (< 2000 bps) 94.29 %
Associated GOLD sequencing projects 125
AlphaFold2 3D model prediction Yes
3D model pTM-score0.57

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (87.857 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(22.857 % of family members)
Environment Ontology (ENVO) Unclassified
(20.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.143 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 20.90%    β-sheet: 8.96%    Coil/Unstructured: 70.15%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.57
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 140 Family Scaffolds
PF00496SBP_bac_5 29.29
PF08240ADH_N 7.14
PF01408GFO_IDH_MocA 2.14
PF02614UxaC 1.43
PF05988DUF899 1.43
PF02894GFO_IDH_MocA_C 1.43
PF01385OrfB_IS605 1.43
PF08352oligo_HPY 1.43
PF08044DUF1707 0.71
PF12708Pectate_lyase_3 0.71
PF00378ECH_1 0.71
PF01243Putative_PNPOx 0.71

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 140 Family Scaffolds
COG0673Predicted dehydrogenaseGeneral function prediction only [R] 1.43
COG0675TransposaseMobilome: prophages, transposons [X] 1.43
COG1904Glucuronate isomeraseCarbohydrate transport and metabolism [G] 1.43
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 1.43


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms87.86 %
UnclassifiedrootN/A12.14 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573003|GZIR7W402HJ56MAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria522Open in IMG/M
3300002245|JGIcombinedJ26739_100208435All Organisms → cellular organisms → Bacteria1847Open in IMG/M
3300002245|JGIcombinedJ26739_100314169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1450Open in IMG/M
3300004091|Ga0062387_100689999All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300004476|Ga0068966_1393831All Organisms → cellular organisms → Bacteria2212Open in IMG/M
3300005332|Ga0066388_104507229All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300005434|Ga0070709_11418102All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300005435|Ga0070714_100937116All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300005435|Ga0070714_102372377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes516Open in IMG/M
3300005436|Ga0070713_101088007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria772Open in IMG/M
3300005439|Ga0070711_101986133All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes511Open in IMG/M
3300005440|Ga0070705_100393342All Organisms → cellular organisms → Bacteria1024Open in IMG/M
3300005456|Ga0070678_102212704All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300005548|Ga0070665_100528423All Organisms → cellular organisms → Bacteria1191Open in IMG/M
3300005548|Ga0070665_101679723All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300005560|Ga0066670_10827708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria561Open in IMG/M
3300005577|Ga0068857_101620983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia632Open in IMG/M
3300005587|Ga0066654_10650572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria587Open in IMG/M
3300005602|Ga0070762_10367822All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300005610|Ga0070763_10198390All Organisms → cellular organisms → Bacteria1069Open in IMG/M
3300005614|Ga0068856_101454304All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300005712|Ga0070764_10412333All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300005764|Ga0066903_107249993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia574Open in IMG/M
3300006173|Ga0070716_101415288Not Available566Open in IMG/M
3300006174|Ga0075014_101027912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria501Open in IMG/M
3300006237|Ga0097621_102029484All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300006576|Ga0074047_11877854All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300006606|Ga0074062_10003974All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1099Open in IMG/M
3300006804|Ga0079221_10463729All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300006854|Ga0075425_101814357All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300006904|Ga0075424_100818633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria993Open in IMG/M
3300009698|Ga0116216_10293324All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria991Open in IMG/M
3300010339|Ga0074046_10705416Not Available592Open in IMG/M
3300010360|Ga0126372_12365018All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria582Open in IMG/M
3300010371|Ga0134125_11480266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria739Open in IMG/M
3300010373|Ga0134128_11653123All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria705Open in IMG/M
3300010375|Ga0105239_10926687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1000Open in IMG/M
3300010376|Ga0126381_100805831All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp.1348Open in IMG/M
3300010379|Ga0136449_101179497Not Available1209Open in IMG/M
3300010396|Ga0134126_10848321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1030Open in IMG/M
3300010398|Ga0126383_11464615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria773Open in IMG/M
3300010880|Ga0126350_11350233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria823Open in IMG/M
3300011078|Ga0138565_1027163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria791Open in IMG/M
3300011120|Ga0150983_11713510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1135Open in IMG/M
3300012469|Ga0150984_100546702All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria665Open in IMG/M
3300012480|Ga0157346_1005005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria806Open in IMG/M
3300012492|Ga0157335_1031401All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300012499|Ga0157350_1003584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1028Open in IMG/M
3300012507|Ga0157342_1010534All Organisms → cellular organisms → Bacteria947Open in IMG/M
3300012958|Ga0164299_10903638Not Available641Open in IMG/M
3300013104|Ga0157370_10691317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria931Open in IMG/M
3300013308|Ga0157375_11420488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria818Open in IMG/M
3300017822|Ga0187802_10328516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria599Open in IMG/M
3300017933|Ga0187801_10072377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1278Open in IMG/M
3300017942|Ga0187808_10074615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1457Open in IMG/M
3300017973|Ga0187780_11138827Not Available571Open in IMG/M
3300017974|Ga0187777_11110842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii575Open in IMG/M
3300018035|Ga0187875_10306426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria859Open in IMG/M
3300018035|Ga0187875_10420721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria712Open in IMG/M
3300018035|Ga0187875_10599825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria581Open in IMG/M
3300020070|Ga0206356_10144509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria691Open in IMG/M
3300020076|Ga0206355_1144417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria721Open in IMG/M
3300020078|Ga0206352_10687209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria714Open in IMG/M
3300020081|Ga0206354_10383738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300020082|Ga0206353_11475521All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300020580|Ga0210403_10571246Not Available915Open in IMG/M
3300020581|Ga0210399_10871137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria732Open in IMG/M
3300020583|Ga0210401_10625953All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria938Open in IMG/M
3300021088|Ga0210404_10398578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria769Open in IMG/M
3300021168|Ga0210406_10335688Not Available1222Open in IMG/M
3300021180|Ga0210396_11436805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria569Open in IMG/M
3300021404|Ga0210389_10375430All Organisms → cellular organisms → Bacteria1117Open in IMG/M
3300021406|Ga0210386_10469831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1087Open in IMG/M
3300021433|Ga0210391_10776281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria750Open in IMG/M
3300021444|Ga0213878_10172908All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium902Open in IMG/M
3300021474|Ga0210390_10265065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1455Open in IMG/M
3300021560|Ga0126371_12959925All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300022521|Ga0224541_1004578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1478Open in IMG/M
3300022530|Ga0242658_1192616All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria550Open in IMG/M
3300022531|Ga0242660_1119801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria663Open in IMG/M
3300022718|Ga0242675_1017789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria964Open in IMG/M
3300022724|Ga0242665_10156846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria723Open in IMG/M
3300022873|Ga0224550_1070843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria502Open in IMG/M
3300024176|Ga0224565_1043208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium524Open in IMG/M
3300025504|Ga0208356_1006792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans2671Open in IMG/M
3300025912|Ga0207707_11090528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria651Open in IMG/M
3300025928|Ga0207700_10851811All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300026310|Ga0209239_1199814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria722Open in IMG/M
3300027110|Ga0208488_1068058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria592Open in IMG/M
3300027117|Ga0209732_1091978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria527Open in IMG/M
3300027334|Ga0209529_1018379All Organisms → cellular organisms → Bacteria1181Open in IMG/M
3300027648|Ga0209420_1163528Not Available605Open in IMG/M
3300027674|Ga0209118_1061773Not Available1091Open in IMG/M
3300027879|Ga0209169_10291282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria857Open in IMG/M
3300027882|Ga0209590_10054375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2245Open in IMG/M
3300027882|Ga0209590_10768961Not Available613Open in IMG/M
3300027884|Ga0209275_10612363Not Available625Open in IMG/M
3300027898|Ga0209067_10957936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300027911|Ga0209698_10125782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2120Open in IMG/M
3300028381|Ga0268264_10200034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1827Open in IMG/M
3300028808|Ga0302228_10222737All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria855Open in IMG/M
3300029943|Ga0311340_10776331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria811Open in IMG/M
3300029951|Ga0311371_10797654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1164Open in IMG/M
3300029999|Ga0311339_11005802Not Available781Open in IMG/M
3300030549|Ga0210257_10860742Not Available528Open in IMG/M
3300030580|Ga0311355_11184937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria675Open in IMG/M
3300030737|Ga0302310_10586917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria590Open in IMG/M
3300030743|Ga0265461_10630794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria940Open in IMG/M
3300031199|Ga0307495_10240065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria517Open in IMG/M
3300031640|Ga0318555_10438569All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria708Open in IMG/M
3300031744|Ga0306918_11231818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria577Open in IMG/M
3300031747|Ga0318502_10168785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1255Open in IMG/M
3300031747|Ga0318502_10579457All Organisms → cellular organisms → Bacteria → Proteobacteria675Open in IMG/M
3300031748|Ga0318492_10662663Not Available558Open in IMG/M
3300031782|Ga0318552_10604105All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300031846|Ga0318512_10028526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans2375Open in IMG/M
3300031879|Ga0306919_11245325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria564Open in IMG/M
3300031890|Ga0306925_10470486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1341Open in IMG/M
3300031912|Ga0306921_10752450All Organisms → cellular organisms → Bacteria1116Open in IMG/M
3300031942|Ga0310916_11350781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria585Open in IMG/M
3300031947|Ga0310909_11177091All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria621Open in IMG/M
3300031954|Ga0306926_11590788Not Available750Open in IMG/M
3300032008|Ga0318562_10494013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii710Open in IMG/M
3300032035|Ga0310911_10350668Not Available852Open in IMG/M
3300032042|Ga0318545_10138019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria864Open in IMG/M
3300032042|Ga0318545_10252098All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300032063|Ga0318504_10263360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria812Open in IMG/M
3300032064|Ga0318510_10113783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1041Open in IMG/M
3300032091|Ga0318577_10067020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1638Open in IMG/M
3300032160|Ga0311301_12535849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria572Open in IMG/M
3300032174|Ga0307470_11473164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria565Open in IMG/M
3300032895|Ga0335074_10980265All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300032896|Ga0335075_10086837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae4161Open in IMG/M
3300032896|Ga0335075_10105047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3681Open in IMG/M
3300032896|Ga0335075_10814622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria872Open in IMG/M
3300033134|Ga0335073_11745202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia585Open in IMG/M
3300033134|Ga0335073_11804804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria571Open in IMG/M
3300033158|Ga0335077_10490719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1301Open in IMG/M
3300033289|Ga0310914_11151507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii677Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil22.86%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.71%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.29%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.29%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.57%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere3.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.57%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.57%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.86%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.14%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.14%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.14%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.14%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.14%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere2.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.43%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.43%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.43%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.43%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.43%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.43%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.43%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.43%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.71%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.71%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.71%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.71%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.71%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.71%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.71%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.71%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.71%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.71%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.71%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.71%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.71%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.71%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.71%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.71%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.71%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573003Grass soil microbial communities from Rothamsted Park, UK - FE2 (NaCl 30g/L 5ml)EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004476Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006576Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011078Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 50 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012480Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610Host-AssociatedOpen in IMG/M
3300012492Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610Host-AssociatedOpen in IMG/M
3300012499Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.yng.030610EnvironmentalOpen in IMG/M
3300012507Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610Host-AssociatedOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020076Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3)EnvironmentalOpen in IMG/M
3300020078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021444Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02EnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022521Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24EnvironmentalOpen in IMG/M
3300022530Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022531Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022718Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022873Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14EnvironmentalOpen in IMG/M
3300024176Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1EnvironmentalOpen in IMG/M
3300025504Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300027110Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes)EnvironmentalOpen in IMG/M
3300027117Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027334Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027648Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027674Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028808Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030549Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR102SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030737Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2EnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FE2_076128402189573003Grass SoilVLSRIAFSTLAFPDVPLAAAVSAGRRWGYSGVELRLIDGELIDP
JGIcombinedJ26739_10020843523300002245Forest SoilVSMQLRIAFSTLAFPDASLATAVSLGRQWGYGGVELRLIDG
JGIcombinedJ26739_10031416923300002245Forest SoilMNTLPIAFTTLAFPDATLAEATSLGRSWGYAGVELRLIDGQVF
Ga0062387_10068999923300004091Bog Forest SoilMNPSVRIAFSTLAFPDASLASAVSLGRRWGYAGVEFRLIDGEL
Ga0068966_139383123300004476Peatlands SoilMNPPVRIAFSTLAFPDASLASAVSLGRRWGYAGVELRLIDGELI
Ga0066388_10450722913300005332Tropical Forest SoilVPSRIAFSTLAFPDATLAAALSAGRRWGYSGVELRLIDGELIDPSWRSPR*
Ga0070709_1141810223300005434Corn, Switchgrass And Miscanthus RhizosphereMPSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRLIDGE
Ga0070714_10093711613300005435Agricultural SoilVPSRIAFSTLAFPDVTLAAAVSAGRRWGYSGVELRLIDGELIDPELPA
Ga0070714_10237237713300005435Agricultural SoilVPSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRLIDGELI
Ga0070713_10108800713300005436Corn, Switchgrass And Miscanthus RhizosphereVPEERGVPSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRL
Ga0070711_10198613323300005439Corn, Switchgrass And Miscanthus RhizosphereVRAEGRSEPSRIAFSTLAFPDATLAAALSAGRRWGYSGVELRLIDGEL
Ga0070705_10039334213300005440Corn, Switchgrass And Miscanthus RhizosphereMNALRIAFSTLAFPDASLEEAISLGRTWGYAGVELRLIDGQ
Ga0070678_10221270413300005456Miscanthus RhizosphereVLSRIAFSTLAFPDATLAAAICAGRRWGYSGVELRLIDGELI
Ga0070665_10052842313300005548Switchgrass RhizosphereVLSRIAFSTLAFPDATLAAAISAGRRWGYSGVELRLIDGEL
Ga0070665_10167972313300005548Switchgrass RhizosphereVPSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRLIDGELIDPAM
Ga0066670_1082770813300005560SoilMPPRIAFSTLAFPDATLAAAVSLGRRWGYAGIELRL
Ga0068857_10162098313300005577Corn RhizosphereMPPRIAFSTLAFPDATLAAAVSLGRRWGYAGIELRLIDGELIDP
Ga0066654_1065057223300005587SoilVPSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELR
Ga0070762_1036782213300005602SoilMHMNALRIAFSTLAFPDATLAEATSLGRSWGYAGVELRLIDGQLIDS
Ga0070763_1019839023300005610SoilVPSRIAFSTLAFPDATLAAALFAGRRWGYSGVELRLIDGELIDPAM
Ga0068856_10145430423300005614Corn RhizosphereVPSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRLIDG
Ga0070764_1041233313300005712SoilMQPPIAFSTLAFPDASLATAVSLGRKWGYGGVELRLIDGELI
Ga0066903_10724999323300005764Tropical Forest SoilMPPRIAFSTLAFPDATLAAAVSLGRRWGYAGIELRLIDGELID
Ga0070716_10141528833300006173Corn, Switchgrass And Miscanthus RhizosphereMNPSRIAYSTLAFPDATLAEATTLGRSWGYAGVELR
Ga0075014_10102791223300006174WatershedsMHPPSRVAFSTLAFPDATLASAVSLGRRWGYAGVELRLIDGELIDP
Ga0097621_10202948413300006237Miscanthus RhizosphereVPSRIAFSTLAFPDVTLAAAVSAGRRWGYSGVELRLIDGELID
Ga0074047_1187785423300006576SoilVPSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRLVDGEL
Ga0074062_1000397413300006606SoilVPSRIAFSTLAFPDATLAAAASAGRRWGYSGPSPS
Ga0079221_1046372913300006804Agricultural SoilVLSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRL
Ga0075425_10181435713300006854Populus RhizosphereMPPRIAFSTLAFPDATLAAAVSLGRRWGYAGIELRLIDGE
Ga0075424_10081863313300006904Populus RhizosphereVRGRRKERPSRIAFSTLAFPDATLAAALSAGRRWGYSG
Ga0116216_1029332423300009698Peatlands SoilMSVPARVAFSTLAFPDATLASATSLGRRWGYSGIELRLIDGELIDP
Ga0074046_1070541613300010339Bog Forest SoilMSAPPRIAFSTLAFPNAILASAASLGCRWGYSGIELRL
Ga0126372_1236501823300010360Tropical Forest SoilMSVPPRIAFSTLAFPDAALAAAVGAGRRWGYAGVELRLIDGELIDP
Ga0134125_1148026613300010371Terrestrial SoilVRSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRL
Ga0134128_1165312313300010373Terrestrial SoilMNALRIAFSTLAFPDASLEEAISLGRTWGYAGVELRLI
Ga0105239_1092668713300010375Corn RhizosphereVPSRIAFSTLAFPDATLAAAISAGRRWGYSGVELRL
Ga0126381_10080583113300010376Tropical Forest SoilMNEMRFAFSTLAFPGAALATTVSLGRSWGYAGVELRLVDGQ
Ga0136449_10117949713300010379Peatlands SoilMDMNTLRIAFSTLAFPDATLAEAITLGRSWGYAGVELRLIDGQ
Ga0134126_1084832113300010396Terrestrial SoilMPPRIAFSTLAFPDATLAAAVSLGRRWGYAGIELRLIDG
Ga0126383_1146461513300010398Tropical Forest SoilMSAPRIAFSTLAFPKASLATAVRLGREWGYAGVELRLIDGALI
Ga0126350_1135023313300010880Boreal Forest SoilMLPMSAPPRIAFSTLAFPGATLAEAASLGRRWGYAGIEL
Ga0138565_102716323300011078Peatlands SoilMNPPVRIAFSTLAFPDASLASAVSLGRRWGYAGVELRLIDGELID
Ga0150983_1171351023300011120Forest SoilMSVPPRIAFSTLAFPQATLAAAASLGRRWGYSGIELRLIDG
Ga0150984_10054670213300012469Avena Fatua RhizosphereVPSRIAFSTLAFPDTTLAAAVSAGRRWGYSGVELRLIDG
Ga0157346_100500513300012480Arabidopsis RhizosphereVLSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELR
Ga0157335_103140113300012492Arabidopsis RhizosphereVLSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRLIDGELIDPAA
Ga0157350_100358413300012499Unplanted SoilVPSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRLIDGELID
Ga0157342_101053423300012507Arabidopsis RhizosphereVLSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRLIDGELIDPAAYPH
Ga0164299_1090363813300012958SoilMNALRIAFSTLAFPEATLEEAVTLGHACGYAGVELRLIDGQMID
Ga0157370_1069131713300013104Corn RhizosphereVRAEGRSEPSRIAFSTLAFPDATLAAAASAGRRWGYSGIELRLIDGELID
Ga0157375_1142048823300013308Miscanthus RhizosphereVSSRIAFSTLAFPDATLAAAISAGRRWGYSGVELRLIDGELI
Ga0187802_1032851623300017822Freshwater SedimentMSVAPRIAFSTLAFPDATLVAAAAAGRRWGYAGIEL
Ga0187801_1007237723300017933Freshwater SedimentVPVVSAEADRSPGLLSRFAFSTLAFPGTTLAAAASLGRRWGYTGVELRLIDGE
Ga0187808_1007461513300017942Freshwater SedimentMMHPPPRVAFSTLAFPDATLASAVSLGRRWGYAGVELRLI
Ga0187783_1141975623300017970Tropical PeatlandVSVVSLDADRSPGVLPRFAFSTLAFPDTTLAAAVSLGRRWGYTGVELRLIDGEL
Ga0187780_1113882713300017973Tropical PeatlandMSVPARIAFSTLAFPGATLAAAAAAGRRWGYSGIELR
Ga0187777_1111084213300017974Tropical PeatlandMTHRPPRVVFSTLALPDATLASAVSLGRRWGYAGVELRLIDGELADRMEVTP
Ga0187875_1030642623300018035PeatlandMPVNAMPLAFSTLAFPDTPLATAASLGRSWGYSGIELRLIDGELI
Ga0187875_1042072123300018035PeatlandMSAPSRIAFSTLAFPDATLASAASLGRRWGYAGIELRLID
Ga0187875_1059982523300018035PeatlandMPPRIAFSTLAFPAATLAAAVSLGRRWGYAGIELR
Ga0206356_1014450913300020070Corn, Switchgrass And Miscanthus RhizosphereMPSRIAFSTLAFPDATLAAAVSLGRRWGYADVKRDK
Ga0206355_114441713300020076Corn, Switchgrass And Miscanthus RhizosphereVPSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRLIDGE
Ga0206352_1068720913300020078Corn, Switchgrass And Miscanthus RhizosphereVPSRIAFSTLAFPDATLAAAISAGRRWGYSGVELRLID
Ga0206354_1038373813300020081Corn, Switchgrass And Miscanthus RhizosphereVRAEGRSEPSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRLI
Ga0206353_1147552123300020082Corn, Switchgrass And Miscanthus RhizosphereVPSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRLIDGELIDP
Ga0210403_1057124623300020580SoilMKALRIAFSTLAFPDATLAEATALGRSWGYAGVELRLIDGQLI
Ga0210399_1087113723300020581SoilMHPPSRVSFSTLAFPDATLASAVSLGRRWGYAGVELRLI
Ga0210401_1062595313300020583SoilVPSRIAFSTLAFPDATLAAAASAGRRWGYSGIELRLIDGEVIDPA
Ga0210404_1039857813300021088SoilMSPASAERRSVPSRIAFSTLAFPDATLAAAASAGRRWGYSGIELRLIDGE
Ga0210406_1033568813300021168SoilMKALRIAFSTLAFPDATLAEATALGRSWGYAGVELRLI
Ga0210396_1143680513300021180SoilMLASAPRIAFSTLAFPDATLATAVSLGRSWGYAGVE
Ga0210389_1037543013300021404SoilVPSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRLIDGELIDPA
Ga0210386_1046983113300021406SoilMTGSSRLAFSTLAFPGTTLARAVALGREYGYQGIELR
Ga0210391_1077628113300021433SoilMTRSPRIAFSTLAFPGTTLARAASLGRRYGYQGIEL
Ga0213878_1017290843300021444Bulk SoilMKPLRIAFSTLAFPEATLAEATALGRSWGYAGVELRL
Ga0210390_1026506513300021474SoilVTAPRLAFSTLAFPAATLATALSLGRSWGYSGVELRLIDGELIDPSM
Ga0126371_1295992523300021560Tropical Forest SoilMNEMRFAFSTLAFPGATLATAVTLGRSWGYAGVELLLVDGQLIDSSMSA
Ga0224541_100457813300022521SoilMIRSADPLSRVAFSTLAFPDATLASAVSLGRRWGYRGVELRLIDGELIDP
Ga0242658_119261613300022530SoilMPPRIAFSTLAFPDATLASAASLGRGWGYSGIELRLIDGELIDPSM
Ga0242660_111980123300022531SoilVPSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRLI
Ga0242675_101778913300022718SoilMSPASAERRSVPSRIAFSTLAFPDATLAAAASAGRRWGYSGIELRLIDGEL
Ga0242665_1015684613300022724SoilVPSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRLID
Ga0224550_107084313300022873SoilMIRSADPLSRVAFSTLAFPDATLASAVSLGRRWGYRGVELRLIDGEL
Ga0224565_104320813300024176Plant LitterVSAGPPIAFSTLAFPGASVATALSLGGAWGYGGVELRLIDGELI
Ga0208356_100679233300025504Arctic Peat SoilMSARRIAFSTLAFPDTPLARAVALGSSWGYTGVELRLIDG
Ga0207707_1109052813300025912Corn RhizosphereMPSRIAFSTLAFPDATLAAAVSLGRRWGYAGIELRLID
Ga0207700_1085181113300025928Corn, Switchgrass And Miscanthus RhizosphereMNALRIAFSTLAFPDASLEEAISLGRTWGYAGVELRLIDGQLIDSSM
Ga0209239_119981413300026310Grasslands SoilVSSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRLIDGELID
Ga0208488_106805813300027110Forest SoilMSGPSRIAFSTLAFPDATLASAASLGRRWGYAGIELRLIDGELIDPS
Ga0209732_109197813300027117Forest SoilMTARHIAFSTLAFPDTTLARAVALGRSWGYTGVELRLI
Ga0209529_101837923300027334Forest SoilVSMQPRIAFSTLAFPDASLATAVSLGRKWGYDGVELRLIDG
Ga0209420_116352823300027648Forest SoilMSAPPRIAFSTLAFPDATLASAASYGRRWGYAGIEL
Ga0209118_106177323300027674Forest SoilMPVKALPTAFSTLAFPDATLAEATSLGRSWGYAGVEL
Ga0209169_1029128213300027879SoilMTRSPRIAFSTLAFPGTTLARAASLGRQYGYQGIELRLI
Ga0209590_1005437513300027882Vadose Zone SoilMSVPPRIAFSTLAFPDATLAAAAALGRRWGYSGIELR
Ga0209590_1076896123300027882Vadose Zone SoilMSVPPRIAFSTLAFPDATLAAAAAAGRRWGYSGIELRLV
Ga0209275_1061236313300027884SoilMNALRIAFSTLAFPDATLAEATSLGRSWGYAGVELRLI
Ga0209067_1095793623300027898WatershedsMSMPPRIAFSTLAFPDATLAAAAAAGRRWGYSGIELRLIDG
Ga0209698_1012578213300027911WatershedsMHPPSRVCFSTLAFPDATLASAVSLGRRWGYAGVELRLIDGELIDPSM
Ga0268264_1020003413300028381Switchgrass RhizosphereVPSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRLIDGEL
Ga0302228_1022273723300028808PalsaMSASSRIAFSTLAFPDATLASAASLGRRWGYGGIELRLIDGELIDP
Ga0311340_1077633113300029943PalsaMSGPSRIAFSTLAFPDATLASAASLGRRWGYAGIELRLIDGEL
Ga0311371_1079765413300029951PalsaMTGSSRLAFSTLAFPGTTLARAASLGREYGYQGIELRLI
Ga0311339_1100580213300029999PalsaMAFMRVRLPPVNASRIAFSTLAFPDATLAEATSLGRSWGYSGVELRLIDGQ
Ga0210257_1086074213300030549SoilMSGPSRIAFSTLAFPDATLASAASLGRRWGYAGIELRLID
Ga0311355_1118493713300030580PalsaMTGSSRLAFSTLAFPGTTLARAASLGREYGYQGIELRLID
Ga0302310_1058691713300030737PalsaMSASSRIAFSTLAFPDATLASAASLGRRWGYGGIELRL
Ga0265461_1063079423300030743SoilMSALSRIAFSTLAFPDATLAAAASLGRRWGYGGIELRLKK
Ga0307495_1024006513300031199SoilMPPRIAFSTLAFPDATLAAAVSHGRRWGYAGIELRLI
Ga0318555_1043856923300031640SoilMTQPPPRVAFSTLAFPDATLASAVSLGRRWGYAGVEL
Ga0306918_1123181823300031744SoilVPSRIAFSTLAFPDATLAAATSAGRRWGYSGIELRLIDV
Ga0318502_1016878523300031747SoilAVPDATLAAAASAGRRWGYSGIELRLIDGELIDPSFRRPR
Ga0318502_1057945723300031747SoilMSPPRIAFSTLAFPYASLATAISLGRSWGYAGVELRLIDGELID
Ga0318492_1066266323300031748SoilMTQPPPRVAFSTLAFPDATLASAVSLGRRWGYAGVE
Ga0318552_1060410513300031782SoilMRIAFSTLAFPNQPLAEVISLGRSWGYSGVELRVIDGHMVESSM
Ga0318512_1002852613300031846SoilVPSRIAFSTLAYPDATLAAAASAGRRWGYSGIELRLIDGELIDPAM
Ga0306919_1124532513300031879SoilVPSRIAFSTLAFPDATLAAATSAGRRWGYSGIELRL
Ga0306925_1047048623300031890SoilVPSRIAFSTLAFPDATLAAATSAGRRWGYSGIELRLIDVGLLTAGGY
Ga0306921_1075245033300031912SoilMHVAPLRIAFSTLAFPDATLAEATALGRSWGYAGVELRLIDGQLIDSS
Ga0310916_1135078123300031942SoilMILSADPPPRVAFSTLAFPDATLARAVSLGRRWGYAGVELRL
Ga0310909_1117709123300031947SoilMTQPPPRVAFSTLAFPDATLASAVSLGRRWGYAGVELRLIDGELI
Ga0306926_1159078823300031954SoilMSPPLIAFSTLAFPDASLAAAVSLGREWGYAGVEL
Ga0318562_1049401313300032008SoilRIAFSTLAFPDATLAAAASAGRRWGYSGIELRLIDGELIDPSFRRPR
Ga0310911_1035066823300032035SoilMHVAPLRIAFSTLAFPDATLAEATALGRSWRYAGV
Ga0318545_1013801913300032042SoilMILSADPPPRVAFSTLAFPDATLARAVSLGRRWGYAGVELRLIDG
Ga0318545_1025209813300032042SoilMQIAFSTLAFPNQPLAEVISLGRSWGYSGVELRVIDGHMVESSMPA
Ga0318504_1026336013300032063SoilVPSRIAFSTLAFPDATLAAAASAGRRWGYSGIELRLIDGEL
Ga0318510_1011378313300032064SoilVAFSTLAFPDATLASAVSLGRRWGYAGVELRLIDGELIDPSMP
Ga0318577_1006702023300032091SoilMTQPPPRVAFSTLAFPDATLASAVSLGRRWGYAGVELRLIDG
Ga0311301_1253584913300032160Peatlands SoilMDMNTLRIAFSTLAFPDATLAEAITLGRSWGYAGVELRLIDG
Ga0307470_1147316423300032174Hardwood Forest SoilVPSRIAFSTLAFPDATLAAALFAGRRWGYSGVELRLIDG
Ga0335074_1098026523300032895SoilVSMQPRIAFSTLAFPDASLATAVSLGRKWGYGGVELRLIDGELIDPSMP
Ga0335075_1008683713300032896SoilMSRPRIAFSTLAFPDATLARAVSLGRSWGYEGVELRL
Ga0335075_1010504713300032896SoilMPQEAPITTARIAFSTLAFPDADLATAVSLGRSWGYAGVELRLIDGELID
Ga0335075_1081462213300032896SoilMSQPPPRVAFSTLAFPDATLASAVSLGRRWGYAGVELRLID
Ga0335073_1174520233300033134SoilMSAARIAFSTLAFPGASLATAISLGRSWGYAGVELRLIDGELI
Ga0335073_1180480413300033134SoilMTQPPPRVAFSTLAFPGATLASVVSLGRRWGYGGVELRLID
Ga0335077_1049071913300033158SoilFPDATLAAAASAGRRWGYSGIELRLIDGEPIDPSCRSPR
Ga0310914_1115150723300033289SoilIAFSTLAFPDATLAAAASAGRRWGYSGIELRLIDGELIDPSFRRPR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.