| Basic Information | |
|---|---|
| Family ID | F054262 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 140 |
| Average Sequence Length | 42 residues |
| Representative Sequence | VPSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRLIDG |
| Number of Associated Samples | 129 |
| Number of Associated Scaffolds | 140 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 74.10 % |
| % of genes near scaffold ends (potentially truncated) | 97.14 % |
| % of genes from short scaffolds (< 2000 bps) | 94.29 % |
| Associated GOLD sequencing projects | 125 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.857 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.857 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.143 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.90% β-sheet: 8.96% Coil/Unstructured: 70.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 140 Family Scaffolds |
|---|---|---|
| PF00496 | SBP_bac_5 | 29.29 |
| PF08240 | ADH_N | 7.14 |
| PF01408 | GFO_IDH_MocA | 2.14 |
| PF02614 | UxaC | 1.43 |
| PF05988 | DUF899 | 1.43 |
| PF02894 | GFO_IDH_MocA_C | 1.43 |
| PF01385 | OrfB_IS605 | 1.43 |
| PF08352 | oligo_HPY | 1.43 |
| PF08044 | DUF1707 | 0.71 |
| PF12708 | Pectate_lyase_3 | 0.71 |
| PF00378 | ECH_1 | 0.71 |
| PF01243 | Putative_PNPOx | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 140 Family Scaffolds |
|---|---|---|---|
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 1.43 |
| COG0675 | Transposase | Mobilome: prophages, transposons [X] | 1.43 |
| COG1904 | Glucuronate isomerase | Carbohydrate transport and metabolism [G] | 1.43 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 1.43 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.86 % |
| Unclassified | root | N/A | 12.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573003|GZIR7W402HJ56M | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100208435 | All Organisms → cellular organisms → Bacteria | 1847 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100314169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1450 | Open in IMG/M |
| 3300004091|Ga0062387_100689999 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300004476|Ga0068966_1393831 | All Organisms → cellular organisms → Bacteria | 2212 | Open in IMG/M |
| 3300005332|Ga0066388_104507229 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300005434|Ga0070709_11418102 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300005435|Ga0070714_100937116 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300005435|Ga0070714_102372377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 516 | Open in IMG/M |
| 3300005436|Ga0070713_101088007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 772 | Open in IMG/M |
| 3300005439|Ga0070711_101986133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 511 | Open in IMG/M |
| 3300005440|Ga0070705_100393342 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300005456|Ga0070678_102212704 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300005548|Ga0070665_100528423 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300005548|Ga0070665_101679723 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300005560|Ga0066670_10827708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 561 | Open in IMG/M |
| 3300005577|Ga0068857_101620983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 632 | Open in IMG/M |
| 3300005587|Ga0066654_10650572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 587 | Open in IMG/M |
| 3300005602|Ga0070762_10367822 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300005610|Ga0070763_10198390 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300005614|Ga0068856_101454304 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300005712|Ga0070764_10412333 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300005764|Ga0066903_107249993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 574 | Open in IMG/M |
| 3300006173|Ga0070716_101415288 | Not Available | 566 | Open in IMG/M |
| 3300006174|Ga0075014_101027912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
| 3300006237|Ga0097621_102029484 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300006576|Ga0074047_11877854 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300006606|Ga0074062_10003974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1099 | Open in IMG/M |
| 3300006804|Ga0079221_10463729 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300006854|Ga0075425_101814357 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300006904|Ga0075424_100818633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 993 | Open in IMG/M |
| 3300009698|Ga0116216_10293324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 991 | Open in IMG/M |
| 3300010339|Ga0074046_10705416 | Not Available | 592 | Open in IMG/M |
| 3300010360|Ga0126372_12365018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 582 | Open in IMG/M |
| 3300010371|Ga0134125_11480266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 739 | Open in IMG/M |
| 3300010373|Ga0134128_11653123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 705 | Open in IMG/M |
| 3300010375|Ga0105239_10926687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1000 | Open in IMG/M |
| 3300010376|Ga0126381_100805831 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 1348 | Open in IMG/M |
| 3300010379|Ga0136449_101179497 | Not Available | 1209 | Open in IMG/M |
| 3300010396|Ga0134126_10848321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1030 | Open in IMG/M |
| 3300010398|Ga0126383_11464615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 773 | Open in IMG/M |
| 3300010880|Ga0126350_11350233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 823 | Open in IMG/M |
| 3300011078|Ga0138565_1027163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 791 | Open in IMG/M |
| 3300011120|Ga0150983_11713510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1135 | Open in IMG/M |
| 3300012469|Ga0150984_100546702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 665 | Open in IMG/M |
| 3300012480|Ga0157346_1005005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 806 | Open in IMG/M |
| 3300012492|Ga0157335_1031401 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300012499|Ga0157350_1003584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1028 | Open in IMG/M |
| 3300012507|Ga0157342_1010534 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300012958|Ga0164299_10903638 | Not Available | 641 | Open in IMG/M |
| 3300013104|Ga0157370_10691317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 931 | Open in IMG/M |
| 3300013308|Ga0157375_11420488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 818 | Open in IMG/M |
| 3300017822|Ga0187802_10328516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 599 | Open in IMG/M |
| 3300017933|Ga0187801_10072377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1278 | Open in IMG/M |
| 3300017942|Ga0187808_10074615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1457 | Open in IMG/M |
| 3300017973|Ga0187780_11138827 | Not Available | 571 | Open in IMG/M |
| 3300017974|Ga0187777_11110842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 575 | Open in IMG/M |
| 3300018035|Ga0187875_10306426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 859 | Open in IMG/M |
| 3300018035|Ga0187875_10420721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 712 | Open in IMG/M |
| 3300018035|Ga0187875_10599825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 581 | Open in IMG/M |
| 3300020070|Ga0206356_10144509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 691 | Open in IMG/M |
| 3300020076|Ga0206355_1144417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 721 | Open in IMG/M |
| 3300020078|Ga0206352_10687209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 714 | Open in IMG/M |
| 3300020081|Ga0206354_10383738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
| 3300020082|Ga0206353_11475521 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300020580|Ga0210403_10571246 | Not Available | 915 | Open in IMG/M |
| 3300020581|Ga0210399_10871137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 732 | Open in IMG/M |
| 3300020583|Ga0210401_10625953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 938 | Open in IMG/M |
| 3300021088|Ga0210404_10398578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 769 | Open in IMG/M |
| 3300021168|Ga0210406_10335688 | Not Available | 1222 | Open in IMG/M |
| 3300021180|Ga0210396_11436805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 569 | Open in IMG/M |
| 3300021404|Ga0210389_10375430 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300021406|Ga0210386_10469831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1087 | Open in IMG/M |
| 3300021433|Ga0210391_10776281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 750 | Open in IMG/M |
| 3300021444|Ga0213878_10172908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 902 | Open in IMG/M |
| 3300021474|Ga0210390_10265065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1455 | Open in IMG/M |
| 3300021560|Ga0126371_12959925 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300022521|Ga0224541_1004578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1478 | Open in IMG/M |
| 3300022530|Ga0242658_1192616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
| 3300022531|Ga0242660_1119801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 663 | Open in IMG/M |
| 3300022718|Ga0242675_1017789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 964 | Open in IMG/M |
| 3300022724|Ga0242665_10156846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 723 | Open in IMG/M |
| 3300022873|Ga0224550_1070843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 502 | Open in IMG/M |
| 3300024176|Ga0224565_1043208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 524 | Open in IMG/M |
| 3300025504|Ga0208356_1006792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans | 2671 | Open in IMG/M |
| 3300025912|Ga0207707_11090528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 651 | Open in IMG/M |
| 3300025928|Ga0207700_10851811 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300026310|Ga0209239_1199814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 722 | Open in IMG/M |
| 3300027110|Ga0208488_1068058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 592 | Open in IMG/M |
| 3300027117|Ga0209732_1091978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 527 | Open in IMG/M |
| 3300027334|Ga0209529_1018379 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300027648|Ga0209420_1163528 | Not Available | 605 | Open in IMG/M |
| 3300027674|Ga0209118_1061773 | Not Available | 1091 | Open in IMG/M |
| 3300027879|Ga0209169_10291282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 857 | Open in IMG/M |
| 3300027882|Ga0209590_10054375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2245 | Open in IMG/M |
| 3300027882|Ga0209590_10768961 | Not Available | 613 | Open in IMG/M |
| 3300027884|Ga0209275_10612363 | Not Available | 625 | Open in IMG/M |
| 3300027898|Ga0209067_10957936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| 3300027911|Ga0209698_10125782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2120 | Open in IMG/M |
| 3300028381|Ga0268264_10200034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1827 | Open in IMG/M |
| 3300028808|Ga0302228_10222737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 855 | Open in IMG/M |
| 3300029943|Ga0311340_10776331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 811 | Open in IMG/M |
| 3300029951|Ga0311371_10797654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1164 | Open in IMG/M |
| 3300029999|Ga0311339_11005802 | Not Available | 781 | Open in IMG/M |
| 3300030549|Ga0210257_10860742 | Not Available | 528 | Open in IMG/M |
| 3300030580|Ga0311355_11184937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 675 | Open in IMG/M |
| 3300030737|Ga0302310_10586917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 590 | Open in IMG/M |
| 3300030743|Ga0265461_10630794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 940 | Open in IMG/M |
| 3300031199|Ga0307495_10240065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 517 | Open in IMG/M |
| 3300031640|Ga0318555_10438569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 708 | Open in IMG/M |
| 3300031744|Ga0306918_11231818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 577 | Open in IMG/M |
| 3300031747|Ga0318502_10168785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1255 | Open in IMG/M |
| 3300031747|Ga0318502_10579457 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 675 | Open in IMG/M |
| 3300031748|Ga0318492_10662663 | Not Available | 558 | Open in IMG/M |
| 3300031782|Ga0318552_10604105 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300031846|Ga0318512_10028526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans | 2375 | Open in IMG/M |
| 3300031879|Ga0306919_11245325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 564 | Open in IMG/M |
| 3300031890|Ga0306925_10470486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1341 | Open in IMG/M |
| 3300031912|Ga0306921_10752450 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300031942|Ga0310916_11350781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 585 | Open in IMG/M |
| 3300031947|Ga0310909_11177091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 621 | Open in IMG/M |
| 3300031954|Ga0306926_11590788 | Not Available | 750 | Open in IMG/M |
| 3300032008|Ga0318562_10494013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 710 | Open in IMG/M |
| 3300032035|Ga0310911_10350668 | Not Available | 852 | Open in IMG/M |
| 3300032042|Ga0318545_10138019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 864 | Open in IMG/M |
| 3300032042|Ga0318545_10252098 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300032063|Ga0318504_10263360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 812 | Open in IMG/M |
| 3300032064|Ga0318510_10113783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1041 | Open in IMG/M |
| 3300032091|Ga0318577_10067020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1638 | Open in IMG/M |
| 3300032160|Ga0311301_12535849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 572 | Open in IMG/M |
| 3300032174|Ga0307470_11473164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 565 | Open in IMG/M |
| 3300032895|Ga0335074_10980265 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300032896|Ga0335075_10086837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae | 4161 | Open in IMG/M |
| 3300032896|Ga0335075_10105047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3681 | Open in IMG/M |
| 3300032896|Ga0335075_10814622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 872 | Open in IMG/M |
| 3300033134|Ga0335073_11745202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 585 | Open in IMG/M |
| 3300033134|Ga0335073_11804804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 571 | Open in IMG/M |
| 3300033158|Ga0335077_10490719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1301 | Open in IMG/M |
| 3300033289|Ga0310914_11151507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 677 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.71% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.29% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.29% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.57% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.57% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.86% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.14% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.14% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.14% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.14% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.14% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 2.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.43% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.43% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.43% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.43% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.43% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.43% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.71% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.71% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.71% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.71% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.71% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.71% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.71% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.71% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.71% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.71% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573003 | Grass soil microbial communities from Rothamsted Park, UK - FE2 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004476 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011078 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 50 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Host-Associated | Open in IMG/M |
| 3300012499 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.yng.030610 | Environmental | Open in IMG/M |
| 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022521 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24 | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
| 3300024176 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 | Environmental | Open in IMG/M |
| 3300025504 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027110 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes) | Environmental | Open in IMG/M |
| 3300027117 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030549 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR102SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FE2_07612840 | 2189573003 | Grass Soil | VLSRIAFSTLAFPDVPLAAAVSAGRRWGYSGVELRLIDGELIDP |
| JGIcombinedJ26739_1002084352 | 3300002245 | Forest Soil | VSMQLRIAFSTLAFPDASLATAVSLGRQWGYGGVELRLIDG |
| JGIcombinedJ26739_1003141692 | 3300002245 | Forest Soil | MNTLPIAFTTLAFPDATLAEATSLGRSWGYAGVELRLIDGQVF |
| Ga0062387_1006899992 | 3300004091 | Bog Forest Soil | MNPSVRIAFSTLAFPDASLASAVSLGRRWGYAGVEFRLIDGEL |
| Ga0068966_13938312 | 3300004476 | Peatlands Soil | MNPPVRIAFSTLAFPDASLASAVSLGRRWGYAGVELRLIDGELI |
| Ga0066388_1045072291 | 3300005332 | Tropical Forest Soil | VPSRIAFSTLAFPDATLAAALSAGRRWGYSGVELRLIDGELIDPSWRSPR* |
| Ga0070709_114181022 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRLIDGE |
| Ga0070714_1009371161 | 3300005435 | Agricultural Soil | VPSRIAFSTLAFPDVTLAAAVSAGRRWGYSGVELRLIDGELIDPELPA |
| Ga0070714_1023723771 | 3300005435 | Agricultural Soil | VPSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRLIDGELI |
| Ga0070713_1010880071 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VPEERGVPSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRL |
| Ga0070711_1019861332 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VRAEGRSEPSRIAFSTLAFPDATLAAALSAGRRWGYSGVELRLIDGEL |
| Ga0070705_1003933421 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MNALRIAFSTLAFPDASLEEAISLGRTWGYAGVELRLIDGQ |
| Ga0070678_1022127041 | 3300005456 | Miscanthus Rhizosphere | VLSRIAFSTLAFPDATLAAAICAGRRWGYSGVELRLIDGELI |
| Ga0070665_1005284231 | 3300005548 | Switchgrass Rhizosphere | VLSRIAFSTLAFPDATLAAAISAGRRWGYSGVELRLIDGEL |
| Ga0070665_1016797231 | 3300005548 | Switchgrass Rhizosphere | VPSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRLIDGELIDPAM |
| Ga0066670_108277081 | 3300005560 | Soil | MPPRIAFSTLAFPDATLAAAVSLGRRWGYAGIELRL |
| Ga0068857_1016209831 | 3300005577 | Corn Rhizosphere | MPPRIAFSTLAFPDATLAAAVSLGRRWGYAGIELRLIDGELIDP |
| Ga0066654_106505722 | 3300005587 | Soil | VPSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELR |
| Ga0070762_103678221 | 3300005602 | Soil | MHMNALRIAFSTLAFPDATLAEATSLGRSWGYAGVELRLIDGQLIDS |
| Ga0070763_101983902 | 3300005610 | Soil | VPSRIAFSTLAFPDATLAAALFAGRRWGYSGVELRLIDGELIDPAM |
| Ga0068856_1014543042 | 3300005614 | Corn Rhizosphere | VPSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRLIDG |
| Ga0070764_104123331 | 3300005712 | Soil | MQPPIAFSTLAFPDASLATAVSLGRKWGYGGVELRLIDGELI |
| Ga0066903_1072499932 | 3300005764 | Tropical Forest Soil | MPPRIAFSTLAFPDATLAAAVSLGRRWGYAGIELRLIDGELID |
| Ga0070716_1014152883 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MNPSRIAYSTLAFPDATLAEATTLGRSWGYAGVELR |
| Ga0075014_1010279122 | 3300006174 | Watersheds | MHPPSRVAFSTLAFPDATLASAVSLGRRWGYAGVELRLIDGELIDP |
| Ga0097621_1020294841 | 3300006237 | Miscanthus Rhizosphere | VPSRIAFSTLAFPDVTLAAAVSAGRRWGYSGVELRLIDGELID |
| Ga0074047_118778542 | 3300006576 | Soil | VPSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRLVDGEL |
| Ga0074062_100039741 | 3300006606 | Soil | VPSRIAFSTLAFPDATLAAAASAGRRWGYSGPSPS |
| Ga0079221_104637291 | 3300006804 | Agricultural Soil | VLSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRL |
| Ga0075425_1018143571 | 3300006854 | Populus Rhizosphere | MPPRIAFSTLAFPDATLAAAVSLGRRWGYAGIELRLIDGE |
| Ga0075424_1008186331 | 3300006904 | Populus Rhizosphere | VRGRRKERPSRIAFSTLAFPDATLAAALSAGRRWGYSG |
| Ga0116216_102933242 | 3300009698 | Peatlands Soil | MSVPARVAFSTLAFPDATLASATSLGRRWGYSGIELRLIDGELIDP |
| Ga0074046_107054161 | 3300010339 | Bog Forest Soil | MSAPPRIAFSTLAFPNAILASAASLGCRWGYSGIELRL |
| Ga0126372_123650182 | 3300010360 | Tropical Forest Soil | MSVPPRIAFSTLAFPDAALAAAVGAGRRWGYAGVELRLIDGELIDP |
| Ga0134125_114802661 | 3300010371 | Terrestrial Soil | VRSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRL |
| Ga0134128_116531231 | 3300010373 | Terrestrial Soil | MNALRIAFSTLAFPDASLEEAISLGRTWGYAGVELRLI |
| Ga0105239_109266871 | 3300010375 | Corn Rhizosphere | VPSRIAFSTLAFPDATLAAAISAGRRWGYSGVELRL |
| Ga0126381_1008058311 | 3300010376 | Tropical Forest Soil | MNEMRFAFSTLAFPGAALATTVSLGRSWGYAGVELRLVDGQ |
| Ga0136449_1011794971 | 3300010379 | Peatlands Soil | MDMNTLRIAFSTLAFPDATLAEAITLGRSWGYAGVELRLIDGQ |
| Ga0134126_108483211 | 3300010396 | Terrestrial Soil | MPPRIAFSTLAFPDATLAAAVSLGRRWGYAGIELRLIDG |
| Ga0126383_114646151 | 3300010398 | Tropical Forest Soil | MSAPRIAFSTLAFPKASLATAVRLGREWGYAGVELRLIDGALI |
| Ga0126350_113502331 | 3300010880 | Boreal Forest Soil | MLPMSAPPRIAFSTLAFPGATLAEAASLGRRWGYAGIEL |
| Ga0138565_10271632 | 3300011078 | Peatlands Soil | MNPPVRIAFSTLAFPDASLASAVSLGRRWGYAGVELRLIDGELID |
| Ga0150983_117135102 | 3300011120 | Forest Soil | MSVPPRIAFSTLAFPQATLAAAASLGRRWGYSGIELRLIDG |
| Ga0150984_1005467021 | 3300012469 | Avena Fatua Rhizosphere | VPSRIAFSTLAFPDTTLAAAVSAGRRWGYSGVELRLIDG |
| Ga0157346_10050051 | 3300012480 | Arabidopsis Rhizosphere | VLSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELR |
| Ga0157335_10314011 | 3300012492 | Arabidopsis Rhizosphere | VLSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRLIDGELIDPAA |
| Ga0157350_10035841 | 3300012499 | Unplanted Soil | VPSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRLIDGELID |
| Ga0157342_10105342 | 3300012507 | Arabidopsis Rhizosphere | VLSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRLIDGELIDPAAYPH |
| Ga0164299_109036381 | 3300012958 | Soil | MNALRIAFSTLAFPEATLEEAVTLGHACGYAGVELRLIDGQMID |
| Ga0157370_106913171 | 3300013104 | Corn Rhizosphere | VRAEGRSEPSRIAFSTLAFPDATLAAAASAGRRWGYSGIELRLIDGELID |
| Ga0157375_114204882 | 3300013308 | Miscanthus Rhizosphere | VSSRIAFSTLAFPDATLAAAISAGRRWGYSGVELRLIDGELI |
| Ga0187802_103285162 | 3300017822 | Freshwater Sediment | MSVAPRIAFSTLAFPDATLVAAAAAGRRWGYAGIEL |
| Ga0187801_100723772 | 3300017933 | Freshwater Sediment | VPVVSAEADRSPGLLSRFAFSTLAFPGTTLAAAASLGRRWGYTGVELRLIDGE |
| Ga0187808_100746151 | 3300017942 | Freshwater Sediment | MMHPPPRVAFSTLAFPDATLASAVSLGRRWGYAGVELRLI |
| Ga0187783_114197562 | 3300017970 | Tropical Peatland | VSVVSLDADRSPGVLPRFAFSTLAFPDTTLAAAVSLGRRWGYTGVELRLIDGEL |
| Ga0187780_111388271 | 3300017973 | Tropical Peatland | MSVPARIAFSTLAFPGATLAAAAAAGRRWGYSGIELR |
| Ga0187777_111108421 | 3300017974 | Tropical Peatland | MTHRPPRVVFSTLALPDATLASAVSLGRRWGYAGVELRLIDGELADRMEVTP |
| Ga0187875_103064262 | 3300018035 | Peatland | MPVNAMPLAFSTLAFPDTPLATAASLGRSWGYSGIELRLIDGELI |
| Ga0187875_104207212 | 3300018035 | Peatland | MSAPSRIAFSTLAFPDATLASAASLGRRWGYAGIELRLID |
| Ga0187875_105998252 | 3300018035 | Peatland | MPPRIAFSTLAFPAATLAAAVSLGRRWGYAGIELR |
| Ga0206356_101445091 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSRIAFSTLAFPDATLAAAVSLGRRWGYADVKRDK |
| Ga0206355_11444171 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | VPSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRLIDGE |
| Ga0206352_106872091 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | VPSRIAFSTLAFPDATLAAAISAGRRWGYSGVELRLID |
| Ga0206354_103837381 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | VRAEGRSEPSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRLI |
| Ga0206353_114755212 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | VPSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRLIDGELIDP |
| Ga0210403_105712462 | 3300020580 | Soil | MKALRIAFSTLAFPDATLAEATALGRSWGYAGVELRLIDGQLI |
| Ga0210399_108711372 | 3300020581 | Soil | MHPPSRVSFSTLAFPDATLASAVSLGRRWGYAGVELRLI |
| Ga0210401_106259531 | 3300020583 | Soil | VPSRIAFSTLAFPDATLAAAASAGRRWGYSGIELRLIDGEVIDPA |
| Ga0210404_103985781 | 3300021088 | Soil | MSPASAERRSVPSRIAFSTLAFPDATLAAAASAGRRWGYSGIELRLIDGE |
| Ga0210406_103356881 | 3300021168 | Soil | MKALRIAFSTLAFPDATLAEATALGRSWGYAGVELRLI |
| Ga0210396_114368051 | 3300021180 | Soil | MLASAPRIAFSTLAFPDATLATAVSLGRSWGYAGVE |
| Ga0210389_103754301 | 3300021404 | Soil | VPSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRLIDGELIDPA |
| Ga0210386_104698311 | 3300021406 | Soil | MTGSSRLAFSTLAFPGTTLARAVALGREYGYQGIELR |
| Ga0210391_107762811 | 3300021433 | Soil | MTRSPRIAFSTLAFPGTTLARAASLGRRYGYQGIEL |
| Ga0213878_101729084 | 3300021444 | Bulk Soil | MKPLRIAFSTLAFPEATLAEATALGRSWGYAGVELRL |
| Ga0210390_102650651 | 3300021474 | Soil | VTAPRLAFSTLAFPAATLATALSLGRSWGYSGVELRLIDGELIDPSM |
| Ga0126371_129599252 | 3300021560 | Tropical Forest Soil | MNEMRFAFSTLAFPGATLATAVTLGRSWGYAGVELLLVDGQLIDSSMSA |
| Ga0224541_10045781 | 3300022521 | Soil | MIRSADPLSRVAFSTLAFPDATLASAVSLGRRWGYRGVELRLIDGELIDP |
| Ga0242658_11926161 | 3300022530 | Soil | MPPRIAFSTLAFPDATLASAASLGRGWGYSGIELRLIDGELIDPSM |
| Ga0242660_11198012 | 3300022531 | Soil | VPSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRLI |
| Ga0242675_10177891 | 3300022718 | Soil | MSPASAERRSVPSRIAFSTLAFPDATLAAAASAGRRWGYSGIELRLIDGEL |
| Ga0242665_101568461 | 3300022724 | Soil | VPSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRLID |
| Ga0224550_10708431 | 3300022873 | Soil | MIRSADPLSRVAFSTLAFPDATLASAVSLGRRWGYRGVELRLIDGEL |
| Ga0224565_10432081 | 3300024176 | Plant Litter | VSAGPPIAFSTLAFPGASVATALSLGGAWGYGGVELRLIDGELI |
| Ga0208356_10067923 | 3300025504 | Arctic Peat Soil | MSARRIAFSTLAFPDTPLARAVALGSSWGYTGVELRLIDG |
| Ga0207707_110905281 | 3300025912 | Corn Rhizosphere | MPSRIAFSTLAFPDATLAAAVSLGRRWGYAGIELRLID |
| Ga0207700_108518111 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MNALRIAFSTLAFPDASLEEAISLGRTWGYAGVELRLIDGQLIDSSM |
| Ga0209239_11998141 | 3300026310 | Grasslands Soil | VSSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRLIDGELID |
| Ga0208488_10680581 | 3300027110 | Forest Soil | MSGPSRIAFSTLAFPDATLASAASLGRRWGYAGIELRLIDGELIDPS |
| Ga0209732_10919781 | 3300027117 | Forest Soil | MTARHIAFSTLAFPDTTLARAVALGRSWGYTGVELRLI |
| Ga0209529_10183792 | 3300027334 | Forest Soil | VSMQPRIAFSTLAFPDASLATAVSLGRKWGYDGVELRLIDG |
| Ga0209420_11635282 | 3300027648 | Forest Soil | MSAPPRIAFSTLAFPDATLASAASYGRRWGYAGIEL |
| Ga0209118_10617732 | 3300027674 | Forest Soil | MPVKALPTAFSTLAFPDATLAEATSLGRSWGYAGVEL |
| Ga0209169_102912821 | 3300027879 | Soil | MTRSPRIAFSTLAFPGTTLARAASLGRQYGYQGIELRLI |
| Ga0209590_100543751 | 3300027882 | Vadose Zone Soil | MSVPPRIAFSTLAFPDATLAAAAALGRRWGYSGIELR |
| Ga0209590_107689612 | 3300027882 | Vadose Zone Soil | MSVPPRIAFSTLAFPDATLAAAAAAGRRWGYSGIELRLV |
| Ga0209275_106123631 | 3300027884 | Soil | MNALRIAFSTLAFPDATLAEATSLGRSWGYAGVELRLI |
| Ga0209067_109579362 | 3300027898 | Watersheds | MSMPPRIAFSTLAFPDATLAAAAAAGRRWGYSGIELRLIDG |
| Ga0209698_101257821 | 3300027911 | Watersheds | MHPPSRVCFSTLAFPDATLASAVSLGRRWGYAGVELRLIDGELIDPSM |
| Ga0268264_102000341 | 3300028381 | Switchgrass Rhizosphere | VPSRIAFSTLAFPDATLAAAVSAGRRWGYSGVELRLIDGEL |
| Ga0302228_102227372 | 3300028808 | Palsa | MSASSRIAFSTLAFPDATLASAASLGRRWGYGGIELRLIDGELIDP |
| Ga0311340_107763311 | 3300029943 | Palsa | MSGPSRIAFSTLAFPDATLASAASLGRRWGYAGIELRLIDGEL |
| Ga0311371_107976541 | 3300029951 | Palsa | MTGSSRLAFSTLAFPGTTLARAASLGREYGYQGIELRLI |
| Ga0311339_110058021 | 3300029999 | Palsa | MAFMRVRLPPVNASRIAFSTLAFPDATLAEATSLGRSWGYSGVELRLIDGQ |
| Ga0210257_108607421 | 3300030549 | Soil | MSGPSRIAFSTLAFPDATLASAASLGRRWGYAGIELRLID |
| Ga0311355_111849371 | 3300030580 | Palsa | MTGSSRLAFSTLAFPGTTLARAASLGREYGYQGIELRLID |
| Ga0302310_105869171 | 3300030737 | Palsa | MSASSRIAFSTLAFPDATLASAASLGRRWGYGGIELRL |
| Ga0265461_106307942 | 3300030743 | Soil | MSALSRIAFSTLAFPDATLAAAASLGRRWGYGGIELRLKK |
| Ga0307495_102400651 | 3300031199 | Soil | MPPRIAFSTLAFPDATLAAAVSHGRRWGYAGIELRLI |
| Ga0318555_104385692 | 3300031640 | Soil | MTQPPPRVAFSTLAFPDATLASAVSLGRRWGYAGVEL |
| Ga0306918_112318182 | 3300031744 | Soil | VPSRIAFSTLAFPDATLAAATSAGRRWGYSGIELRLIDV |
| Ga0318502_101687852 | 3300031747 | Soil | AVPDATLAAAASAGRRWGYSGIELRLIDGELIDPSFRRPR |
| Ga0318502_105794572 | 3300031747 | Soil | MSPPRIAFSTLAFPYASLATAISLGRSWGYAGVELRLIDGELID |
| Ga0318492_106626632 | 3300031748 | Soil | MTQPPPRVAFSTLAFPDATLASAVSLGRRWGYAGVE |
| Ga0318552_106041051 | 3300031782 | Soil | MRIAFSTLAFPNQPLAEVISLGRSWGYSGVELRVIDGHMVESSM |
| Ga0318512_100285261 | 3300031846 | Soil | VPSRIAFSTLAYPDATLAAAASAGRRWGYSGIELRLIDGELIDPAM |
| Ga0306919_112453251 | 3300031879 | Soil | VPSRIAFSTLAFPDATLAAATSAGRRWGYSGIELRL |
| Ga0306925_104704862 | 3300031890 | Soil | VPSRIAFSTLAFPDATLAAATSAGRRWGYSGIELRLIDVGLLTAGGY |
| Ga0306921_107524503 | 3300031912 | Soil | MHVAPLRIAFSTLAFPDATLAEATALGRSWGYAGVELRLIDGQLIDSS |
| Ga0310916_113507812 | 3300031942 | Soil | MILSADPPPRVAFSTLAFPDATLARAVSLGRRWGYAGVELRL |
| Ga0310909_111770912 | 3300031947 | Soil | MTQPPPRVAFSTLAFPDATLASAVSLGRRWGYAGVELRLIDGELI |
| Ga0306926_115907882 | 3300031954 | Soil | MSPPLIAFSTLAFPDASLAAAVSLGREWGYAGVEL |
| Ga0318562_104940131 | 3300032008 | Soil | RIAFSTLAFPDATLAAAASAGRRWGYSGIELRLIDGELIDPSFRRPR |
| Ga0310911_103506682 | 3300032035 | Soil | MHVAPLRIAFSTLAFPDATLAEATALGRSWRYAGV |
| Ga0318545_101380191 | 3300032042 | Soil | MILSADPPPRVAFSTLAFPDATLARAVSLGRRWGYAGVELRLIDG |
| Ga0318545_102520981 | 3300032042 | Soil | MQIAFSTLAFPNQPLAEVISLGRSWGYSGVELRVIDGHMVESSMPA |
| Ga0318504_102633601 | 3300032063 | Soil | VPSRIAFSTLAFPDATLAAAASAGRRWGYSGIELRLIDGEL |
| Ga0318510_101137831 | 3300032064 | Soil | VAFSTLAFPDATLASAVSLGRRWGYAGVELRLIDGELIDPSMP |
| Ga0318577_100670202 | 3300032091 | Soil | MTQPPPRVAFSTLAFPDATLASAVSLGRRWGYAGVELRLIDG |
| Ga0311301_125358491 | 3300032160 | Peatlands Soil | MDMNTLRIAFSTLAFPDATLAEAITLGRSWGYAGVELRLIDG |
| Ga0307470_114731642 | 3300032174 | Hardwood Forest Soil | VPSRIAFSTLAFPDATLAAALFAGRRWGYSGVELRLIDG |
| Ga0335074_109802652 | 3300032895 | Soil | VSMQPRIAFSTLAFPDASLATAVSLGRKWGYGGVELRLIDGELIDPSMP |
| Ga0335075_100868371 | 3300032896 | Soil | MSRPRIAFSTLAFPDATLARAVSLGRSWGYEGVELRL |
| Ga0335075_101050471 | 3300032896 | Soil | MPQEAPITTARIAFSTLAFPDADLATAVSLGRSWGYAGVELRLIDGELID |
| Ga0335075_108146221 | 3300032896 | Soil | MSQPPPRVAFSTLAFPDATLASAVSLGRRWGYAGVELRLID |
| Ga0335073_117452023 | 3300033134 | Soil | MSAARIAFSTLAFPGASLATAISLGRSWGYAGVELRLIDGELI |
| Ga0335073_118048041 | 3300033134 | Soil | MTQPPPRVAFSTLAFPGATLASVVSLGRRWGYGGVELRLID |
| Ga0335077_104907191 | 3300033158 | Soil | FPDATLAAAASAGRRWGYSGIELRLIDGEPIDPSCRSPR |
| Ga0310914_111515072 | 3300033289 | Soil | IAFSTLAFPDATLAAAASAGRRWGYSGIELRLIDGELIDPSFRRPR |
| ⦗Top⦘ |