Basic Information | |
---|---|
Family ID | F054259 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 140 |
Average Sequence Length | 37 residues |
Representative Sequence | MTEPTYEELKARLSQLEKEVETKKRSGDLIFKVGEKGG |
Number of Associated Samples | 127 |
Number of Associated Scaffolds | 140 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 98.57 % |
% of genes near scaffold ends (potentially truncated) | 98.57 % |
% of genes from short scaffolds (< 2000 bps) | 90.71 % |
Associated GOLD sequencing projects | 121 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.39 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (75.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.571 % of family members) |
Environment Ontology (ENVO) | Unclassified (22.857 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.143 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.27% β-sheet: 0.00% Coil/Unstructured: 72.73% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 140 Family Scaffolds |
---|---|---|
PF13620 | CarboxypepD_reg | 7.14 |
PF01979 | Amidohydro_1 | 2.14 |
PF02469 | Fasciclin | 1.43 |
PF01243 | Putative_PNPOx | 1.43 |
PF01977 | UbiD | 1.43 |
PF06537 | DHOR | 0.71 |
PF00926 | DHBP_synthase | 0.71 |
PF02129 | Peptidase_S15 | 0.71 |
PF03460 | NIR_SIR_ferr | 0.71 |
PF12801 | Fer4_5 | 0.71 |
PF09286 | Pro-kuma_activ | 0.71 |
PF12704 | MacB_PCD | 0.71 |
PF02687 | FtsX | 0.71 |
PF05649 | Peptidase_M13_N | 0.71 |
PF11875 | DnaJ-like_C11_C | 0.71 |
PF01592 | NifU_N | 0.71 |
PF14310 | Fn3-like | 0.71 |
PF12867 | DinB_2 | 0.71 |
PF00950 | ABC-3 | 0.71 |
PF02583 | Trns_repr_metal | 0.71 |
PF02371 | Transposase_20 | 0.71 |
PF07238 | PilZ | 0.71 |
PF01609 | DDE_Tnp_1 | 0.71 |
PF06071 | YchF-GTPase_C | 0.71 |
PF01326 | PPDK_N | 0.71 |
PF14659 | Phage_int_SAM_3 | 0.71 |
PF00892 | EamA | 0.71 |
PF00578 | AhpC-TSA | 0.71 |
PF00107 | ADH_zinc_N | 0.71 |
PF13432 | TPR_16 | 0.71 |
PF00873 | ACR_tran | 0.71 |
PF00072 | Response_reg | 0.71 |
PF01297 | ZnuA | 0.71 |
COG ID | Name | Functional Category | % Frequency in 140 Family Scaffolds |
---|---|---|---|
COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 1.43 |
COG2335 | Uncaracterized surface protein containing fasciclin (FAS1) repeats | General function prediction only [R] | 1.43 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.71 |
COG0012 | Ribosome-binding ATPase YchF, GTP1/OBG family | Translation, ribosomal structure and biogenesis [J] | 0.71 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.71 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.71 |
COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 0.71 |
COG4606 | ABC-type enterochelin transport system, permease component | Inorganic ion transport and metabolism [P] | 0.71 |
COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 0.71 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.71 |
COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 0.71 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.71 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.71 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.71 |
COG1937 | DNA-binding transcriptional regulator, FrmR family | Transcription [K] | 0.71 |
COG1108 | ABC-type Mn2+/Zn2+ transport system, permease component | Inorganic ion transport and metabolism [P] | 0.71 |
COG0822 | Fe-S cluster assembly scaffold protein IscU, NifU family | Posttranslational modification, protein turnover, chaperones [O] | 0.71 |
COG0609 | ABC-type Fe3+-siderophore transport system, permease component | Inorganic ion transport and metabolism [P] | 0.71 |
COG0574 | Phosphoenolpyruvate synthase/pyruvate phosphate dikinase | Carbohydrate transport and metabolism [G] | 0.71 |
COG0108 | 3,4-dihydroxy-2-butanone 4-phosphate synthase | Coenzyme transport and metabolism [H] | 0.71 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 75.00 % |
Unclassified | root | N/A | 25.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001471|JGI12712J15308_10117203 | Not Available | 679 | Open in IMG/M |
3300001593|JGI12635J15846_10070211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2594 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101380870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
3300004080|Ga0062385_10064664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1643 | Open in IMG/M |
3300004092|Ga0062389_100072330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2900 | Open in IMG/M |
3300005179|Ga0066684_10104874 | All Organisms → cellular organisms → Bacteria | 1738 | Open in IMG/M |
3300005437|Ga0070710_10893247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
3300005529|Ga0070741_11766654 | Not Available | 501 | Open in IMG/M |
3300005534|Ga0070735_10735116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
3300005591|Ga0070761_10525350 | Not Available | 732 | Open in IMG/M |
3300005591|Ga0070761_10717013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
3300005602|Ga0070762_10000326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 19161 | Open in IMG/M |
3300005764|Ga0066903_105496022 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300005844|Ga0068862_100268657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1559 | Open in IMG/M |
3300005921|Ga0070766_10387336 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 913 | Open in IMG/M |
3300006162|Ga0075030_101165243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
3300006173|Ga0070716_101460792 | Not Available | 558 | Open in IMG/M |
3300006174|Ga0075014_100403932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 745 | Open in IMG/M |
3300006354|Ga0075021_11114498 | Not Available | 517 | Open in IMG/M |
3300006642|Ga0075521_10040936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1990 | Open in IMG/M |
3300006806|Ga0079220_11766801 | Not Available | 543 | Open in IMG/M |
3300006852|Ga0075433_11724270 | Not Available | 539 | Open in IMG/M |
3300006871|Ga0075434_101682126 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300006903|Ga0075426_11007700 | Not Available | 630 | Open in IMG/M |
3300009029|Ga0066793_10875371 | Not Available | 509 | Open in IMG/M |
3300009029|Ga0066793_10893769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
3300009038|Ga0099829_10826668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 769 | Open in IMG/M |
3300009089|Ga0099828_10047284 | All Organisms → cellular organisms → Bacteria | 3555 | Open in IMG/M |
3300009093|Ga0105240_11656840 | Not Available | 668 | Open in IMG/M |
3300009162|Ga0075423_11164484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 822 | Open in IMG/M |
3300009764|Ga0116134_1089438 | Not Available | 1124 | Open in IMG/M |
3300009839|Ga0116223_10466102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
3300010048|Ga0126373_10957566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 921 | Open in IMG/M |
3300010048|Ga0126373_12963938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
3300010343|Ga0074044_10587994 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300010343|Ga0074044_10922864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
3300010396|Ga0134126_12412948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus | 572 | Open in IMG/M |
3300010401|Ga0134121_12597212 | Not Available | 550 | Open in IMG/M |
3300012096|Ga0137389_10872860 | Not Available | 772 | Open in IMG/M |
3300012202|Ga0137363_10955910 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300012203|Ga0137399_11331540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
3300012469|Ga0150984_119762234 | Not Available | 501 | Open in IMG/M |
3300012924|Ga0137413_11821811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
3300012975|Ga0134110_10289831 | Not Available | 704 | Open in IMG/M |
3300013104|Ga0157370_10911000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 798 | Open in IMG/M |
3300013308|Ga0157375_13597359 | Not Available | 516 | Open in IMG/M |
3300014200|Ga0181526_10954736 | Not Available | 539 | Open in IMG/M |
3300014657|Ga0181522_10147949 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
3300015053|Ga0137405_1083390 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
3300015053|Ga0137405_1196892 | Not Available | 533 | Open in IMG/M |
3300015053|Ga0137405_1253947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 829 | Open in IMG/M |
3300015373|Ga0132257_103040012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
3300017940|Ga0187853_10079785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1633 | Open in IMG/M |
3300017940|Ga0187853_10295711 | Not Available | 733 | Open in IMG/M |
3300017943|Ga0187819_10482776 | Not Available | 708 | Open in IMG/M |
3300017948|Ga0187847_10871145 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300017955|Ga0187817_10598740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 703 | Open in IMG/M |
3300017955|Ga0187817_10752927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
3300017959|Ga0187779_10122579 | All Organisms → cellular organisms → Bacteria | 1583 | Open in IMG/M |
3300017959|Ga0187779_10360588 | Not Available | 941 | Open in IMG/M |
3300017970|Ga0187783_10403530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 993 | Open in IMG/M |
3300018003|Ga0187876_1209959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
3300018007|Ga0187805_10204862 | Not Available | 901 | Open in IMG/M |
3300018013|Ga0187873_1352300 | Not Available | 538 | Open in IMG/M |
3300018018|Ga0187886_1239275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
3300018026|Ga0187857_10050495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2135 | Open in IMG/M |
3300018030|Ga0187869_10144378 | Not Available | 1183 | Open in IMG/M |
3300018033|Ga0187867_10053353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2423 | Open in IMG/M |
3300018062|Ga0187784_10657441 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
3300018086|Ga0187769_10024494 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4041 | Open in IMG/M |
3300018086|Ga0187769_10240314 | All Organisms → cellular organisms → Bacteria | 1346 | Open in IMG/M |
3300018090|Ga0187770_10313601 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
3300018468|Ga0066662_10140272 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1807 | Open in IMG/M |
3300019786|Ga0182025_1245229 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1812 | Open in IMG/M |
3300019787|Ga0182031_1386327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis | 3061 | Open in IMG/M |
3300021088|Ga0210404_10476986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
3300021171|Ga0210405_10422130 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
3300021402|Ga0210385_10107797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1951 | Open in IMG/M |
3300021402|Ga0210385_10867866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 693 | Open in IMG/M |
3300021403|Ga0210397_10450925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 968 | Open in IMG/M |
3300021420|Ga0210394_11758837 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300021432|Ga0210384_10665076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 933 | Open in IMG/M |
3300021559|Ga0210409_10736174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 858 | Open in IMG/M |
3300021560|Ga0126371_12530935 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300022515|Ga0224546_1012234 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
3300022557|Ga0212123_10498559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 791 | Open in IMG/M |
3300022734|Ga0224571_108301 | Not Available | 705 | Open in IMG/M |
3300024177|Ga0247686_1002655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1873 | Open in IMG/M |
3300024220|Ga0224568_1033576 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300024246|Ga0247680_1067315 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
3300025459|Ga0208689_1093270 | Not Available | 540 | Open in IMG/M |
3300025507|Ga0208188_1004204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5332 | Open in IMG/M |
3300025939|Ga0207665_11029629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
3300026011|Ga0208532_1002882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
3300026095|Ga0207676_10923455 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
3300026327|Ga0209266_1296282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
3300026482|Ga0257172_1063073 | Not Available | 680 | Open in IMG/M |
3300026498|Ga0257156_1087659 | Not Available | 647 | Open in IMG/M |
3300026537|Ga0209157_1375384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
3300026538|Ga0209056_10064663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3175 | Open in IMG/M |
3300026557|Ga0179587_10349070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 959 | Open in IMG/M |
3300027516|Ga0207761_1107639 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300027603|Ga0209331_1075069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 841 | Open in IMG/M |
3300027701|Ga0209447_10120768 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
3300027737|Ga0209038_10248876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
3300027767|Ga0209655_10241133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
3300027846|Ga0209180_10260034 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
3300027875|Ga0209283_10926000 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300027884|Ga0209275_10120002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1366 | Open in IMG/M |
3300027895|Ga0209624_10618395 | Not Available | 718 | Open in IMG/M |
3300028380|Ga0268265_10249210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1572 | Open in IMG/M |
3300028798|Ga0302222_10022178 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2601 | Open in IMG/M |
3300028882|Ga0302154_10550201 | Not Available | 546 | Open in IMG/M |
3300029907|Ga0311329_10875919 | Not Available | 566 | Open in IMG/M |
3300030518|Ga0302275_10472802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
3300030687|Ga0302309_10239843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 917 | Open in IMG/M |
3300030842|Ga0075404_11223622 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300030848|Ga0075388_11550956 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300030991|Ga0073994_11923497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
3300030991|Ga0073994_12076927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
3300031028|Ga0302180_10573409 | Not Available | 546 | Open in IMG/M |
3300031057|Ga0170834_109436177 | Not Available | 774 | Open in IMG/M |
3300031128|Ga0170823_12744550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
3300031241|Ga0265325_10079667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1630 | Open in IMG/M |
3300031573|Ga0310915_11205894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
3300031708|Ga0310686_115924069 | Not Available | 627 | Open in IMG/M |
3300031715|Ga0307476_10722038 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
3300031753|Ga0307477_10423103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 910 | Open in IMG/M |
3300031754|Ga0307475_11372820 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300031788|Ga0302319_10559386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1205 | Open in IMG/M |
3300031788|Ga0302319_10629817 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1107 | Open in IMG/M |
3300031833|Ga0310917_10230806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1243 | Open in IMG/M |
3300031912|Ga0306921_11200161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 845 | Open in IMG/M |
3300031942|Ga0310916_11045098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
3300031962|Ga0307479_10029225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5251 | Open in IMG/M |
3300031996|Ga0308176_11669698 | Not Available | 679 | Open in IMG/M |
3300032205|Ga0307472_101874854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
3300032783|Ga0335079_11347954 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300032828|Ga0335080_10887426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 915 | Open in IMG/M |
3300033888|Ga0334792_024282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2113 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.57% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.57% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 6.43% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.00% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.57% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.57% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.57% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.57% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.57% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.86% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.86% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.14% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.14% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.14% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.14% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.14% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.14% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.43% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.43% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.43% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.43% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.43% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.43% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.43% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.43% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.43% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.71% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.71% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.71% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.71% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.71% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.71% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.71% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.71% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.71% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.71% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.71% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.71% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.71% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.71% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.71% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.71% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.71% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022515 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 1-5 | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU3 | Host-Associated | Open in IMG/M |
3300024177 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK27 | Environmental | Open in IMG/M |
3300024220 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU5 | Environmental | Open in IMG/M |
3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
3300025459 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes) | Environmental | Open in IMG/M |
3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026011 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301 (SPAdes) | Environmental | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
3300030687 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_1 | Environmental | Open in IMG/M |
3300030842 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030848 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300033888 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12712J15308_101172033 | 3300001471 | Forest Soil | MTEPSYEELKARLADLEKQVDTKKRSGAIEFRVSEKGGVSV |
JGI12635J15846_100702113 | 3300001593 | Forest Soil | MSEPTYEELKARLSQLEKEVDTKKRSGDLIFKVGEKGGVS |
JGIcombinedJ26739_1013808701 | 3300002245 | Forest Soil | MTEPTYEELKAKLSQLEKQVETKKRSGVMEFKVSEKGGVS |
Ga0062385_100646643 | 3300004080 | Bog Forest Soil | MAEPTYEELKAKLSQLEKEVEVKKRSGDLIFKVGEKGGVSV |
Ga0062389_1000723303 | 3300004092 | Bog Forest Soil | MSEPTYEELKAKLSQLEKEVETKKRSGDLIFKVGEKGGVS |
Ga0066684_101048743 | 3300005179 | Soil | MSVMSEPTPEELKARIAELEQKLSSRRSKNLEFRVSEKGGV |
Ga0070710_108932471 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEPTYEELKARLQDLEKQVETKKRSGTMEFKVSEKGGVS |
Ga0070741_117666541 | 3300005529 | Surface Soil | MTEPSYEELKARVAELEKQAGRRQKGTLEFKVGEK |
Ga0070735_107351161 | 3300005534 | Surface Soil | MTEPTYEELKARLAAMEKQAGRRTGSLEFRVSEKG |
Ga0070761_105253501 | 3300005591 | Soil | MTEPSYEELKARLADLEKQVDTKKKSGVMEFRVSEKGGVS |
Ga0070761_107170131 | 3300005591 | Soil | MSEPTYEELKARLSQLEKEVETKKRSGDLIFKVGEKG |
Ga0070762_1000032617 | 3300005602 | Soil | MSEPTYEELKAKLSQLEKEVEIKKRSGDLIFKVGEKGGVS |
Ga0066903_1054960221 | 3300005764 | Tropical Forest Soil | MSEPSYEELKARLAELEKQAETRKRTGAIEFRVSEK |
Ga0068862_1002686572 | 3300005844 | Switchgrass Rhizosphere | MSEPTYEELKAKLSQLEKQVENKKRSGAMEFRVSE |
Ga0070766_103873361 | 3300005921 | Soil | MSEPTYEELKARLSQLEKEVEVKKRSGDLIFKVGEKG |
Ga0075030_1011652432 | 3300006162 | Watersheds | MTEPTYDELKAKLQELEKQVETKKRSGTMEFRVSEKGGVS |
Ga0070716_1014607921 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MTEPTYEELKARLAELEKQQGTRRSGSLEFRIGEK |
Ga0075014_1004039322 | 3300006174 | Watersheds | MTEPTYEELKARLQDLEKQVETKKRSGTMEFKVSEKG |
Ga0075021_111144982 | 3300006354 | Watersheds | MTEPSYEELKARLADLEKQVETKKRSGAVEFRVSEKGGVS |
Ga0075521_100409364 | 3300006642 | Arctic Peat Soil | MAEPSYEELKARVAELEKTQGRKRGSLEFKVSEKG |
Ga0079220_117668011 | 3300006806 | Agricultural Soil | MAEPTYEEFKAKLAEMEKQGGSKRSGSLEFRVGEK |
Ga0075433_117242701 | 3300006852 | Populus Rhizosphere | MSEPTYEELKAQLAALQKQSGQKRSGSLDFRVGEKG |
Ga0075434_1016821261 | 3300006871 | Populus Rhizosphere | MAEPSYEELKARLAELESQQGRQRSGSLEFRVGEK |
Ga0075426_110077002 | 3300006903 | Populus Rhizosphere | MTEPSYEELKARITELVKQGGRRQKGNLEFKVGEEG |
Ga0066793_108753711 | 3300009029 | Prmafrost Soil | MAEPSYDELKAKVAELEKQQARKRSGPLEFRVSEKGAVSVYGMG |
Ga0066793_108937692 | 3300009029 | Prmafrost Soil | MAEPSYEELKARVAELEKTQGRKRGSLEFKVSEKGGMS |
Ga0099829_108266682 | 3300009038 | Vadose Zone Soil | MAEPTYEELKARVAELEKQKTLGSLQFRVGDKGGV |
Ga0099828_100472844 | 3300009089 | Vadose Zone Soil | VTEPTYEELKARLTDLEKQVEAKKRTGAIEFRVSEK |
Ga0105240_116568402 | 3300009093 | Corn Rhizosphere | MAEPTYEELKARLAELEKHGTTRRTGSLDFRVSEK |
Ga0075423_111644843 | 3300009162 | Populus Rhizosphere | MPEPTYEELKARLAELQKQGATRSGSLEFRVSEKG |
Ga0116134_10894381 | 3300009764 | Peatland | MTEPSYEELKARLADLEKQVETKKRSGAIEFRVSEK |
Ga0116223_104661022 | 3300009839 | Peatlands Soil | MSEPSYEELKAKLAQLEKEVETKKRSGDLIFKVGEKGGV |
Ga0126373_109575662 | 3300010048 | Tropical Forest Soil | MAEPTYEELKAKLAQLEKEAETKKRSGDLIFKVGEKG |
Ga0126373_129639381 | 3300010048 | Tropical Forest Soil | MAEPTYEELKAKLAQLEKEVETKKRSGDLIFKVGEK |
Ga0074044_105879943 | 3300010343 | Bog Forest Soil | MSEPTYDELKARLADLEKQVEGKKRSGAMEFRVSEKGGV |
Ga0074044_109228641 | 3300010343 | Bog Forest Soil | MSEPTYEELKAKLSQLEKEVETKKRSGDLIFKVGEKGGVSV |
Ga0134126_124129481 | 3300010396 | Terrestrial Soil | MSEPTYEELKARLAELEKQGPKRSGSLEFRVSEKG |
Ga0134121_125972121 | 3300010401 | Terrestrial Soil | MPEPTYEELKARLSELEKQGPRRTGSLEFRVSEKGGV |
Ga0137389_108728601 | 3300012096 | Vadose Zone Soil | MAEPTYEELKARLAELAKQTAGRQARSLEFRVSEKGG |
Ga0137363_109559101 | 3300012202 | Vadose Zone Soil | MSEPTYEELKAQLEQAQKQLGSKKSGALDFRVGEKG |
Ga0137399_113315402 | 3300012203 | Vadose Zone Soil | MSEPTYEELKARLSQLEKEVEVKKRSGDLIFKVGE |
Ga0150984_1197622341 | 3300012469 | Avena Fatua Rhizosphere | MSEPSYEELKAKVAELEKKQTRQRSGALEFRVSEKG |
Ga0137413_118218112 | 3300012924 | Vadose Zone Soil | MSEPTYEELKARLSQLEKEKGPKRTGSLEFRVGEK |
Ga0134110_102898311 | 3300012975 | Grasslands Soil | MSEPTYEELKARLAELEKQGQRRSGSLEFRVGEKG |
Ga0157370_109110001 | 3300013104 | Corn Rhizosphere | MADPTYEEMKARLAELEKQVATKRTGSLEFRVSEKGG |
Ga0157375_135973591 | 3300013308 | Miscanthus Rhizosphere | MSEPTYEELKAQLAALQKQSGQKRSGTLDFRVGEKG |
Ga0181526_109547361 | 3300014200 | Bog | MTEPSYEELKARLADLEKQVETKKRSGAIEFRVSEKGGVS |
Ga0181522_101479491 | 3300014657 | Bog | LTEPTYDELKAKLQELEKQVETKKRSGVMEFRVSEKGGVSVY |
Ga0137405_10833903 | 3300015053 | Vadose Zone Soil | MTEPTYEELKAKLSQLEKEVETKKRSGDLIFKVGE |
Ga0137405_11968921 | 3300015053 | Vadose Zone Soil | MSEPSYEELKAKVAELEKQGPKRTGAMEYSASAKKAASA |
Ga0137405_12539471 | 3300015053 | Vadose Zone Soil | MTEPTYEELKAKLSQLEKEVETKKRSGDLIFKRSGD |
Ga0132257_1030400122 | 3300015373 | Arabidopsis Rhizosphere | MSEPSYEELKARLADLEKQVETKKRSGAMEFRVSEKG |
Ga0187853_100797851 | 3300017940 | Peatland | MSEPSYEELKARLSQLEKEVETKKRSGDLIFKVGEK |
Ga0187853_102957111 | 3300017940 | Peatland | MTEPTYEELKARLADLEKQAETKKRSGAIEFRVSEK |
Ga0187819_104827761 | 3300017943 | Freshwater Sediment | MTEPTYEELKAKLQELEKQVETKKRSGAMEFRVSEKGG |
Ga0187847_108711452 | 3300017948 | Peatland | MSEPTYEELKARLSQLEKEVETKKRSGDLIFKVGEKGGV |
Ga0187817_105987401 | 3300017955 | Freshwater Sediment | MSEPTYEELKARLSQLEKEVETKKRSGDLIFKVGEKGGVS |
Ga0187817_107529271 | 3300017955 | Freshwater Sediment | MAEPTYEELKAKLAELEKQGGTRRTGSLEFRVGEK |
Ga0187779_101225793 | 3300017959 | Tropical Peatland | MTEPSYEELKARLADLEKQVEAKKRGGALEFRVSE |
Ga0187779_103605881 | 3300017959 | Tropical Peatland | MSEPTYEELKARLAELEKKPGGSRRPGQLEFRVGEK |
Ga0187783_104035301 | 3300017970 | Tropical Peatland | MPEPTYEELKAKLAELEKQAQGRKRGNVDFKVSEKGGV |
Ga0187876_12099591 | 3300018003 | Peatland | MAEPTYEELKARLSQLEKEVETKKRSGDLIFKVGEKGGV |
Ga0187805_102048622 | 3300018007 | Freshwater Sediment | MAEPTYEELKARLAQLEKQVETKKRVGVLDFKVGEKG |
Ga0187873_13523002 | 3300018013 | Peatland | MTEPSYEELKARLSQLEKEVETKKRSGDLIFKVGE |
Ga0187886_12392752 | 3300018018 | Peatland | MSEPSYEELKARLSQLEKEVETKKRSGDLIFKVGEKGGVSVY |
Ga0187857_100504953 | 3300018026 | Peatland | MSEPSYEELKARLSQLEKEVETKKRSGDLIFKVGEKG |
Ga0187869_101443781 | 3300018030 | Peatland | MTEPSYEELKARLADLEKQVQTKKKVGVIDFRVSEKGGV |
Ga0187867_100533533 | 3300018033 | Peatland | MTEPSYEELKARLADLEKQVETKKRSGAIEFRVSEKGGVSV |
Ga0187784_106574412 | 3300018062 | Tropical Peatland | MSEPTYDELKSRVQELEKQQVQRRSGSLEFRIGEKGG |
Ga0187769_100244943 | 3300018086 | Tropical Peatland | MTEPTYEELKARLSQLEKEVETKKRSGDLIFKVGEKGGVS |
Ga0187769_102403141 | 3300018086 | Tropical Peatland | MAEPSYDELKARLQELEKQVESKKRSGAMEFRVSEKGGVS |
Ga0187770_103136012 | 3300018090 | Tropical Peatland | MPEPTYDELKARLQELEKQVETKKRTGAIEFRVSEKGGVSV |
Ga0066662_101402721 | 3300018468 | Grasslands Soil | MAEPTYEELKARLSELEKQQGTRRSGSLEFRVGEK |
Ga0182025_12452291 | 3300019786 | Permafrost | MTEQTYEELKARLSQLEKEAETKKRSGDLIFKVGEKG |
Ga0182031_13863276 | 3300019787 | Bog | MTEPSYEELKARLADLEKQVETKKKVGVIDFRVSEKVG |
Ga0210404_104769862 | 3300021088 | Soil | MSEPTYEELKAKLSQLEKEVETKKRSGDLIFKVGEKG |
Ga0210405_104221301 | 3300021171 | Soil | MTEPTYEELKARLTDLEKQVETKKRSGAMEFRVSEKGGVS |
Ga0210385_101077973 | 3300021402 | Soil | MAEPTYEELKAKLSQLEKEVETKKRSGDLIFKVGEKGGVS |
Ga0210385_108678662 | 3300021402 | Soil | MSEPSYDELKARLQELEKQVETKKRSGSMEFKVSEKGG |
Ga0210397_104509251 | 3300021403 | Soil | MAEPTYEELKAKLSQLEKEVETKKRSGDLIFKVGEKGGV |
Ga0210394_117588371 | 3300021420 | Soil | MTEPSYEELKARLADLEKQVETKKKSGAMEFRVSEKGG |
Ga0210384_106650763 | 3300021432 | Soil | MSEPTYEELKARLSQLEKEVEVKKRSGDLIFKVGEKGGVS |
Ga0210409_107361741 | 3300021559 | Soil | MTEPTYEELKARLAELEKQGPRRTASMEFRVSEKGGV |
Ga0126371_125309351 | 3300021560 | Tropical Forest Soil | TNSEGVRIMAEPSYEELKAKLAQLEKEVETKKRSGDLIFKVGEKL |
Ga0224546_10122341 | 3300022515 | Soil | MSEPTYEELKARLSQLEKEVETKKRSGDLIFKVGEKGGVSVY |
Ga0212123_104985592 | 3300022557 | Iron-Sulfur Acid Spring | MTEPTYEELKARLSQLEKEVETKKRSGDLIFKVGEKGG |
Ga0224571_1083012 | 3300022734 | Rhizosphere | MSEPSYEELKARLSQLEKEVETKKRSGDLIFKVGEKGGV |
Ga0247686_10026551 | 3300024177 | Soil | MSEPSYEELKAKLAELEKQQGTRRTGALEFRVGEK |
Ga0224568_10335762 | 3300024220 | Plant Litter | MTEPSYEELKARLSQLEKEVETKKRSGDLIFKVGEKGGVS |
Ga0247680_10673153 | 3300024246 | Soil | MAEPTYEELKARLSELEKQGTRRTGSLEFRAASAART |
Ga0208689_10932701 | 3300025459 | Peatland | MTEPSYEELKARLADLEKQVETKKRSGAIEFRVSE |
Ga0208188_10042045 | 3300025507 | Peatland | MTEPTYEELRARLADLEKQVETKKRSGAIEFRVSEK |
Ga0207665_110296292 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEPTYEEMKARLAELEKQVATKRTGSLEFRVSEKGG |
Ga0208532_10028821 | 3300026011 | Rice Paddy Soil | MAEPTYEELKAKLAQLEKEVETKKRSGDLIFKVGEKGG |
Ga0207676_109234551 | 3300026095 | Switchgrass Rhizosphere | VAEPTYEELKARLEQLEKQGPKRTGNLEFRVGEKGGV |
Ga0209266_12962821 | 3300026327 | Soil | MPEPSYEELKARLAELEKQVDTRKRSGSLEFKVSEKG |
Ga0257172_10630731 | 3300026482 | Soil | VTEPTYEELKARLTDLEKQVEAKKRTGAIEFRVSEKGGVSV |
Ga0257156_10876593 | 3300026498 | Soil | MTEPTYEELKARLATLEKQADKKRSGTLEFRVGEK |
Ga0209157_13753842 | 3300026537 | Soil | MAEPSYEELKARVAELEKQGPGRRSGQLEFRIGEKGG |
Ga0209056_100646634 | 3300026538 | Soil | MSEPSYEELKAQLAQLQKQSGSKRSGTLDFRVGEKG |
Ga0179587_103490702 | 3300026557 | Vadose Zone Soil | MSEPSYEELKARLADLEKQVETKKRSGTMEFKVSEKGG |
Ga0207761_11076391 | 3300027516 | Tropical Forest Soil | MSEPSYDELKARLAQLEKQVDAKKRSGNLEFRVSEKGG |
Ga0209331_10750692 | 3300027603 | Forest Soil | MTEPTYEELKARLTDLEKQVETRKRSGAMEFRVSEKGGV |
Ga0209447_101207681 | 3300027701 | Bog Forest Soil | MSEPTYEELKARLSQLEKEVDTKKRSGDLIFKVGEKGG |
Ga0209038_102488761 | 3300027737 | Bog Forest Soil | MSEPTYEELKARLSQLEKEVDTKKRSGDLIFKVGEKGGVSV |
Ga0209655_102411332 | 3300027767 | Bog Forest Soil | MAEPTYEELKAQLEELKKQSPAKRSGALEFRVGEK |
Ga0209180_102600341 | 3300027846 | Vadose Zone Soil | MAEPSYEELKARLAELEKQGGARRTGQLDFRVGEK |
Ga0209283_109260002 | 3300027875 | Vadose Zone Soil | MPEPTYEELKARLADLEKQGARRTGSLEFRVSEKGG |
Ga0209275_101200022 | 3300027884 | Soil | MAEPSYEELKAQLAELQKQSGSRRTGALDFRVGEKG |
Ga0209624_106183952 | 3300027895 | Forest Soil | MSEPSYEELKAQLAELKKQSGNRRTGALDFRVGEKG |
Ga0268265_102492102 | 3300028380 | Switchgrass Rhizosphere | MSEPTYEELKAKLSQLEKQVENKKRSGAMEFRVSEKGGVS |
Ga0302222_100221781 | 3300028798 | Palsa | MSEPTYEELKAKLSQLEKEVETKKRSGDLIFKVGEK |
Ga0302154_105502011 | 3300028882 | Bog | MSEPSYEELKARLSQLEKEVEIKKRTGELIFKVGEKGGV |
Ga0311329_108759191 | 3300029907 | Bog | MAEPTYEELKAKLSQLEKEVETKKRSGDLIFKVGE |
Ga0302275_104728022 | 3300030518 | Bog | MTEPSYEELKARLADLEKQVDTKKKTGAMEFRVSEKGGV |
Ga0302309_102398431 | 3300030687 | Palsa | MTEPSYEELKARLADLEKQVETKKRSGAMEFRVSEK |
Ga0075404_112236222 | 3300030842 | Soil | MSEPSYEELKAQLEQAQKQLGAKKSGTLDFRVDEKGGV |
Ga0075388_115509562 | 3300030848 | Soil | MTEPTYEELKARLSDLEKQVETKKRSGVMEFRVSEKGGVS |
Ga0073994_119234972 | 3300030991 | Soil | MSEPSYEELKARLSQLEKEVEVKKRSGDLIFKVGEKGGVSV |
Ga0073994_120769271 | 3300030991 | Soil | MAEPSYEELKAKIAELEKKGSGRRTGALEFRVGEK |
Ga0302180_105734092 | 3300031028 | Palsa | MTEPSYEELKARLADLEKQVETKKKTGVIDFRVSEKGGVSVY |
Ga0170834_1094361771 | 3300031057 | Forest Soil | MAEPSYEELKARLAELEKQKPGHRTGQLDFRVGEKG |
Ga0170823_127445501 | 3300031128 | Forest Soil | MAEPSYEELKAKLAQLEKEVETKKRSGDLIFKVGEKGGVSVY |
Ga0265325_100796671 | 3300031241 | Rhizosphere | MTEPSYEELKARLQDLEKQVETKKRSGAMEFRVSEKGGV |
Ga0310915_112058941 | 3300031573 | Soil | MAEPTYDELKAKLAQLEKEVETKKRSGDLIFKVGEKGGVS |
Ga0310686_1159240691 | 3300031708 | Soil | MTEPSYEELKARLSQLEKEVETKKRSGDLIFKVGEKGGVSV |
Ga0307476_107220383 | 3300031715 | Hardwood Forest Soil | MSEPTYEELKARLSQLEKEVETKKRSGDLIFKVGEKGGVSV |
Ga0307477_104231031 | 3300031753 | Hardwood Forest Soil | MAEPSYEELKAKLAQLEKEVETKKRSGDLIFKVGEKG |
Ga0307475_113728202 | 3300031754 | Hardwood Forest Soil | MAEPTYEELKAKLAELEKQQGPRRTGSQEFRVGEK |
Ga0302319_105593861 | 3300031788 | Bog | MTEPSYEELKARLADLEKQVDTKKKTGAMEFRVSEK |
Ga0302319_106298172 | 3300031788 | Bog | MAEPSYEELKAKVAELEKQTQGRKRGSLDFKVSEK |
Ga0310917_102308063 | 3300031833 | Soil | MAEPTYDELKAKLAQLEKEVETKKRSGDLIFKVGEKGGV |
Ga0306921_112001611 | 3300031912 | Soil | MAEPSYEELKARVEELEKSQARKRGSLEFRVSEKGGLS |
Ga0310916_110450981 | 3300031942 | Soil | MAEPTYDELKAKLAQLEKEVETKKRSGDLIFKVGEKGG |
Ga0307479_100292254 | 3300031962 | Hardwood Forest Soil | MAEPSYEELKAKLAQLEKEVETKKRSGDLIFKVGEKGGVSV |
Ga0308176_116696982 | 3300031996 | Soil | MSEPSYDELKAKLAELEKQVAGKRSGNLDFRVSEKGAVS |
Ga0307472_1018748542 | 3300032205 | Hardwood Forest Soil | MAEPSYEELKAKLAQLEKEVETKKRSGDLIFKVGEKGGVS |
Ga0335079_113479542 | 3300032783 | Soil | MPEPSYDELKAKLAELEKQVQGRKRGVIDFKVSEKGGMSVY |
Ga0335080_108874262 | 3300032828 | Soil | MSEPTYEELKAKLAQMEKEKEGRRSGSLEFRVGEK |
Ga0334792_024282_3_107 | 3300033888 | Soil | MSEPTYEELKAKLSQLEKEVETKKRSGDLIFKVGE |
⦗Top⦘ |