| Basic Information | |
|---|---|
| Family ID | F054255 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 140 |
| Average Sequence Length | 39 residues |
| Representative Sequence | VKNVLLVNALLTILFLSDTYGGRVHDLRIAEATPYPLPA |
| Number of Associated Samples | 120 |
| Number of Associated Scaffolds | 140 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 10.79 % |
| % of genes near scaffold ends (potentially truncated) | 94.29 % |
| % of genes from short scaffolds (< 2000 bps) | 95.71 % |
| Associated GOLD sequencing projects | 116 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.429 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.571 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.429 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.429 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 40.30% β-sheet: 0.00% Coil/Unstructured: 59.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 140 Family Scaffolds |
|---|---|---|
| PF13613 | HTH_Tnp_4 | 55.71 |
| PF01609 | DDE_Tnp_1 | 4.29 |
| PF13359 | DDE_Tnp_4 | 4.29 |
| PF14104 | DUF4277 | 2.14 |
| PF00239 | Resolvase | 1.43 |
| PF12759 | HTH_Tnp_IS1 | 1.43 |
| PF07592 | DDE_Tnp_ISAZ013 | 1.43 |
| PF13586 | DDE_Tnp_1_2 | 0.71 |
| PF13267 | DUF4058 | 0.71 |
| PF03050 | DDE_Tnp_IS66 | 0.71 |
| PF00496 | SBP_bac_5 | 0.71 |
| PF05168 | HEPN | 0.71 |
| PF00296 | Bac_luciferase | 0.71 |
| PF00534 | Glycos_transf_1 | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 140 Family Scaffolds |
|---|---|---|---|
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 4.29 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 4.29 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 4.29 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 4.29 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 4.29 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 4.29 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 1.43 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 1.43 |
| COG1895 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.71 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.71 |
| COG2250 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.71 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.43 % |
| Unclassified | root | N/A | 3.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001686|C688J18823_10626890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 686 | Open in IMG/M |
| 3300005332|Ga0066388_100480962 | All Organisms → cellular organisms → Bacteria | 1880 | Open in IMG/M |
| 3300005445|Ga0070708_101962768 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300005467|Ga0070706_100180029 | All Organisms → cellular organisms → Bacteria | 1973 | Open in IMG/M |
| 3300005471|Ga0070698_100401734 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300005518|Ga0070699_101836017 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300005552|Ga0066701_10914865 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300005555|Ga0066692_10071334 | All Organisms → cellular organisms → Bacteria | 1993 | Open in IMG/M |
| 3300005568|Ga0066703_10442089 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300005598|Ga0066706_11189350 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300005617|Ga0068859_101253248 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300005719|Ga0068861_101330363 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300005764|Ga0066903_105950335 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300005764|Ga0066903_108689959 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300005981|Ga0081538_10197292 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 833 | Open in IMG/M |
| 3300006049|Ga0075417_10753261 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300006173|Ga0070716_101621938 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300006794|Ga0066658_10190424 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300006806|Ga0079220_10633780 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 768 | Open in IMG/M |
| 3300006846|Ga0075430_100781910 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300006880|Ga0075429_100263957 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
| 3300006969|Ga0075419_11524933 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300007076|Ga0075435_101469706 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300007258|Ga0099793_10130111 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
| 3300007258|Ga0099793_10324301 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300007265|Ga0099794_10484524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 650 | Open in IMG/M |
| 3300009038|Ga0099829_11594845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 538 | Open in IMG/M |
| 3300009081|Ga0105098_10404499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 678 | Open in IMG/M |
| 3300009089|Ga0099828_11746941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 547 | Open in IMG/M |
| 3300009090|Ga0099827_10346245 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300009090|Ga0099827_11102689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 689 | Open in IMG/M |
| 3300009094|Ga0111539_11808096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 708 | Open in IMG/M |
| 3300009098|Ga0105245_11150306 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300009100|Ga0075418_10298980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1716 | Open in IMG/M |
| 3300009137|Ga0066709_101505069 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300009137|Ga0066709_102570158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 683 | Open in IMG/M |
| 3300009147|Ga0114129_10080892 | All Organisms → cellular organisms → Bacteria | 4516 | Open in IMG/M |
| 3300009147|Ga0114129_10239082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2442 | Open in IMG/M |
| 3300009553|Ga0105249_10172455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales | 2099 | Open in IMG/M |
| 3300009792|Ga0126374_10946785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 671 | Open in IMG/M |
| 3300009792|Ga0126374_11592690 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300009793|Ga0105077_124409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 531 | Open in IMG/M |
| 3300009802|Ga0105073_1058442 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300009815|Ga0105070_1009198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 1612 | Open in IMG/M |
| 3300009815|Ga0105070_1068552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 673 | Open in IMG/M |
| 3300009818|Ga0105072_1059384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 735 | Open in IMG/M |
| 3300010041|Ga0126312_10743623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 709 | Open in IMG/M |
| 3300010043|Ga0126380_12111754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 518 | Open in IMG/M |
| 3300010047|Ga0126382_11046032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 719 | Open in IMG/M |
| 3300010047|Ga0126382_11336127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 650 | Open in IMG/M |
| 3300010047|Ga0126382_12236128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 527 | Open in IMG/M |
| 3300010322|Ga0134084_10233037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 658 | Open in IMG/M |
| 3300010359|Ga0126376_11727338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 662 | Open in IMG/M |
| 3300010362|Ga0126377_11135337 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300010366|Ga0126379_11300567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 833 | Open in IMG/M |
| 3300010366|Ga0126379_13128498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 554 | Open in IMG/M |
| 3300010398|Ga0126383_11229208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 839 | Open in IMG/M |
| 3300010398|Ga0126383_13492602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 513 | Open in IMG/M |
| 3300010400|Ga0134122_10943416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 839 | Open in IMG/M |
| 3300010863|Ga0124850_1109055 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300011415|Ga0137325_1146435 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300012096|Ga0137389_10718212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 859 | Open in IMG/M |
| 3300012189|Ga0137388_10982604 | Not Available | 779 | Open in IMG/M |
| 3300012199|Ga0137383_11087114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 579 | Open in IMG/M |
| 3300012202|Ga0137363_11266351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 625 | Open in IMG/M |
| 3300012203|Ga0137399_10278433 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
| 3300012205|Ga0137362_11167213 | Not Available | 654 | Open in IMG/M |
| 3300012206|Ga0137380_10664873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 906 | Open in IMG/M |
| 3300012206|Ga0137380_10744943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 848 | Open in IMG/M |
| 3300012206|Ga0137380_11255557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 626 | Open in IMG/M |
| 3300012210|Ga0137378_10212099 | All Organisms → cellular organisms → Bacteria | 1803 | Open in IMG/M |
| 3300012211|Ga0137377_11642080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 566 | Open in IMG/M |
| 3300012355|Ga0137369_11038327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 540 | Open in IMG/M |
| 3300012359|Ga0137385_10272759 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
| 3300012360|Ga0137375_11147124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 599 | Open in IMG/M |
| 3300012363|Ga0137390_12007688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 504 | Open in IMG/M |
| 3300012401|Ga0134055_1107844 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300012532|Ga0137373_11046645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 588 | Open in IMG/M |
| 3300012912|Ga0157306_10078166 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300012925|Ga0137419_10187698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Scytonemataceae → Scytonema → Scytonema tolypothrichoides | 1522 | Open in IMG/M |
| 3300012925|Ga0137419_11481643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 574 | Open in IMG/M |
| 3300012948|Ga0126375_11541914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 570 | Open in IMG/M |
| 3300015245|Ga0137409_10371668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacter → Desulfobacter postgatei | 1242 | Open in IMG/M |
| 3300015359|Ga0134085_10593703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 514 | Open in IMG/M |
| 3300015374|Ga0132255_106270910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 503 | Open in IMG/M |
| 3300016270|Ga0182036_11461503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 573 | Open in IMG/M |
| 3300016404|Ga0182037_10050257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Scytonemataceae → Scytonema → Scytonema tolypothrichoides | 2781 | Open in IMG/M |
| 3300016422|Ga0182039_11650471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 586 | Open in IMG/M |
| 3300017965|Ga0190266_11050563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 550 | Open in IMG/M |
| 3300018027|Ga0184605_10085298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1381 | Open in IMG/M |
| 3300018029|Ga0187787_10375506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 554 | Open in IMG/M |
| 3300018074|Ga0184640_10202519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 896 | Open in IMG/M |
| 3300018077|Ga0184633_10140176 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
| 3300018079|Ga0184627_10351122 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300018466|Ga0190268_10649942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 761 | Open in IMG/M |
| 3300018469|Ga0190270_13143057 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300025938|Ga0207704_11540909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 571 | Open in IMG/M |
| 3300025961|Ga0207712_10921707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 773 | Open in IMG/M |
| 3300026035|Ga0207703_11119904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 756 | Open in IMG/M |
| 3300026075|Ga0207708_10516910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1003 | Open in IMG/M |
| 3300026088|Ga0207641_12045789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 574 | Open in IMG/M |
| 3300026297|Ga0209237_1196174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 656 | Open in IMG/M |
| 3300026540|Ga0209376_1253750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 749 | Open in IMG/M |
| 3300027061|Ga0209729_1033062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 645 | Open in IMG/M |
| 3300027748|Ga0209689_1251974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 721 | Open in IMG/M |
| 3300027750|Ga0209461_10110669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 633 | Open in IMG/M |
| 3300027829|Ga0209773_10333828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 632 | Open in IMG/M |
| 3300027873|Ga0209814_10037424 | All Organisms → cellular organisms → Bacteria | 2013 | Open in IMG/M |
| 3300027874|Ga0209465_10122567 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300027874|Ga0209465_10286290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 825 | Open in IMG/M |
| 3300027909|Ga0209382_11067928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 836 | Open in IMG/M |
| 3300027909|Ga0209382_11244119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 758 | Open in IMG/M |
| 3300027948|Ga0209858_1007690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 816 | Open in IMG/M |
| 3300027954|Ga0209859_1039766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 776 | Open in IMG/M |
| 3300028381|Ga0268264_11359018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 721 | Open in IMG/M |
| 3300028589|Ga0247818_10743391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 682 | Open in IMG/M |
| 3300028792|Ga0307504_10123971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 850 | Open in IMG/M |
| 3300029999|Ga0311339_11274100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 668 | Open in IMG/M |
| 3300030006|Ga0299907_10653501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 811 | Open in IMG/M |
| 3300030904|Ga0308198_1031533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 759 | Open in IMG/M |
| 3300031092|Ga0308204_10108899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 774 | Open in IMG/M |
| 3300031093|Ga0308197_10090426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 886 | Open in IMG/M |
| 3300031114|Ga0308187_10399129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 543 | Open in IMG/M |
| 3300031228|Ga0299914_10798900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 787 | Open in IMG/M |
| 3300031731|Ga0307405_10775655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 801 | Open in IMG/M |
| 3300031833|Ga0310917_10792595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 640 | Open in IMG/M |
| 3300031890|Ga0306925_10236205 | Not Available | 1971 | Open in IMG/M |
| 3300031890|Ga0306925_10683165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1076 | Open in IMG/M |
| 3300031890|Ga0306925_10959045 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300031910|Ga0306923_12080400 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300031942|Ga0310916_11194704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 629 | Open in IMG/M |
| 3300031954|Ga0306926_12497078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 567 | Open in IMG/M |
| 3300032035|Ga0310911_10644542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 614 | Open in IMG/M |
| 3300032035|Ga0310911_10833234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 533 | Open in IMG/M |
| 3300032080|Ga0326721_11063786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 520 | Open in IMG/M |
| 3300032126|Ga0307415_100807672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 857 | Open in IMG/M |
| 3300032205|Ga0307472_100883814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 826 | Open in IMG/M |
| 3300032261|Ga0306920_102697754 | Not Available | 679 | Open in IMG/M |
| 3300034178|Ga0364934_0213176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 732 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.57% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.29% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.00% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 5.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.57% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.14% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.14% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.43% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.71% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.71% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.71% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.71% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.71% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.71% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.71% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.71% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.71% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.71% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.71% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009793 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 | Environmental | Open in IMG/M |
| 3300009802 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 | Environmental | Open in IMG/M |
| 3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011415 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012401 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027061 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027948 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027954 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030904 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032080 | Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J18823_106268901 | 3300001686 | Soil | LVNAPLIILFLSDTVGGRLHDKRLAEPYPLPAGSRLLQDLG |
| Ga0066388_1004809623 | 3300005332 | Tropical Forest Soil | VLLVNALLLILFLSDTYGGRVHDKRIADATPYPLPAKSR* |
| Ga0066388_1022473161 | 3300005332 | Tropical Forest Soil | VLRVKALLAILFLSDTYGGRTHDKRIAEATTYPLPAGSRLLQDPRVIAPS* |
| Ga0070708_1019627682 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MAFPTAIKNILLVNALLIILFLNETAGGRLHDKRLAEATPYP |
| Ga0070706_1001800294 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VLLVNALLMILFLSDTHGGRVHDLRIAETTPYPLPAGSGL |
| Ga0070698_1004017341 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VKNVLLVNALLIILFLSATHGGRVHDLRIAEATPYPLPAG |
| Ga0070699_1018360171 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VKHVLLANALLTILFLSETFGGRIHEKRMADATPYPLPAG |
| Ga0066701_109148652 | 3300005552 | Soil | VNALLTILFLSATYGGRVHDKPIAATTPYPLPAGSRLLQDLGF |
| Ga0066692_100713341 | 3300005555 | Soil | LLVNALLLILFLSDTHGGRVHDLRIAEATPYPLPAGSQREVS* |
| Ga0066703_104420891 | 3300005568 | Soil | KNVLLVNALLTILFLSGTYGGRVHDKRIADATPYPLPARSRL* |
| Ga0066706_111893501 | 3300005598 | Soil | VNALLIILFLSDTYGGRIHDKPIADATPYPLPVGS |
| Ga0068859_1012532481 | 3300005617 | Switchgrass Rhizosphere | LLLILFLSDTHGGRVHDLRIAETTPYPLPAGSGLLQPTFKG* |
| Ga0068861_1013303632 | 3300005719 | Switchgrass Rhizosphere | LINALLRILLLSDTYGGRTHDLRIAEATPYPLPAGSGLLQ |
| Ga0066903_1059503351 | 3300005764 | Tropical Forest Soil | VKNVLLVNALLVILLLSDTHGGRTHDLRIAEATPYPLP |
| Ga0066903_1086899592 | 3300005764 | Tropical Forest Soil | VKNVLLVNALLVILFLSDTHGGRTHDLRIAEATPY |
| Ga0081538_101972921 | 3300005981 | Tabebuia Heterophylla Rhizosphere | VLLINAALTILFLSETYAGSTHDKRIAEATPYPLPPGSR |
| Ga0075417_107532611 | 3300006049 | Populus Rhizosphere | VNALLTILFLSDTYGGRVHDLRIAEATPYPLPAGSGLLQ |
| Ga0070716_1016219382 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VKNVLLVNALLLILFLSDTYGGRTHDLRIAEATPYP |
| Ga0066658_101904242 | 3300006794 | Soil | VKNVLLVNALLLILFLSDTYGGRTHDKRIADATP* |
| Ga0079220_106337801 | 3300006806 | Agricultural Soil | VLIILFLSDTVGGRIHDKRLAEPYPLPAGSRLLQD |
| Ga0075430_1007819102 | 3300006846 | Populus Rhizosphere | VIKSTLLTILFRSDTYGGRVHEKPIADATPYPLPA |
| Ga0075429_1002639572 | 3300006880 | Populus Rhizosphere | VNALLLLLFLSATHGGRVHDRRIAEAPLPHMHEAITY* |
| Ga0075419_115249331 | 3300006969 | Populus Rhizosphere | VNALLTILFLSDTYGGRTHDLRIAEATPYPLPAGSGLLQD |
| Ga0075435_1014697063 | 3300007076 | Populus Rhizosphere | LLVNALLTILFLSATYGGRVHDLRIAEATPYPLPAGSG* |
| Ga0099793_101301113 | 3300007258 | Vadose Zone Soil | VNALLLILFLSDTYGGRTHDKPIADATPYPLPAGSG |
| Ga0099793_103243012 | 3300007258 | Vadose Zone Soil | LVKPEKNVLLVNTPLTILLLSDTYGGRVHDLRIAEATPYPLPAGSGLLQD |
| Ga0099794_104845241 | 3300007265 | Vadose Zone Soil | VHALLIILFLSDTYGGRIHEKPMADATPYPLPAGSW |
| Ga0099829_115948452 | 3300009038 | Vadose Zone Soil | VNALLIILFLSDTYGGRVHDKPIADATPYPLPAGS |
| Ga0105098_104044991 | 3300009081 | Freshwater Sediment | VKPVFRIHAALTLLFRSDTYAGSTHDKRMAEATPYPWPTGSR |
| Ga0099828_117469412 | 3300009089 | Vadose Zone Soil | VNALLLILFLSDTYGGRIHEKPMADATPSPLPAGSRLLQ |
| Ga0099827_103462451 | 3300009090 | Vadose Zone Soil | VNALLIILFLSDTYGGRVHDKPIADATPYPLPAGSR |
| Ga0099827_111026891 | 3300009090 | Vadose Zone Soil | VNALLTILFLSATHGGRVHDKRIAEATPYPLPAGS |
| Ga0111539_118080962 | 3300009094 | Populus Rhizosphere | VKNVLLVNALLLILFLSDTYGGRTHDKLIADATPY |
| Ga0105245_111503061 | 3300009098 | Miscanthus Rhizosphere | ALLLLLFLSATHGGRVHDRRIAEAPLPHMHEAITY* |
| Ga0075418_102989801 | 3300009100 | Populus Rhizosphere | KDNTVKNVLLVNALLTILFLSATYGGRVHDLRIAEATPYPPYAPG* |
| Ga0066709_1015050691 | 3300009137 | Grasslands Soil | VKNVLLINAPLTILFLSATEPGRMHDKRLADATPYP |
| Ga0066709_1025701581 | 3300009137 | Grasslands Soil | VNALLIILCLSDTYGGRVHDKPIADATPYPLPAGSRLLQDLGFLA |
| Ga0114129_100808921 | 3300009147 | Populus Rhizosphere | VNALLTILFLSDTYGGRVHDKRIADATPYPLPARSRLL |
| Ga0114129_102390823 | 3300009147 | Populus Rhizosphere | VKNVRLVNASLTILFLSDTYGGRVHDKRIAEATPYPFSGCA* |
| Ga0105249_101724552 | 3300009553 | Switchgrass Rhizosphere | VKNVLLVNALLLILFLRDTYGGRVHDKRIADATPYPLPAQSRL* |
| Ga0126374_109467852 | 3300009792 | Tropical Forest Soil | VKNVLLVNALLLILFLSDTYGGRVHDLRIAEATPYPLP |
| Ga0126374_115926901 | 3300009792 | Tropical Forest Soil | KKDHTVKKVLLVKALLLILFLSDTYGGRTHEKSIADVTPSPLPAGS* |
| Ga0105077_1244092 | 3300009793 | Groundwater Sand | VNALLLIFFLSDTYGGRTHDKPIADATPYPLPAGSRLLQDLG |
| Ga0105073_10584422 | 3300009802 | Groundwater Sand | VKNVLLINAPLTILFLSETHGGRVHDKRIAEATHYPLPA |
| Ga0105070_10091981 | 3300009815 | Groundwater Sand | KCHTVKNVLLINAALTILFLRDPYAGSVHDKRSAATTP* |
| Ga0105070_10685522 | 3300009815 | Groundwater Sand | VKNVLLVNAPLTILFLSETAGGRVHDKRLAEATPYPLPAGS |
| Ga0105072_10593842 | 3300009818 | Groundwater Sand | VNALLIVLFLSDTYGGRIHEKPIAAATPYPLPAGSR |
| Ga0126312_107436231 | 3300010041 | Serpentine Soil | VKHVPLINAALLILLLSDPSPASPHDKRMAEATPYPLT |
| Ga0126380_121117541 | 3300010043 | Tropical Forest Soil | VKNVLLVNALLVILFLSDTHGGRTHDLRIAEATPYP |
| Ga0126382_110460322 | 3300010047 | Tropical Forest Soil | VKNVLLVNALLLILFLSDTHGGRTHDLRIAEATPYPPFAPG* |
| Ga0126382_113361272 | 3300010047 | Tropical Forest Soil | VKNVLLVNTLLVILFLSDTHGGRVHDLRIAEATPY |
| Ga0126382_122361281 | 3300010047 | Tropical Forest Soil | VKNVLLVNAPLTILFLSETHGGRVHEKRIAEATPYPLPAGS |
| Ga0134084_102330371 | 3300010322 | Grasslands Soil | VNALLIILFLSDTSGGRVHDKPIADTTPYPLPPGSRL |
| Ga0126376_117273381 | 3300010359 | Tropical Forest Soil | VKNVLLVNALLTILFLSATHGGRTHDLRIAEATPYPLP |
| Ga0126377_111353373 | 3300010362 | Tropical Forest Soil | HTVKNGLLVNPLLLILLLSDPYGGRTHAKRIAEATPSP* |
| Ga0126379_113005672 | 3300010366 | Tropical Forest Soil | VNALLTILFLSDTYGGRVHDLRIAEATPYPLPARSRLL |
| Ga0126379_131284981 | 3300010366 | Tropical Forest Soil | LLVNALLVILFLSDTHGGRTHDLRIAEATPYPLPAGSGLLQ |
| Ga0126383_112292081 | 3300010398 | Tropical Forest Soil | VLLINAGLTILFLSGTYAGSTHDKRIADATPYPLPA |
| Ga0126383_134926021 | 3300010398 | Tropical Forest Soil | VKNVLLVNALLVILFLSDTHGGRVHDLRIAEATPYPL |
| Ga0134122_109434162 | 3300010400 | Terrestrial Soil | VKNVLLVNAPLTILLLSETHGGRGHDKRIAEATPYP |
| Ga0124850_11090551 | 3300010863 | Tropical Forest Soil | LLINALLTILFLSDTYAGRVHEKRIAEATPYPLPAGSRLL* |
| Ga0137325_11464351 | 3300011415 | Soil | VLLGLFLSETYGGRIHDKRIAEATPYPLPAGSRLLQDLGFL |
| Ga0137389_107182121 | 3300012096 | Vadose Zone Soil | VNNVLLVHALLTILFLSATHGGRVHDTRIAEATPYP |
| Ga0137388_109826041 | 3300012189 | Vadose Zone Soil | KKKDHTVKNLLLVNAPLTVLFLSATHGDRVHDLRIAAATPYL* |
| Ga0137383_110871141 | 3300012199 | Vadose Zone Soil | VKNVLLVHTLLTLLFLSATYGGRVHDKRIAEATPYPLPAGSRLL* |
| Ga0137363_112663512 | 3300012202 | Vadose Zone Soil | VRLINAALTILLLRETSAGSTHDKRIADANPYPLP |
| Ga0137399_102784331 | 3300012203 | Vadose Zone Soil | LRDNSNATLRIVFLSETAPGSVHDKRLADTTPYPLP |
| Ga0137362_111672131 | 3300012205 | Vadose Zone Soil | VKNVLLVNALLTILFLSATHGGRVHDKRIVEATPYPLPAGSRLLQDL |
| Ga0137380_106648731 | 3300012206 | Vadose Zone Soil | VLLVNALLLILLLSDTYGGRVHDKRMAAATPYPLPAGRGLL |
| Ga0137380_107449431 | 3300012206 | Vadose Zone Soil | VKNVLLVHTLLTLLFLSATYGGRVHDKRIAEATPYPLPAG |
| Ga0137380_112555572 | 3300012206 | Vadose Zone Soil | MVKTVRLINTVLTILLLSETYAGSTQDTRMADATPYPWPAGSRLL |
| Ga0137378_102120991 | 3300012210 | Vadose Zone Soil | NVLLVNALLIILFLSDTSGGRIHDKRMAEATPYPHKRQDKL* |
| Ga0137377_116420801 | 3300012211 | Vadose Zone Soil | VNALLTILFLSDTYGGRVHDLRLAEVTPYPLPAGSGL |
| Ga0137369_110383272 | 3300012355 | Vadose Zone Soil | VKNVLLVNALLIILFLSDTYGGRSHDKRIAEATPY |
| Ga0137385_102727591 | 3300012359 | Vadose Zone Soil | VKNVLLVNTLLTILFLSATYGGRVHDKRIAEATPYPLPAGSRLLQ |
| Ga0137375_111471241 | 3300012360 | Vadose Zone Soil | VKNVLLVNALLTILFLSDTCGGRVHDKRIADMTPSPLPA |
| Ga0137390_120076881 | 3300012363 | Vadose Zone Soil | VNALLVILFLSDTHGGRVHDLRIAETTPYPLPAGRG |
| Ga0134055_11078442 | 3300012401 | Grasslands Soil | VKNVLLVNALLIILFLSDTYGGRSHDKRIAEATP* |
| Ga0137373_110466451 | 3300012532 | Vadose Zone Soil | VNALLLILFLSDTYGGRVHDKPIADATPSPLPAGSR |
| Ga0157306_100781663 | 3300012912 | Soil | VKNILLVNAPLMILFLSETAGGRVHDKRLAEATPYPLPA |
| Ga0137419_101876983 | 3300012925 | Vadose Zone Soil | LVNALLTVLFLSDTYGGRVHDLRIAEATPYPLPLTGVGFL* |
| Ga0137419_114816431 | 3300012925 | Vadose Zone Soil | KDHTVKNVLLVNTLLVILFLSDTYGGRVHDLRIAEATGK* |
| Ga0126375_115419141 | 3300012948 | Tropical Forest Soil | VKNVLLINAVLTILFLSETYAGSTHDKRIADATPYP |
| Ga0137409_103716681 | 3300015245 | Vadose Zone Soil | VHARLLILFLSDTYGGRLHEKPLADETPSPWPAGSRLLQD |
| Ga0134085_105937032 | 3300015359 | Grasslands Soil | VNALLIILFLSDTYGGRIHDKPIADATPSPLPAGS |
| Ga0132255_1062709102 | 3300015374 | Arabidopsis Rhizosphere | VKNVLLVNAWLLILFLSNTYGGRTHDKRIADATPYPLPAGS |
| Ga0182036_114615031 | 3300016270 | Soil | VKNVLLVNALLTILFLSDTHSGRTHELRIAEATPYPLPV |
| Ga0182037_100502571 | 3300016404 | Soil | LLVILFLSDTHGGRTHDLRIAEATPHPLPASEKEVFS |
| Ga0182039_116504712 | 3300016422 | Soil | VNALLLILFLSDTYGGRVHDKRIADATPYPLPAGS |
| Ga0190266_110505631 | 3300017965 | Soil | VNALLTILFLSDTYGGRVHDLRIAEATPYPLPAGS |
| Ga0184605_100852981 | 3300018027 | Groundwater Sediment | NVLLVNALLIILFLSDTHGGRTHDLRIAETTPYPP |
| Ga0187787_103755061 | 3300018029 | Tropical Peatland | VKNVLLVNALLTILFLSETYGGRTHDLRIAEATPYPLPAGS |
| Ga0184640_102025192 | 3300018074 | Groundwater Sediment | VLLINAVLTILFLSETYAGSTHDKRIADATPYPLPA |
| Ga0184633_101401762 | 3300018077 | Groundwater Sediment | VKTVWLINAALTVLLLSDTYAGSTHDTRMADATPYP |
| Ga0184627_103511222 | 3300018079 | Groundwater Sediment | VLLINAALTILFLSETYAGSTHDKRIADATPYPLPA |
| Ga0190268_106499421 | 3300018466 | Soil | VKHVLLINAALTILFLRATYAGSTHDKRIADATPYPL |
| Ga0190270_131430571 | 3300018469 | Soil | VKNVLLINAALAILCLRETSAGRTHDPRMADATPDPLPAGSR |
| Ga0207704_115409091 | 3300025938 | Miscanthus Rhizosphere | VKNVLLVNALLIILFLSETHGGRTHDLRIAEATPYPLPAGRGLL |
| Ga0207712_109217072 | 3300025961 | Switchgrass Rhizosphere | VKNVLLVNALLLILFLRDTYGGRVHDKRIADATPYPLPAQSR |
| Ga0207703_111199041 | 3300026035 | Switchgrass Rhizosphere | VKNVLLVNALLIILFLSDTYGGRVHDLRIAEATPYP |
| Ga0207708_105169103 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | NTLLLILFLSDTHGGRVHDLRIAETTPYPLPAGSGLLQPTFKG |
| Ga0207641_120457892 | 3300026088 | Switchgrass Rhizosphere | VKNVLLVNALLTILFLSDTYGGRVHDKRIADATPY |
| Ga0209237_11961742 | 3300026297 | Grasslands Soil | VKNVLLVNTLLTILFLSATYGGRVHDKRIAEATPYPLPAG |
| Ga0209376_12537502 | 3300026540 | Soil | VNALLIILFLSDTYGGRVHDKPMADATPYPLPAGS |
| Ga0209729_10330621 | 3300027061 | Forest Soil | VKHVLLSNAALTSLLLSDTYAGSTHDQRMADTTPYPL |
| Ga0209689_12519742 | 3300027748 | Soil | VLLVNTLLLILFLSDTYGGRVHDKQIADATPYPLPAQ |
| Ga0209461_101106691 | 3300027750 | Agave | VNALLLILFLSDTYGGRMHDLRIAEATPYPLPAGSGLLQDL |
| Ga0209773_103338281 | 3300027829 | Bog Forest Soil | VLLVNAPLIILFLSETTGGRVHDKTIAASTPYPLPAGS |
| Ga0209814_100374244 | 3300027873 | Populus Rhizosphere | VNALLTILFLSDTYGGHTHDLRIAEATPYPLPAGSGL |
| Ga0209465_101225671 | 3300027874 | Tropical Forest Soil | LLAILFLSDTYGGRTHDKRIAEATTYPLPAGSRLLQDPRVIAPS |
| Ga0209465_102862903 | 3300027874 | Tropical Forest Soil | VKNVLLVNALLTILFLSDTYGGRVHDLRIAEATPYPLPA |
| Ga0209382_110679282 | 3300027909 | Populus Rhizosphere | VKNVLLVNALLLILFLSATHGGRVHDLRIAEATPYPLPAGSQ |
| Ga0209382_112441191 | 3300027909 | Populus Rhizosphere | VLLINALLTLLFLSATSVGSTHDQRMADATPYPLPAGSLLLQD |
| Ga0209858_10076901 | 3300027948 | Groundwater Sand | MILFLSATYGGRIHEKRIAEATPSPLPAGSRLLQD |
| Ga0209859_10397661 | 3300027954 | Groundwater Sand | VNALLLILFLSDTYGGRVHDKPIADATPYPLPAGS |
| Ga0268264_113590181 | 3300028381 | Switchgrass Rhizosphere | LVNTLLLILFLSDTHGGRVHDLRIAETTPYPLPAGSGLLQPTFKG |
| Ga0247818_107433911 | 3300028589 | Soil | VKNVLLVNAPLTILFLSETHGGRVHDLRIAEATPY |
| Ga0307504_101239712 | 3300028792 | Soil | VNTPLTILFLSETYGGRVHDLRIAEATPYPLPAGSGLLQ |
| Ga0311339_112741002 | 3300029999 | Palsa | VKDVLLVNAPLNFLFLSATVGGHVHDKRIADATPYPLPTGSRLL |
| Ga0299907_106535012 | 3300030006 | Soil | VKNVLLVDAPLTILFLSATHGGRVHDKRIAEATPYPLPAGSRLLQD |
| Ga0308198_10315331 | 3300030904 | Soil | VNALLIILCLSDTYAGRVHDKRIAEATPYPLPSGSRLLQDL |
| Ga0308204_101088991 | 3300031092 | Soil | VKNVLLVNAPLTILFLSDTRGGRVHDKRIAEATPYP |
| Ga0308197_100904263 | 3300031093 | Soil | VNALLIILCLSDTYAGRVHDKRIAAATPYPLPSGSRLLQDLGF |
| Ga0308187_103991292 | 3300031114 | Soil | VTNVLLINAALMILLLSETYAGSTHDQRIADTTPYPL |
| Ga0299914_107989001 | 3300031228 | Soil | VKNVLLVDAPLTILFLSNTYGGRTHDKRIADATPY |
| Ga0307405_107756552 | 3300031731 | Rhizosphere | VKNLLLVNAALTIIFLSETYHGSTHDKRIADGAPYPLPA |
| Ga0310917_107925951 | 3300031833 | Soil | VNAQLIILFLSDTYDGRVHDLRIAEATPYPLPAGSG |
| Ga0306925_102362051 | 3300031890 | Soil | MTNGDTVKNVLRVHALLTILFLSATYCGRVHDKRIADATPYPL |
| Ga0306925_106831653 | 3300031890 | Soil | VKNVLLVNALLLILFLSDTYGGRTHDKPIADATPY |
| Ga0306925_109590451 | 3300031890 | Soil | VNALLIILFLSDTYGGHIHDKPIADATPYPLPAGS |
| Ga0306923_120804002 | 3300031910 | Soil | MTNGDTVKNVLRVHALLTILFLSATYCGRVHDKRIADATPYPLPA |
| Ga0310916_111947041 | 3300031942 | Soil | VKNVLLVNALLVILFLSDTHGGRVHDLRIAEATPSPLPAGSGLL |
| Ga0306926_124970782 | 3300031954 | Soil | VNALLLILFLSDTYGGRAHDKRIADTTPYPLPARS |
| Ga0310911_106445422 | 3300032035 | Soil | VKNVLLVNALLVILFLSDTHGGRVHDLRIAEATPSPL |
| Ga0310911_108332341 | 3300032035 | Soil | VKNVLLVNAPLISLFLSATHGGRVHDLRIAEATPSPLPAGSHL |
| Ga0326721_110637861 | 3300032080 | Soil | VLIILFLSDTVGGRIHDKRLAEATPYPLPAGSRLL |
| Ga0307415_1008076722 | 3300032126 | Rhizosphere | VKNVLLINAALTILFLSDTSAGSVHDTRLADSTPS |
| Ga0307472_1008838142 | 3300032205 | Hardwood Forest Soil | VLLINAALTILFLSETYVGRTHDQRMADATPDPLP |
| Ga0306920_1026977542 | 3300032261 | Soil | VKNALLVKALLTILFLSDTYGGRVHDKRIAAAPPYP |
| Ga0364934_0213176_2_118 | 3300034178 | Sediment | VLLINAALTILFLSETYAGSTHDTRMADANPYPLPPGSR |
| ⦗Top⦘ |