| Basic Information | |
|---|---|
| Family ID | F054203 |
| Family Type | Metagenome |
| Number of Sequences | 140 |
| Average Sequence Length | 46 residues |
| Representative Sequence | METCFAESHAAAVKHNVITIEKAMGMIKRYLQLTTVMAAKQRANA |
| Number of Associated Samples | 123 |
| Number of Associated Scaffolds | 140 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 78.42 % |
| % of genes near scaffold ends (potentially truncated) | 97.86 % |
| % of genes from short scaffolds (< 2000 bps) | 90.71 % |
| Associated GOLD sequencing projects | 117 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.857 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (21.429 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.714 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.714 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.90% β-sheet: 0.00% Coil/Unstructured: 41.10% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 140 Family Scaffolds |
|---|---|---|
| PF13366 | PDDEXK_3 | 2.14 |
| PF07043 | DUF1328 | 2.14 |
| PF08241 | Methyltransf_11 | 1.43 |
| PF12900 | Pyridox_ox_2 | 1.43 |
| PF01554 | MatE | 1.43 |
| PF01850 | PIN | 1.43 |
| PF07238 | PilZ | 1.43 |
| PF06071 | YchF-GTPase_C | 1.43 |
| PF02548 | Pantoate_transf | 1.43 |
| PF05995 | CDO_I | 1.43 |
| PF01872 | RibD_C | 0.71 |
| PF01590 | GAF | 0.71 |
| PF00999 | Na_H_Exchanger | 0.71 |
| PF01255 | Prenyltransf | 0.71 |
| PF00480 | ROK | 0.71 |
| PF14534 | DUF4440 | 0.71 |
| PF00324 | AA_permease | 0.71 |
| PF08681 | DUF1778 | 0.71 |
| PF01695 | IstB_IS21 | 0.71 |
| PF00285 | Citrate_synt | 0.71 |
| PF01336 | tRNA_anti-codon | 0.71 |
| PF00430 | ATP-synt_B | 0.71 |
| PF03169 | OPT | 0.71 |
| PF01061 | ABC2_membrane | 0.71 |
| PF00926 | DHBP_synthase | 0.71 |
| PF00069 | Pkinase | 0.71 |
| PF12704 | MacB_PCD | 0.71 |
| PF02687 | FtsX | 0.71 |
| PF12850 | Metallophos_2 | 0.71 |
| PF01192 | RNA_pol_Rpb6 | 0.71 |
| PF00121 | TIM | 0.71 |
| PF00218 | IGPS | 0.71 |
| PF14026 | DUF4242 | 0.71 |
| PF10397 | ADSL_C | 0.71 |
| PF09970 | DUF2204 | 0.71 |
| PF01663 | Phosphodiest | 0.71 |
| PF00171 | Aldedh | 0.71 |
| PF01370 | Epimerase | 0.71 |
| PF09948 | DUF2182 | 0.71 |
| PF02348 | CTP_transf_3 | 0.71 |
| PF14520 | HHH_5 | 0.71 |
| PF00072 | Response_reg | 0.71 |
| PF00106 | adh_short | 0.71 |
| PF10459 | Peptidase_S46 | 0.71 |
| PF04674 | Phi_1 | 0.71 |
| PF04357 | TamB | 0.71 |
| PF05690 | ThiG | 0.71 |
| PF07635 | PSCyt1 | 0.71 |
| PF08544 | GHMP_kinases_C | 0.71 |
| PF12680 | SnoaL_2 | 0.71 |
| PF01401 | Peptidase_M2 | 0.71 |
| PF04879 | Molybdop_Fe4S4 | 0.71 |
| PF00440 | TetR_N | 0.71 |
| PF07786 | HGSNAT_cat | 0.71 |
| PF01926 | MMR_HSR1 | 0.71 |
| PF11138 | DUF2911 | 0.71 |
| PF13570 | PQQ_3 | 0.71 |
| PF07992 | Pyr_redox_2 | 0.71 |
| PF13507 | GATase_5 | 0.71 |
| PF11570 | E2R135 | 0.71 |
| PF14559 | TPR_19 | 0.71 |
| PF02954 | HTH_8 | 0.71 |
| PF08450 | SGL | 0.71 |
| PF01740 | STAS | 0.71 |
| PF01595 | CNNM | 0.71 |
| PF06537 | DHOR | 0.71 |
| PF01916 | DS | 0.71 |
| PF00160 | Pro_isomerase | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 140 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.86 |
| COG5487 | Uncharacterized membrane protein YtjA, UPF0391 family | Function unknown [S] | 2.14 |
| COG5553 | Predicted metal-dependent enzyme of the double-stranded beta helix superfamily | General function prediction only [R] | 1.43 |
| COG0012 | Ribosome-binding ATPase YchF, GTP1/OBG family | Translation, ribosomal structure and biogenesis [J] | 1.43 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.43 |
| COG0413 | Ketopantoate hydroxymethyltransferase | Coenzyme transport and metabolism [H] | 1.43 |
| COG1758 | DNA-directed RNA polymerase, subunit K/omega | Transcription [K] | 0.71 |
| COG1212 | CMP-2-keto-3-deoxyoctulosonic acid synthetase | Cell wall/membrane/envelope biogenesis [M] | 0.71 |
| COG1861 | Spore coat polysaccharide biosynthesis protein SpsF, cytidylyltransferase family | Cell wall/membrane/envelope biogenesis [M] | 0.71 |
| COG1899 | Deoxyhypusine synthase | Translation, ribosomal structure and biogenesis [J] | 0.71 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.71 |
| COG2022 | Thiazole synthase ThiGH, ThiG subunit (thiamin biosynthesis) | Coenzyme transport and metabolism [H] | 0.71 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.71 |
| COG2911 | Phospholipid transport to the outer membrane protein TamB | Cell wall/membrane/envelope biogenesis [M] | 0.71 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.71 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.71 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.71 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.71 |
| COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 0.71 |
| COG3503 | Uncharacterized membrane protein, DUF1624 family | Function unknown [S] | 0.71 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.71 |
| COG4453 | Uncharacterized conserved protein, DUF1778 family | Function unknown [S] | 0.71 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.71 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.71 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.71 |
| COG0020 | Undecaprenyl pyrophosphate synthase | Lipid transport and metabolism [I] | 0.71 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.71 |
| COG0108 | 3,4-dihydroxy-2-butanone 4-phosphate synthase | Coenzyme transport and metabolism [H] | 0.71 |
| COG0134 | Indole-3-glycerol phosphate synthase | Amino acid transport and metabolism [E] | 0.71 |
| COG0149 | Triosephosphate isomerase | Carbohydrate transport and metabolism [G] | 0.71 |
| COG0214 | Pyridoxal 5'-phosphate synthase subunit PdxS | Coenzyme transport and metabolism [H] | 0.71 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.71 |
| COG0372 | Citrate synthase | Energy production and conversion [C] | 0.71 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.71 |
| COG0531 | Serine transporter YbeC, amino acid:H+ symporter family | Amino acid transport and metabolism [E] | 0.71 |
| COG0652 | Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family | Posttranslational modification, protein turnover, chaperones [O] | 0.71 |
| COG0711 | FoF1-type ATP synthase, membrane subunit b or b' | Energy production and conversion [C] | 0.71 |
| COG0833 | Amino acid permease | Amino acid transport and metabolism [E] | 0.71 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.71 |
| COG1083 | CMP-N-acetylneuraminic acid synthetase, NeuA/PseF family | Cell wall/membrane/envelope biogenesis [M] | 0.71 |
| COG1113 | L-asparagine transporter or related permease | Amino acid transport and metabolism [E] | 0.71 |
| COG1115 | Na+/alanine symporter | Amino acid transport and metabolism [E] | 0.71 |
| COG1297 | Predicted oligopeptide transporter, OPT family | General function prediction only [R] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.86 % |
| Unclassified | root | N/A | 17.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10213340 | Not Available | 648 | Open in IMG/M |
| 3300001356|JGI12269J14319_10147434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1016 | Open in IMG/M |
| 3300001545|JGI12630J15595_10049798 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300001867|JGI12627J18819_10089652 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101469621 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300004082|Ga0062384_101097575 | Not Available | 574 | Open in IMG/M |
| 3300004152|Ga0062386_100434075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1061 | Open in IMG/M |
| 3300005171|Ga0066677_10650885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300005177|Ga0066690_10693877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300005343|Ga0070687_101240444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300005435|Ga0070714_100821637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 901 | Open in IMG/M |
| 3300005454|Ga0066687_10507932 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300005458|Ga0070681_11545593 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300005534|Ga0070735_10861480 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300005569|Ga0066705_10735869 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300005610|Ga0070763_10346504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 826 | Open in IMG/M |
| 3300005843|Ga0068860_102634060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300006028|Ga0070717_10095083 | All Organisms → cellular organisms → Bacteria | 2522 | Open in IMG/M |
| 3300006050|Ga0075028_100872422 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300006176|Ga0070765_100135612 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2178 | Open in IMG/M |
| 3300006176|Ga0070765_100611166 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300006804|Ga0079221_10525107 | Not Available | 776 | Open in IMG/M |
| 3300006893|Ga0073928_10955607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300007255|Ga0099791_10607991 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 535 | Open in IMG/M |
| 3300007258|Ga0099793_10049029 | All Organisms → cellular organisms → Bacteria | 1856 | Open in IMG/M |
| 3300009012|Ga0066710_104652262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300009038|Ga0099829_10312833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1289 | Open in IMG/M |
| 3300009089|Ga0099828_11676481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
| 3300009143|Ga0099792_10068220 | All Organisms → cellular organisms → Bacteria | 1786 | Open in IMG/M |
| 3300009521|Ga0116222_1490146 | Not Available | 538 | Open in IMG/M |
| 3300009522|Ga0116218_1418479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300009523|Ga0116221_1490879 | Not Available | 538 | Open in IMG/M |
| 3300009524|Ga0116225_1483548 | Not Available | 550 | Open in IMG/M |
| 3300009525|Ga0116220_10330899 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300009525|Ga0116220_10453493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300009698|Ga0116216_10114973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1656 | Open in IMG/M |
| 3300009698|Ga0116216_10955224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 512 | Open in IMG/M |
| 3300009792|Ga0126374_10876727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 693 | Open in IMG/M |
| 3300009839|Ga0116223_10857467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300010366|Ga0126379_13127529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300010375|Ga0105239_10850204 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300010376|Ga0126381_102334616 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300010379|Ga0136449_101867885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 895 | Open in IMG/M |
| 3300011269|Ga0137392_10463046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1053 | Open in IMG/M |
| 3300011270|Ga0137391_11233382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300011271|Ga0137393_10281021 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300012096|Ga0137389_10692441 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300012198|Ga0137364_11432254 | Not Available | 511 | Open in IMG/M |
| 3300012199|Ga0137383_11004846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300012200|Ga0137382_10497337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 866 | Open in IMG/M |
| 3300012200|Ga0137382_11166670 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300012202|Ga0137363_10450442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1077 | Open in IMG/M |
| 3300012202|Ga0137363_11809265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 503 | Open in IMG/M |
| 3300012203|Ga0137399_10018133 | All Organisms → cellular organisms → Bacteria | 4522 | Open in IMG/M |
| 3300012207|Ga0137381_11618427 | Not Available | 538 | Open in IMG/M |
| 3300012361|Ga0137360_10718450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 858 | Open in IMG/M |
| 3300012361|Ga0137360_11165635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 666 | Open in IMG/M |
| 3300012480|Ga0157346_1015489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300012495|Ga0157323_1023783 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300012922|Ga0137394_11125834 | Not Available | 649 | Open in IMG/M |
| 3300012922|Ga0137394_11146620 | Not Available | 641 | Open in IMG/M |
| 3300012923|Ga0137359_10300182 | All Organisms → cellular organisms → Bacteria | 1430 | Open in IMG/M |
| 3300012924|Ga0137413_10137104 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
| 3300012927|Ga0137416_10749868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 860 | Open in IMG/M |
| 3300012929|Ga0137404_10424326 | Not Available | 1176 | Open in IMG/M |
| 3300012929|Ga0137404_10863686 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300012929|Ga0137404_11161038 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300012929|Ga0137404_11316028 | Not Available | 666 | Open in IMG/M |
| 3300012929|Ga0137404_11770090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 574 | Open in IMG/M |
| 3300012975|Ga0134110_10222740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 797 | Open in IMG/M |
| 3300013105|Ga0157369_11651222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300014154|Ga0134075_10380603 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300014166|Ga0134079_10699761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300014201|Ga0181537_11243428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300014492|Ga0182013_10498310 | Not Available | 634 | Open in IMG/M |
| 3300014495|Ga0182015_10207948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1306 | Open in IMG/M |
| 3300015193|Ga0167668_1014411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1778 | Open in IMG/M |
| 3300015371|Ga0132258_12853084 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300015372|Ga0132256_100149726 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2340 | Open in IMG/M |
| 3300016294|Ga0182041_10237476 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1476 | Open in IMG/M |
| 3300017942|Ga0187808_10528781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300017943|Ga0187819_10619286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300017974|Ga0187777_10447509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 898 | Open in IMG/M |
| 3300018034|Ga0187863_10605217 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300018482|Ga0066669_10370379 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
| 3300020199|Ga0179592_10301216 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 712 | Open in IMG/M |
| 3300020579|Ga0210407_10102858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2172 | Open in IMG/M |
| 3300020579|Ga0210407_10544903 | Not Available | 906 | Open in IMG/M |
| 3300020580|Ga0210403_10745700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 782 | Open in IMG/M |
| 3300021088|Ga0210404_10048770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1982 | Open in IMG/M |
| 3300021168|Ga0210406_10420431 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300021171|Ga0210405_10320737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1223 | Open in IMG/M |
| 3300021171|Ga0210405_10365038 | Not Available | 1138 | Open in IMG/M |
| 3300021171|Ga0210405_10786976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
| 3300021178|Ga0210408_10468871 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300021403|Ga0210397_10074504 | All Organisms → cellular organisms → Bacteria | 2234 | Open in IMG/M |
| 3300021479|Ga0210410_11052616 | Not Available | 703 | Open in IMG/M |
| 3300022557|Ga0212123_10000824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 94136 | Open in IMG/M |
| 3300022557|Ga0212123_10000905 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 89313 | Open in IMG/M |
| 3300023250|Ga0224544_1057285 | Not Available | 562 | Open in IMG/M |
| 3300024246|Ga0247680_1064805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 534 | Open in IMG/M |
| 3300025906|Ga0207699_11164483 | Not Available | 571 | Open in IMG/M |
| 3300026041|Ga0207639_12000705 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300026285|Ga0209438_1103522 | Not Available | 853 | Open in IMG/M |
| 3300026469|Ga0257169_1027033 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300026530|Ga0209807_1244177 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300026551|Ga0209648_10169090 | Not Available | 1705 | Open in IMG/M |
| 3300026552|Ga0209577_10232424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1399 | Open in IMG/M |
| 3300027497|Ga0208199_1056659 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300027576|Ga0209003_1079649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300027696|Ga0208696_1157283 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300027869|Ga0209579_10622103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300027889|Ga0209380_10531655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
| 3300027911|Ga0209698_10633827 | Not Available | 819 | Open in IMG/M |
| 3300028381|Ga0268264_12092629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300028673|Ga0257175_1129105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300028879|Ga0302229_10282044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
| 3300028906|Ga0308309_11714226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 533 | Open in IMG/M |
| 3300029943|Ga0311340_11530297 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300030659|Ga0316363_10108373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter | 1227 | Open in IMG/M |
| 3300030906|Ga0302314_10011110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 15732 | Open in IMG/M |
| 3300031231|Ga0170824_110268844 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300031231|Ga0170824_110449745 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300031708|Ga0310686_107560704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 838 | Open in IMG/M |
| 3300031718|Ga0307474_11444185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300031740|Ga0307468_101176792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 689 | Open in IMG/M |
| 3300031753|Ga0307477_10758347 | Not Available | 646 | Open in IMG/M |
| 3300031753|Ga0307477_11155134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300031754|Ga0307475_11218690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300031823|Ga0307478_11528461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300031837|Ga0302315_10001614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 22510 | Open in IMG/M |
| 3300031910|Ga0306923_12175750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300031912|Ga0306921_12004875 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300031962|Ga0307479_10184905 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2050 | Open in IMG/M |
| 3300032001|Ga0306922_11923114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300032160|Ga0311301_10144299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4342 | Open in IMG/M |
| 3300032205|Ga0307472_100152233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1692 | Open in IMG/M |
| 3300032770|Ga0335085_11975935 | Not Available | 592 | Open in IMG/M |
| 3300033158|Ga0335077_10844402 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.43% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 11.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.57% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.86% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.86% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.14% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.14% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.43% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.43% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.43% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.43% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.43% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.43% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.43% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.43% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.71% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.71% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.71% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.71% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.71% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.71% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.71% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.71% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.71% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.71% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.71% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.71% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Host-Associated | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_102133402 | 3300000567 | Peatlands Soil | METCLAESHAAAVKHNVITIEKAMGMIKRYLAAKAQGER |
| JGI12269J14319_101474342 | 3300001356 | Peatlands Soil | METCFAESHAAAVKHNVITIEKAMGMIKRYFQLTTVMAAKQRA |
| JGI12630J15595_100497982 | 3300001545 | Forest Soil | METCFAESHAAAVKHNVITIEKATGRIKRYLQLTTVMAAKQRANAH |
| JGI12627J18819_100896521 | 3300001867 | Forest Soil | VETCFAESHAAAVKHNVITIEKTMGMIKRYLQLTTVMAAKQRANAHPVPRMSV |
| JGIcombinedJ26739_1014696211 | 3300002245 | Forest Soil | METCFAESHAAAVKHNVVTSEKMMGIIKKYFQLKTVMPAKQRA |
| Ga0062384_1010975752 | 3300004082 | Bog Forest Soil | METCLDENNAAAVKHSVITIEKAMGMIKRYLQLTTEMAAKQRANAHAVPRMSA |
| Ga0062386_1004340753 | 3300004152 | Bog Forest Soil | METRFAESQAAAVKHNVITIEKAMGRIKRYLQLTTVMAAKQRANA |
| Ga0066677_106508852 | 3300005171 | Soil | MLSPHCRNEGMEGCFGDSHAAAVKHNVVTIEKAIGTIKKYFQLKTEMAAKQSANAHA |
| Ga0066690_106938771 | 3300005177 | Soil | METCFAESHAAAVKHNVITIEKAMGMIKRYLQLTTVMAAKQRANAHAV |
| Ga0070687_1012404441 | 3300005343 | Switchgrass Rhizosphere | VSCYCVEGVETGLAESHAAADKHIVIRMEKTMGMAKRYLQLRTVMTAKQRANAHAVPRRS |
| Ga0070714_1008216371 | 3300005435 | Agricultural Soil | MLSPHWRNGGMDGRFGESHAAAVKHNVVTIEKTIGTIKKYFQLKTEMAAKQSANAHAVPRMSAKDSGG |
| Ga0066687_105079322 | 3300005454 | Soil | LDTCLAESHAAANKHNVITIEKAMGMIKRYFQLTTVMAAKQRANAHAV |
| Ga0070681_115455932 | 3300005458 | Corn Rhizosphere | MEDMEGCFVESHAAAIKHKVITIEKTSGVAKRYLQLTTVMAAKQ |
| Ga0070735_108614803 | 3300005534 | Surface Soil | MLEACNGEQGKTYFDASHAAAAKHNVMTIEKAIGRIKRYLQLTIVMPAKQR |
| Ga0066705_107358691 | 3300005569 | Soil | METCFAENHAAAVKHNVITIEKAMGMLKRYLQLTTVM |
| Ga0070763_103465042 | 3300005610 | Soil | MGCAESHAAAIKHTVITIEKTIGRIKRYLQLTTVMAAKQ |
| Ga0068860_1026340602 | 3300005843 | Switchgrass Rhizosphere | MEACLAESHAAAVKHNVITIEKAIGMIKRYRQLTSVMAAKQRANAHAVPR |
| Ga0070717_100950833 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | METCFAESHAAAVKHRVITIEKAMGRMIKRYLQLTM* |
| Ga0075028_1008724221 | 3300006050 | Watersheds | MEACLAESHAPAVKHNVITIEKAMGRIKRYLQLTTVMAAKQRANAH |
| Ga0070765_1001356123 | 3300006176 | Soil | MGTCFAESHAAAVKHNVITIEKAMGMIKRYLQLTTVMAAKQRANAHAVPRMRD |
| Ga0070765_1006111661 | 3300006176 | Soil | MEGCFAESHAAAVKHNVMTIEKAMGRMKRYLKLTTVMAAKQRAKAHAVPR |
| Ga0079221_105251072 | 3300006804 | Agricultural Soil | LAESHAATIKHTVIRKEKTIGRIKRYLQLRTVIAAKQRAN |
| Ga0073928_109556072 | 3300006893 | Iron-Sulfur Acid Spring | METCFVESQAAAVKHKVITIEKAMGRIKRYRQLTTVMAAKQRANAHAVPRMS |
| Ga0099791_106079912 | 3300007255 | Vadose Zone Soil | MGTCLAESHAAAVKHNVITIEKAMGMIKRYLQLTTVMAAKQRANAHA |
| Ga0099793_100490291 | 3300007258 | Vadose Zone Soil | MEICFAESHAAAVKHNVITIEKAMGMTKRYLQLTTVMAAKQRANAHTVPR |
| Ga0066710_1046522621 | 3300009012 | Grasslands Soil | METCFAESHAAAVKHNVITIEKAMGMIKRYLQLTT |
| Ga0099829_103128331 | 3300009038 | Vadose Zone Soil | METCFAESHAAAVKHNVITIEKAMGMIKRYLQLTTVMAAKQRAN |
| Ga0099828_116764811 | 3300009089 | Vadose Zone Soil | METCFAESHAAAVKHNVITIEKAMGMIKRYLQLTTVMAAKQKANAHAAP |
| Ga0099792_100682201 | 3300009143 | Vadose Zone Soil | MEACLAESHAAAVKHSVIRIEKAMGIMKRYLQLTTVMAAKHRANAHAV |
| Ga0116222_14901462 | 3300009521 | Peatlands Soil | METCFAESHAAAVKHNVITIEKAMGMIKRYLQLTTVMAAK |
| Ga0116218_14184791 | 3300009522 | Peatlands Soil | METCFAESHAAAVKHNVVTIEKTMGIIKKYFQLKTVIATKQR |
| Ga0116221_14908792 | 3300009523 | Peatlands Soil | MEACFAEIHAAAVKHNVITIEKAMGMIKRYLQLTTVMAAKQR |
| Ga0116225_14835482 | 3300009524 | Peatlands Soil | MEACFAEIHAAAVKHNVITIEKTMGIIKKYFQLKTVMAAKQRANAH |
| Ga0116220_103308992 | 3300009525 | Peatlands Soil | METCFAESHAAAVKHSVITIENAMGMIKRYLQLTTVMAAKQRANAH |
| Ga0116220_104534932 | 3300009525 | Peatlands Soil | METCFAESHAAAAKHNVITIEKAMGMIKRYLQLTTVMAAKQRANAHAVPR |
| Ga0116216_101149731 | 3300009698 | Peatlands Soil | METCFAESHAAAAKHNVITIEKAMGMIKRYLQLTTVMAAKQRANAHAVPRMGAKV |
| Ga0116216_109552243 | 3300009698 | Peatlands Soil | METRFVESHAAAVKHKVVTIEKTMGIIKKYFQLKTVM |
| Ga0126374_108767272 | 3300009792 | Tropical Forest Soil | MRFAESHAPAVKHTVITIEKTIGRINKYLQLTTVMAAKQRA |
| Ga0116223_108574673 | 3300009839 | Peatlands Soil | METRFAESHAAAVKHNVVTIEKTMGIIKKYFQLKTVMAAKQRANAHAVPRM |
| Ga0126379_131275291 | 3300010366 | Tropical Forest Soil | METYFDESHAAEIKHTVITIEKTIGRIKRYLQLTSVIAAKQKANAHAMPRMRAK |
| Ga0105239_108502042 | 3300010375 | Corn Rhizosphere | METCFAESQAAAVKHNVIAIEKAMGRMKRYLQLTT |
| Ga0126381_1023346161 | 3300010376 | Tropical Forest Soil | MALEVQKIYFEESHAAETKHPVITIEKTMGRRKRYRQLTTVMAAKQRANVHETPRRRARI |
| Ga0136449_1018678852 | 3300010379 | Peatlands Soil | METCFAESHAAAVKHNVIKIEKAMGRTKRYLQLTTVMAAKQRANAHAM |
| Ga0137392_104630461 | 3300011269 | Vadose Zone Soil | VETRFAESHAAAVKHNVITIAKAMGMIKRYLQLTTVMAAKQRAN |
| Ga0137391_112333822 | 3300011270 | Vadose Zone Soil | METCLAESHAAAVKHNVITIEKAMGMIKRYLQHTNVMAAEQRANAHAVPRM |
| Ga0137393_102810211 | 3300011271 | Vadose Zone Soil | METCFAESHAAVVKHNVITIEKAMGMIKRYLQLTTVMAAKQRANAHAVPRMSAKVA |
| Ga0137389_106924411 | 3300012096 | Vadose Zone Soil | METCFAESHAAVVKHNVITIEKAMGMIKRYLQLTTVMAAKQRANAHAVPRMS |
| Ga0137364_114322542 | 3300012198 | Vadose Zone Soil | METCFAESHAAAVKHNVIKIEKAMGRIKRYLQLTIVMAAKQSANAHT |
| Ga0137383_110048461 | 3300012199 | Vadose Zone Soil | METCSAESHAAAVKHNVITIEKAMGMIKRYLQLTTVM |
| Ga0137382_104973372 | 3300012200 | Vadose Zone Soil | METCFAESQAPAVKHNVIRVEKTMGVVKAYLQLKAVTAT |
| Ga0137382_111666702 | 3300012200 | Vadose Zone Soil | MEICLAESHAAAVKHSVITIEKAMGMIKRYLQLTTVMAAKQRANAHAVP |
| Ga0137363_104504422 | 3300012202 | Vadose Zone Soil | METCSAESHAAAVKHNVITIEKAMGMIKRYLQLTTVMAAKQR |
| Ga0137363_118092652 | 3300012202 | Vadose Zone Soil | MEICFAESHAAVVKHNVITIEKAMGMTKRYLQLTTVMTAKQRANAHTVPRMSAKV |
| Ga0137399_100181335 | 3300012203 | Vadose Zone Soil | METCFAESHAAAVKHNVIRIEKVIGMTKRYLQLTTAMAAKQRANAHAVPRMSAKVAV |
| Ga0137381_116184272 | 3300012207 | Vadose Zone Soil | VETFLAESHAAAVKHNVVTIEKTMGIIKKYFQLKTV |
| Ga0137360_107184502 | 3300012361 | Vadose Zone Soil | METCSAESHAAAVKHNVITIEKAMGMIKRYLQLTTVMAAKQRANAHAVPRMSA |
| Ga0137360_111656352 | 3300012361 | Vadose Zone Soil | MEICFAESHAAAVKHNVITIEKAMGMTKRYLQLTTVMAAN |
| Ga0157346_10154893 | 3300012480 | Arabidopsis Rhizosphere | METGLAESHAAAVKHNVITLEKTMGMIKRYLQLTTVMAAKQTANAHAVPRMSA |
| Ga0157323_10237832 | 3300012495 | Arabidopsis Rhizosphere | METCLAESHAAAVKHKVINIEKAMGMIKRYLQLTTVMAAKQ |
| Ga0137394_111258342 | 3300012922 | Vadose Zone Soil | METYLAESHAAAVKHNVITIEKAMGKTKRYLQLTTVMAPK |
| Ga0137394_111466201 | 3300012922 | Vadose Zone Soil | METYLAESHAAAVKHNVITIEKAMGKTKRYLQLTTVMA |
| Ga0137359_103001821 | 3300012923 | Vadose Zone Soil | METCFAESHAAAVKHNVITIEKAMGMIKRYLQLTTVMAAKQRANAHAVPRMSAKVA |
| Ga0137413_101371043 | 3300012924 | Vadose Zone Soil | MGICFAESHAAAVKHNVITIEKAMGMTKRYLQLTTVMTAKQRANAHTVP |
| Ga0137416_107498682 | 3300012927 | Vadose Zone Soil | METCFAESHAPAVKHNVIRVEKTMGVVKAYLQLKAVTAT |
| Ga0137404_104243262 | 3300012929 | Vadose Zone Soil | METCFAESHAAAVKHNVITIEKAMGMIKRYLQLTTVMAAKQRANA |
| Ga0137404_108636862 | 3300012929 | Vadose Zone Soil | MEACLAESHAAAVKHNVIRIEKAMGMMNRYLQLTIVMAAKQRANVHAVPRM |
| Ga0137404_111610381 | 3300012929 | Vadose Zone Soil | METCFAESQAPAVKHNVIRVEKTMGVVKAYLQLKA |
| Ga0137404_113160283 | 3300012929 | Vadose Zone Soil | VETCFAESHAAAIKNTVIRAEKTIGITKRYLQLTTVMAAKQKAKAHPVPRMSAKVA |
| Ga0137404_117700901 | 3300012929 | Vadose Zone Soil | MEICFAESHAAAVKHNVITIDKAMGMTKRYLQLTTVMTAKQRANAHTVPRMSAKV |
| Ga0134110_102227402 | 3300012975 | Grasslands Soil | METCLAESHAAAVKHNVITIEKAMGMIKRYLQLTTVMAAKQRANAHVAPRMSAK |
| Ga0157369_116512222 | 3300013105 | Corn Rhizosphere | MEACLAESHAAAVKHNVITIEKAIGMIKRYRQLTSVMAAKQRANAHAVPRMSAKVA |
| Ga0134075_103806032 | 3300014154 | Grasslands Soil | METCLAESHAAAVKHNVITIEKAMGMIKRYLQLTTVMAAKQRANAHVAPRMSA |
| Ga0134079_106997611 | 3300014166 | Grasslands Soil | VEACLAESHAAAVKHNVITIEKTIGMIKRYLKLTTVMMAKQRANAH |
| Ga0181537_112434282 | 3300014201 | Bog | METCLAESHAATVKHNVIRIEKAMGRIKRYFQLTTVMAAKQ |
| Ga0182013_104983102 | 3300014492 | Bog | METCLAESHAATVKHNVIRIEKAMGRIKRYFQLTTVMAAKQMA |
| Ga0182015_102079483 | 3300014495 | Palsa | METCFAESHAAAVKHNVITIEKAMGRMKRYLQLTTVMAAKQRA |
| Ga0167668_10144112 | 3300015193 | Glacier Forefield Soil | METCLAESHAAAVKHNVITIEKAMGMIKRYLQLTTVMAAKQRANAHAVPRMSAK |
| Ga0132258_128530841 | 3300015371 | Arabidopsis Rhizosphere | METCFAESQAAAVKHNVIAIEKAMGRMKRYLQLTTVMAAKQRANAHAVLRISAR |
| Ga0132256_1001497261 | 3300015372 | Arabidopsis Rhizosphere | METCLAESHAAAVKHKVINIEKAMGMIKRYLQLTTVMAAKQSANAHEVPRMSAKV |
| Ga0182041_102374763 | 3300016294 | Soil | MKTYFDESHAAETKHAVITIEKTIGRIKRYLQLTTVIAAKQRANAHAMLR |
| Ga0187808_105287812 | 3300017942 | Freshwater Sediment | MEPCFAESHAAAVKHDVITIEKAMGRIKRYLQLTTVMAAKQRANAH |
| Ga0187819_106192862 | 3300017943 | Freshwater Sediment | METCFAESHAAAVKHNVITIEKAMGMIKRYLQLTTVMAAKQRANAHAVL |
| Ga0187777_104475092 | 3300017974 | Tropical Peatland | METYLDESHAAEIKHTVITAEKAIGRIKRYFQLTTVMAAKQRANAHLMPCM |
| Ga0187863_106052172 | 3300018034 | Peatland | VRAAPAPAGFPESHAAAVKHTVITIEKTIGRTKRYLQLTAVMAAKQRAKAHTVERMIA |
| Ga0066669_103703791 | 3300018482 | Grasslands Soil | METCLAESHAAAVKHNVITIEKAMGMIKRYLQLTTVMAAKQRANAH |
| Ga0179592_103012162 | 3300020199 | Vadose Zone Soil | METCFAESHAAAVKHDVITIEKAMGTIKRYLQLTTVMAAKQR |
| Ga0210407_101028581 | 3300020579 | Soil | MATCLAESHAAAVKHSVITIEKAMGRIKRYLQLTTVMAAKQRTNAHAVPR |
| Ga0210407_105449031 | 3300020579 | Soil | METCLAESHAAAVKHNVITIEKAMGMTKRYLQLTTVIAAKQRANAHAVPRMSA |
| Ga0210403_107457001 | 3300020580 | Soil | VTCFAESHAATVKQIVITIEKAMGKMKRYLQLTSVMAAKQKAKAHRVPRMSAK |
| Ga0210404_100487703 | 3300021088 | Soil | VSFAESHAAAVKHAVITIEKTIGRIKRYLQLTTVMAPKQSARAHT |
| Ga0210406_104204311 | 3300021168 | Soil | METCYAESHAAAVKHNVITIEKAMGRMKRYLQLTTVMAAKQRAKAH |
| Ga0210405_103207372 | 3300021171 | Soil | METCFAESHAAAVKHNVITTEKAMGMIKRYLQLTTVMAAKQRA |
| Ga0210405_103650383 | 3300021171 | Soil | LAESHAAAIKHTVIRKEKTIGRIKRYLQLRTVMAAK |
| Ga0210405_107869761 | 3300021171 | Soil | MGCAESHAAAIKHTVITIEKTIGRIKRYLQLTTVMAAKQTAK |
| Ga0210408_104688711 | 3300021178 | Soil | METCFAESHAAAVKHSVITIEKAMGRIKRYLQLTTVMA |
| Ga0210397_100745044 | 3300021403 | Soil | MAPCLPESHAATAKHIVITIEKTIGRMKRYLQLITVMAAKQ |
| Ga0210410_110526161 | 3300021479 | Soil | METYFADSHAAAVKHTVITMEKAMGMIKKYLQLKTVMAAKQRGSAHATPRI |
| Ga0126371_115701521 | 3300021560 | Tropical Forest Soil | MVSAHDRTGAVAACFAGSHAATIKHSVITVEKTMGRMKRYLQLTTEIAAK |
| Ga0212123_1000082440 | 3300022557 | Iron-Sulfur Acid Spring | VETCFAESHAAAVGHTVIRVEKAMGVVKGYVQLKAVTATKANGERGGDL |
| Ga0212123_100009051 | 3300022557 | Iron-Sulfur Acid Spring | METCLAESHAAAVKHNVITIEKAMGMIKRYLQLTTVMA |
| Ga0224544_10572852 | 3300023250 | Soil | METCLVESHAAAVKHNVITNEKAMGMIKRYLQLTTVMAAKQRANAHAVSPIS |
| Ga0247680_10648051 | 3300024246 | Soil | VESHAAAVKQNVITIEKTMGRMKRYLQLTTVMAAKQRANAHAVPRMSAKV |
| Ga0207699_111644832 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VESHAAVVRQRVIAMEKTIGRMKRYLQLTTAMAAKQSANAHAVPRIRAKVGAGRP |
| Ga0207639_120007051 | 3300026041 | Corn Rhizosphere | METCFAESRAAAVKHNVIAIEKAMGRMKRYLQLTTVMAAKQRRTPTQ |
| Ga0209438_11035221 | 3300026285 | Grasslands Soil | MEICFAESHAAAVKHNVITIEKAMGMTKRYLQLTTV |
| Ga0257169_10270332 | 3300026469 | Soil | METRLAESHAAAVKHNVITIEKAMGTIKRYLQLTTVMAAKQR |
| Ga0209807_12441771 | 3300026530 | Soil | METCFAENHAAAVKHNVITIEKAMGMLKRYLQLTTVMPAKQR |
| Ga0209648_101690903 | 3300026551 | Grasslands Soil | METLETFFAESHAAAVKHNVITIEKAMGMIKRYLQLTTVMAAKQRANAHA |
| Ga0209577_102324241 | 3300026552 | Soil | METCFAESHAAAVKHNVITIEKAMGKIKRYLQVTTV |
| Ga0208199_10566592 | 3300027497 | Peatlands Soil | METCFAESHAAAAKHNVITIEKAMGMIKRYLQLTTVMAAK |
| Ga0209003_10796492 | 3300027576 | Forest Soil | LAESHAAAIKQTVITKEKTIGRIKRYLQLRTVIAAKQRANAQA |
| Ga0208696_11572831 | 3300027696 | Peatlands Soil | METCFAESHAAAVKHNVVTIEKTMGIIKKYFQLKTVIATKQRANAH |
| Ga0209579_106221031 | 3300027869 | Surface Soil | LAESHAAAVKQNVIAIEKTIGRIKRYLQLTTVIAAKQRANAHT |
| Ga0209380_105316552 | 3300027889 | Soil | MKARFVESHAAAVKHSVITIEKAMGRMKRYLQLTTVMTAKQRANAQAVPR |
| Ga0209698_106338271 | 3300027911 | Watersheds | METCFAESHAAAVKHKVITIVKAMSRIKRYLQLTTVMAAKERANAHAVPRMS |
| Ga0268264_120926291 | 3300028381 | Switchgrass Rhizosphere | MEACLAESHAAAVKHNVITIEKAIGMIKRYRQLTSVMAAKQRANAHAVPRMSAK |
| Ga0257175_11291051 | 3300028673 | Soil | METCFAESHAAAVKHNVITIEKAMGMIKRYLQLTTVMAAKQR |
| Ga0302229_102820442 | 3300028879 | Palsa | METCFAESHAAAVKHNVITIEKAMGRIKRYLQLTKVIPAKQRANPHAV |
| Ga0308309_117142261 | 3300028906 | Soil | LAESQAAAVKHTVIAMEKTIGRIKRYLQLATETAAKQ |
| Ga0311340_115302971 | 3300029943 | Palsa | VKLESSHLTIAESHAAAVKHNVITIEKATGMRKRYLQLTTVMAAKQRANAH |
| Ga0316363_101083731 | 3300030659 | Peatlands Soil | METCLAESHAAAVKHNVITIEKAMGMIKRYLQLTTVMAAK |
| Ga0302314_1001111019 | 3300030906 | Palsa | METCFAESHAAAVKHNVITIEKAMGRIKRYLQLTKVIPAKQ |
| Ga0170824_1102688443 | 3300031231 | Forest Soil | MRAAIKHTVITIEKTIGSMKRYLQLTNVMAAKQTANAHA |
| Ga0170824_1104497452 | 3300031231 | Forest Soil | MCDLTCFAESHAAAVKHSVVTIEKTIGTIKKYFQLKTVMAAKQSANAHAVPRMS |
| Ga0310686_1075607042 | 3300031708 | Soil | LESFGGFAESHAAAVKHIVITIEKTMGRIKRYLQLTTVMAAKQ |
| Ga0307474_114441851 | 3300031718 | Hardwood Forest Soil | VETCFAESHAAAVKHNVITIEKAMGRIKRYLQLTTVMAAKQRANAH |
| Ga0307468_1011767923 | 3300031740 | Hardwood Forest Soil | LETGLAESHAAAIKHNVITIEKAMGTIKRYLQLTTEM |
| Ga0307477_107583471 | 3300031753 | Hardwood Forest Soil | LPESHAAAVRTNVVTIEKTIGIIKKYFQLKKVIAA |
| Ga0307477_111551341 | 3300031753 | Hardwood Forest Soil | MLQISCAESHAAAIKHTVITIEKTTGRIKRYLQLTTVIAAKQTAKAHAVPR |
| Ga0307475_112186901 | 3300031754 | Hardwood Forest Soil | METCFAESHAAAVKHNVIRVEKTMGVVKAYLQLKA |
| Ga0307478_115284611 | 3300031823 | Hardwood Forest Soil | METRFAESHAAAVKHNVVTLEKTTGIIKKYFQLKS |
| Ga0302315_1000161424 | 3300031837 | Palsa | METCFAESHAAAVKHNVITIEKAMGRIKRYLQLTKVIPAKQRANPH |
| Ga0306923_121757502 | 3300031910 | Soil | METCFAESHAAAVKQNVIRIEQAMGRIKRYLQLTTVMAAKQRANAQAIPRRTAKV |
| Ga0306921_120048751 | 3300031912 | Soil | METCLVESHAAAAKHNVVTAAKTVGMMKRYLQLTIVMA |
| Ga0307479_101849054 | 3300031962 | Hardwood Forest Soil | METCLAESHAAAVKHNVITIEKTMGITKKYFQLKTVMATKQRANAHAVPRMR |
| Ga0306922_119231142 | 3300032001 | Soil | METCFAESHAAAVKQNVIRIEQAMGRIKRYLQLTTVMAAKQR |
| Ga0311301_101442995 | 3300032160 | Peatlands Soil | METCFAESHAAAVKHNVVTIEKTMGIIKKYFQLKTVMAAKQRAN |
| Ga0307472_1001522331 | 3300032205 | Hardwood Forest Soil | MCDLTCFAESHAAAVKHSVVTIEKTIGTIKKYFQLKTVMAAKQRAN |
| Ga0335085_119759351 | 3300032770 | Soil | LPVYRGFAESHAAPAKHTVITNEKAIGRIKRNLQLTTVMAAKQRAK |
| Ga0335077_108444022 | 3300033158 | Soil | VPEAGFADTHAAANRHTVITMEKAIGRIKRYLQLTTVIAAK |
| ⦗Top⦘ |