| Basic Information | |
|---|---|
| Family ID | F054189 |
| Family Type | Metagenome |
| Number of Sequences | 140 |
| Average Sequence Length | 42 residues |
| Representative Sequence | ALASAFVARWCVGAKVETAGGVFQVREDEPEPRVGAGLHRTP |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 140 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 5.56 % |
| % of genes near scaffold ends (potentially truncated) | 75.00 % |
| % of genes from short scaffolds (< 2000 bps) | 71.43 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (57.143 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (40.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (57.857 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.143 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.71% β-sheet: 0.00% Coil/Unstructured: 74.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 140 Family Scaffolds |
|---|---|---|
| PF08241 | Methyltransf_11 | 2.14 |
| PF00571 | CBS | 2.14 |
| PF04392 | ABC_sub_bind | 1.43 |
| PF13847 | Methyltransf_31 | 1.43 |
| PF02371 | Transposase_20 | 1.43 |
| PF00211 | Guanylate_cyc | 1.43 |
| PF13417 | GST_N_3 | 1.43 |
| PF03330 | DPBB_1 | 1.43 |
| PF00872 | Transposase_mut | 0.71 |
| PF13185 | GAF_2 | 0.71 |
| PF07969 | Amidohydro_3 | 0.71 |
| PF13551 | HTH_29 | 0.71 |
| PF04964 | Flp_Fap | 0.71 |
| PF00313 | CSD | 0.71 |
| PF14023 | DUF4239 | 0.71 |
| PF04828 | GFA | 0.71 |
| PF07883 | Cupin_2 | 0.71 |
| PF07721 | TPR_4 | 0.71 |
| PF02586 | SRAP | 0.71 |
| PF04966 | OprB | 0.71 |
| PF02646 | RmuC | 0.71 |
| PF02201 | SWIB | 0.71 |
| PF05015 | HigB-like_toxin | 0.71 |
| PF01738 | DLH | 0.71 |
| PF00903 | Glyoxalase | 0.71 |
| PF11937 | DUF3455 | 0.71 |
| PF06627 | DUF1153 | 0.71 |
| PF00072 | Response_reg | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 140 Family Scaffolds |
|---|---|---|---|
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.43 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.43 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.43 |
| COG1322 | DNA anti-recombination protein (rearrangement mutator) RmuC | Replication, recombination and repair [L] | 0.71 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.71 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.71 |
| COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.71 |
| COG3659 | Carbohydrate-selective porin OprB | Cell wall/membrane/envelope biogenesis [M] | 0.71 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.71 |
| COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 0.71 |
| COG5531 | DNA-binding SWIB/MDM2 domain | Chromatin structure and dynamics [B] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 57.14 % |
| All Organisms | root | All Organisms | 42.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005332|Ga0066388_101714355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 1112 | Open in IMG/M |
| 3300005332|Ga0066388_102609560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 920 | Open in IMG/M |
| 3300005552|Ga0066701_10751121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 583 | Open in IMG/M |
| 3300005554|Ga0066661_10712587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300005556|Ga0066707_10113425 | All Organisms → cellular organisms → Bacteria | 1681 | Open in IMG/M |
| 3300005610|Ga0070763_10482090 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300005764|Ga0066903_105169429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 691 | Open in IMG/M |
| 3300005764|Ga0066903_107527421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 562 | Open in IMG/M |
| 3300005764|Ga0066903_108302110 | Not Available | 531 | Open in IMG/M |
| 3300006034|Ga0066656_10518699 | Not Available | 776 | Open in IMG/M |
| 3300006176|Ga0070765_101030434 | Not Available | 778 | Open in IMG/M |
| 3300009792|Ga0126374_10079579 | All Organisms → cellular organisms → Bacteria | 1787 | Open in IMG/M |
| 3300010048|Ga0126373_10343425 | Not Available | 1502 | Open in IMG/M |
| 3300010048|Ga0126373_10467963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium rifense | 1298 | Open in IMG/M |
| 3300010358|Ga0126370_10220893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1448 | Open in IMG/M |
| 3300010358|Ga0126370_12565384 | Not Available | 509 | Open in IMG/M |
| 3300010359|Ga0126376_10294193 | Not Available | 1408 | Open in IMG/M |
| 3300010359|Ga0126376_10353035 | Not Available | 1304 | Open in IMG/M |
| 3300010360|Ga0126372_12248072 | Not Available | 595 | Open in IMG/M |
| 3300010361|Ga0126378_10800001 | Not Available | 1052 | Open in IMG/M |
| 3300010361|Ga0126378_12859047 | Not Available | 551 | Open in IMG/M |
| 3300010366|Ga0126379_11296867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 834 | Open in IMG/M |
| 3300010376|Ga0126381_101080799 | Not Available | 1159 | Open in IMG/M |
| 3300010376|Ga0126381_103292548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 637 | Open in IMG/M |
| 3300010376|Ga0126381_103442965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 622 | Open in IMG/M |
| 3300010398|Ga0126383_10906339 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300011120|Ga0150983_13124536 | Not Available | 539 | Open in IMG/M |
| 3300012198|Ga0137364_11119338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 592 | Open in IMG/M |
| 3300012205|Ga0137362_11079910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 682 | Open in IMG/M |
| 3300012208|Ga0137376_10868300 | Not Available | 775 | Open in IMG/M |
| 3300012211|Ga0137377_11225567 | Not Available | 680 | Open in IMG/M |
| 3300012361|Ga0137360_10088720 | Not Available | 2339 | Open in IMG/M |
| 3300012683|Ga0137398_11023904 | Not Available | 572 | Open in IMG/M |
| 3300012948|Ga0126375_10678654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 799 | Open in IMG/M |
| 3300012971|Ga0126369_11788360 | Not Available | 703 | Open in IMG/M |
| 3300012989|Ga0164305_10840132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 766 | Open in IMG/M |
| 3300016270|Ga0182036_10556715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 915 | Open in IMG/M |
| 3300016270|Ga0182036_11204619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 630 | Open in IMG/M |
| 3300016294|Ga0182041_10836072 | Not Available | 824 | Open in IMG/M |
| 3300016319|Ga0182033_10823632 | Not Available | 819 | Open in IMG/M |
| 3300016341|Ga0182035_11146592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 693 | Open in IMG/M |
| 3300016371|Ga0182034_11554822 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300016404|Ga0182037_11727231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300016404|Ga0182037_11888822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300016422|Ga0182039_10130774 | All Organisms → cellular organisms → Bacteria | 1911 | Open in IMG/M |
| 3300020581|Ga0210399_11053076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 653 | Open in IMG/M |
| 3300020582|Ga0210395_11335711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300021168|Ga0210406_10819809 | Not Available | 707 | Open in IMG/M |
| 3300021362|Ga0213882_10364582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 608 | Open in IMG/M |
| 3300021403|Ga0210397_11616805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 503 | Open in IMG/M |
| 3300021560|Ga0126371_10397666 | Not Available | 1519 | Open in IMG/M |
| 3300021560|Ga0126371_13491680 | Not Available | 531 | Open in IMG/M |
| 3300027654|Ga0209799_1132619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 567 | Open in IMG/M |
| 3300027855|Ga0209693_10552136 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300031231|Ga0170824_103283433 | All Organisms → cellular organisms → Bacteria | 1928 | Open in IMG/M |
| 3300031231|Ga0170824_114028024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1991 | Open in IMG/M |
| 3300031543|Ga0318516_10038230 | All Organisms → cellular organisms → Bacteria | 2566 | Open in IMG/M |
| 3300031544|Ga0318534_10500877 | Not Available | 694 | Open in IMG/M |
| 3300031545|Ga0318541_10440810 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300031573|Ga0310915_11284188 | Not Available | 504 | Open in IMG/M |
| 3300031668|Ga0318542_10439038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 676 | Open in IMG/M |
| 3300031679|Ga0318561_10438153 | Not Available | 719 | Open in IMG/M |
| 3300031680|Ga0318574_10086407 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1719 | Open in IMG/M |
| 3300031681|Ga0318572_10692983 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300031682|Ga0318560_10044830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2157 | Open in IMG/M |
| 3300031682|Ga0318560_10161501 | Not Available | 1188 | Open in IMG/M |
| 3300031713|Ga0318496_10854796 | Not Available | 501 | Open in IMG/M |
| 3300031719|Ga0306917_11343952 | Not Available | 552 | Open in IMG/M |
| 3300031719|Ga0306917_11522107 | Not Available | 514 | Open in IMG/M |
| 3300031723|Ga0318493_10672968 | Not Available | 579 | Open in IMG/M |
| 3300031736|Ga0318501_10039215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2149 | Open in IMG/M |
| 3300031747|Ga0318502_10462807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 758 | Open in IMG/M |
| 3300031747|Ga0318502_10672933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300031763|Ga0318537_10261001 | Not Available | 642 | Open in IMG/M |
| 3300031770|Ga0318521_10822508 | Not Available | 566 | Open in IMG/M |
| 3300031777|Ga0318543_10123793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1124 | Open in IMG/M |
| 3300031782|Ga0318552_10571302 | Not Available | 577 | Open in IMG/M |
| 3300031799|Ga0318565_10612618 | Not Available | 523 | Open in IMG/M |
| 3300031835|Ga0318517_10379991 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300031890|Ga0306925_11980746 | Not Available | 550 | Open in IMG/M |
| 3300031893|Ga0318536_10434298 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300031896|Ga0318551_10094751 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1581 | Open in IMG/M |
| 3300031912|Ga0306921_10098974 | All Organisms → cellular organisms → Bacteria | 3378 | Open in IMG/M |
| 3300031912|Ga0306921_11174124 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300031912|Ga0306921_11833466 | Not Available | 651 | Open in IMG/M |
| 3300031912|Ga0306921_12518618 | Not Available | 533 | Open in IMG/M |
| 3300031941|Ga0310912_10481492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 968 | Open in IMG/M |
| 3300031941|Ga0310912_11169691 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300031942|Ga0310916_10138009 | Not Available | 2001 | Open in IMG/M |
| 3300031946|Ga0310910_10236443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1426 | Open in IMG/M |
| 3300031954|Ga0306926_10375963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1755 | Open in IMG/M |
| 3300031954|Ga0306926_12038048 | Not Available | 644 | Open in IMG/M |
| 3300032001|Ga0306922_10916190 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300032001|Ga0306922_11468059 | Not Available | 683 | Open in IMG/M |
| 3300032001|Ga0306922_11509913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 671 | Open in IMG/M |
| 3300032041|Ga0318549_10292041 | Not Available | 735 | Open in IMG/M |
| 3300032051|Ga0318532_10124470 | Not Available | 913 | Open in IMG/M |
| 3300032055|Ga0318575_10167973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1095 | Open in IMG/M |
| 3300032055|Ga0318575_10427520 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300032059|Ga0318533_10037194 | Not Available | 3187 | Open in IMG/M |
| 3300032059|Ga0318533_10041255 | All Organisms → cellular organisms → Bacteria | 3038 | Open in IMG/M |
| 3300032059|Ga0318533_10101130 | Not Available | 1995 | Open in IMG/M |
| 3300032063|Ga0318504_10567167 | Not Available | 545 | Open in IMG/M |
| 3300032068|Ga0318553_10315039 | Not Available | 818 | Open in IMG/M |
| 3300032090|Ga0318518_10387543 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300032091|Ga0318577_10327931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 732 | Open in IMG/M |
| 3300032261|Ga0306920_102443915 | Not Available | 720 | Open in IMG/M |
| 3300033289|Ga0310914_11861888 | Not Available | 506 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 40.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 16.43% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.43% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.86% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.14% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.14% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.43% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.71% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066388_1017143551 | 3300005332 | Tropical Forest Soil | FADATLASAFVARWCVGAKAETAGGVFQVREDDPEPRVGAGLHKIP* |
| Ga0066388_1026095601 | 3300005332 | Tropical Forest Soil | MLASAFVARWCVGAKVETAGGVFEVREEAPEPRIGAELQRTP* |
| Ga0066701_107511211 | 3300005552 | Soil | FVARWCAGYGVETAGGTFRVREDESAPRLGAGLHRTP* |
| Ga0066661_107125872 | 3300005554 | Soil | ASAFVARWCAGYGAETAGGVFRVREDEPAPRLGAGPHRTP* |
| Ga0066707_101134254 | 3300005556 | Soil | AFVARWCAGYGVETAGGTFRVREDESAPRLGAGLHRTP* |
| Ga0070763_104820901 | 3300005610 | Soil | GALVCAVSKVETAGGVFRVRDDEPAPRIGAGLHRTP* |
| Ga0066903_1000813872 | 3300005764 | Tropical Forest Soil | MTLASAFVARWCAASKVETEGGLFRIRDDEPPPRIRAGLHRTP* |
| Ga0066903_1051694291 | 3300005764 | Tropical Forest Soil | AFVARWCIGFKVETAEGAFRVREDEPAPRVGAGLHRTP* |
| Ga0066903_1075274211 | 3300005764 | Tropical Forest Soil | ATLASAFVARWCVGAKADTAGGVFRVREDEPEPRIGAGLHRTT* |
| Ga0066903_1083021102 | 3300005764 | Tropical Forest Soil | LASAFVARWCVGSKVETSGGVLQVREDEPVPRVGAGLHRTP* |
| Ga0066656_105186992 | 3300006034 | Soil | DAMLAGAFVARWCVGAKAETAGGVFQVREDEPAPRIEAGLHRTP* |
| Ga0070765_1010304341 | 3300006176 | Soil | AFVARWCVGSKVETAEGVFQVREDEPAPRVGARLHRTP* |
| Ga0126374_100795791 | 3300009792 | Tropical Forest Soil | DAMLASAFVARWCVGAKVETAGGVFEVREEAPEPRIGAELQRTP* |
| Ga0126373_103434251 | 3300010048 | Tropical Forest Soil | IHFAGAALTSAFVVRWCFGAKVETAGGVFQVRGDEPAPRVAAGVHRTL* |
| Ga0126373_104679631 | 3300010048 | Tropical Forest Soil | SAFVAQWRVAAKVETTGGVFQVREDEPAPRVGAGLHRTP* |
| Ga0126370_102208935 | 3300010358 | Tropical Forest Soil | DATLASAFVARWCVAAKVETAGGVFQVREDEPAPRVGAGLHRTP* |
| Ga0126370_125653842 | 3300010358 | Tropical Forest Soil | SAFVARWCVGSRVETTGGVFHVREDEPTVRVEAGLHRTP* |
| Ga0126376_102941931 | 3300010359 | Tropical Forest Soil | GAFVSRWCAGSKVETPGGVFQVREDEPTPRIGAGLHRTP* |
| Ga0126376_103530351 | 3300010359 | Tropical Forest Soil | TLANAFVVRWCVGSKAETAGGVFLVRKEEPAPRVGAGLHRTP* |
| Ga0126372_118486711 | 3300010360 | Tropical Forest Soil | LASAFVARWCVASKVEVEGGLFRIRDDHPAPRIPAGVHRTP* |
| Ga0126372_122480722 | 3300010360 | Tropical Forest Soil | ARWCVGSKIETTGGVFQVREDEPAPRVGSGLHRTP* |
| Ga0126378_108000011 | 3300010361 | Tropical Forest Soil | DATLANAFVARWCVGSKVATAGGVFQVRVDEPAPGIGAGLHRTP* |
| Ga0126378_128590471 | 3300010361 | Tropical Forest Soil | ANAFVARWCQGSKAETAGGVFQMREDEPAPRIGAGLHRTP* |
| Ga0126379_112968672 | 3300010366 | Tropical Forest Soil | FVARWCVGARVEANGGVFQVREDEPMPRLGATLHRTP* |
| Ga0126379_129027811 | 3300010366 | Tropical Forest Soil | MTLASAFVARWCAASKVETEGGLFRIRDDEPPPRIGARLHRTP* |
| Ga0126379_135729171 | 3300010366 | Tropical Forest Soil | TLASAFVARWCAGAKTETDGGVFRMREDEPTPRIGAGLHRTP* |
| Ga0126381_1010807991 | 3300010376 | Tropical Forest Soil | SAFVARWCVAAKVETAGGVFQVREDEPAPRTWAGLHRTP* |
| Ga0126381_1032925482 | 3300010376 | Tropical Forest Soil | FADATLASAFVARWCVGSKVDTAGGVFQVREDEPAPRVGAGLHRTP* |
| Ga0126381_1034429652 | 3300010376 | Tropical Forest Soil | SEATLANAFVARWCVGSEVETAGGVFQVREDEPATRVGAGLHRTP* |
| Ga0126381_1039696871 | 3300010376 | Tropical Forest Soil | IYFRDATLASAFVVRWCAASKVETEGGLFRIRDDEPAPRIGAGLHRTP* |
| Ga0126383_109063393 | 3300010398 | Tropical Forest Soil | AEATLASAFVARWCVGRKVETTGGVFQVREDEPEARVGAGLHKTP* |
| Ga0150983_131245361 | 3300011120 | Forest Soil | LASAFVARWCAGARVETAGGVFQVREDEPAPPMGAGLHRTPGGQT* |
| Ga0137364_111193381 | 3300012198 | Vadose Zone Soil | RPWCIGSKVETAGGVFQVREDEPAPRIGAGLHRTP* |
| Ga0137362_110799101 | 3300012205 | Vadose Zone Soil | RWCAGYGVETAGGAFRVREDEPAPRLAAGPHSTP* |
| Ga0137376_108683003 | 3300012208 | Vadose Zone Soil | AFVARWCAGRKVETAAGVFQVREDESTPKVGATLHRTP* |
| Ga0137377_112255671 | 3300012211 | Vadose Zone Soil | ALASAFVARWCVGAKVETAGGVFQVREDEPEPRVGAGLHRTP* |
| Ga0137370_108051322 | 3300012285 | Vadose Zone Soil | YFADPTLASAFVVRWYAATKVETAGGVFRVREDESTPRVAAGLHRTP* |
| Ga0137360_100887201 | 3300012361 | Vadose Zone Soil | RWCVGSKVETAGGVFQVREDEPAPRVGAGLHRTP* |
| Ga0137398_110239042 | 3300012683 | Vadose Zone Soil | SAFVARWCAGSKVSTIGGVFQVRDDEPAPRVGAGLHSIP* |
| Ga0137394_107060622 | 3300012922 | Vadose Zone Soil | LAGAFVARWCTGYYKVKTAEGALTVREDEPTPRIGVGLHRTP* |
| Ga0137359_106403853 | 3300012923 | Vadose Zone Soil | FVARWCAGHKVETAEGVFRARGDEPMARTGAGVTPDA* |
| Ga0126375_106786542 | 3300012948 | Tropical Forest Soil | ATLASAFVARWCVGSKVETAGGVFHAREDEPSPRVGAGFHRTP* |
| Ga0126369_117883601 | 3300012971 | Tropical Forest Soil | LASAFVARGCVGSETEATAGVFQVREDEPAPRVGAGLRRTQ* |
| Ga0164305_108401323 | 3300012989 | Soil | AFVARWCAGPKVETIGGVFQVREDEPAPRIGAGLHRTP* |
| Ga0182036_105567151 | 3300016270 | Soil | DPALASAFVARWCVRAKVETGGGVFQVREDEPEPRVGAGLHRTP |
| Ga0182036_112046191 | 3300016270 | Soil | LSIYFGDATLASAFVARWCVGAKVETTGGVFQVREDEPEARVGVGLHKTP |
| Ga0182041_108360721 | 3300016294 | Soil | FGDAVLASAFVARWCVGAKVETAGGVFQFREDEPETRFEAAMHRTP |
| Ga0182033_108236321 | 3300016319 | Soil | DAALASAFAARWCVGAKVETAGGVFRVREDEPGPRIAARLHRPP |
| Ga0182035_111465921 | 3300016341 | Soil | MRCIVRDAPLASAFVARWCVGAKVETTGGGVFPLREDEPEPRVGAGL |
| Ga0182035_121079082 | 3300016341 | Soil | VSIYFLDATLASAFVARWCTASRVETEGGLFRIREDEPPPRIGAGLHRTP |
| Ga0182034_115548221 | 3300016371 | Soil | ASAFVARWCVGSKVETTGGVFQVREDEPAPRVGAGLHRTP |
| Ga0182037_117272311 | 3300016404 | Soil | AFVARWCVGSKVETAGGVFQLHEDKLTPRVSPGLHRTP |
| Ga0182037_118888221 | 3300016404 | Soil | YFADATLASAFVARWCVGAKVETAGGVFQVREDESEGRVGAGLHKTP |
| Ga0182039_101307741 | 3300016422 | Soil | ARWCVGAKVETNGGVFQVRENDPEPRVGAALHTTP |
| Ga0182039_102579734 | 3300016422 | Soil | NATIVGAFVARWCVATRVETIGGVFQIREDEPEPRVGTVLHSTA |
| Ga0182039_109768863 | 3300016422 | Soil | GRWCVGAKVQTVGGVFQVREDEPEPWVGAGLHKTP |
| Ga0182038_107442571 | 3300016445 | Soil | LASAFVARWCAASRVETEGGLFRIRDDEPPPRIGAGLHRTP |
| Ga0210399_110530761 | 3300020581 | Soil | SAFVARWCAGSMVETKDGVFRIRDDGPAPRIGAGLHRTP |
| Ga0210395_113357112 | 3300020582 | Soil | IRTRWCVGSKVETAGGVFQVREDEPAPRIGVGLHRAP |
| Ga0210406_108198091 | 3300021168 | Soil | VARWCVGAKVETDGGVFRVREDEPGARVGAGPHKTP |
| Ga0213882_103645823 | 3300021362 | Exposed Rock | IYFVEATLASAFVARWCVAAKFETVEGVFRMREDEPMPRISAGLHRTP |
| Ga0210397_116168051 | 3300021403 | Soil | ADATLASAFVARWCAGSKIEATGGVFQVRDDEPVPRVGAGLHRTP |
| Ga0126371_103976661 | 3300021560 | Tropical Forest Soil | ATLASAFVASWCVGFKVEAAGGVFQVREGEPVPRIGAGLHRTP |
| Ga0126371_134916801 | 3300021560 | Tropical Forest Soil | ATLASAFVARWCVGSKAETAGGVFQVGEDEPTPRIGARLHRTP |
| Ga0209217_10457793 | 3300027651 | Forest Soil | NAWGAERIGYKVETAEGALRVREDEPEPRVGGGLHRTP |
| Ga0209799_11326191 | 3300027654 | Tropical Forest Soil | LANAFVARWCVGARVEANGGVFQVREDEPMPRLGATLHRTP |
| Ga0209693_105521362 | 3300027855 | Soil | GALVCAVSKVETAGGVFRVRDDEPAPRIGAGLHRTP |
| Ga0170824_1032834333 | 3300031231 | Forest Soil | FVARWCVGSKVETAGGVFQVREDEPAPRVRAGLHRTP |
| Ga0170824_1140280245 | 3300031231 | Forest Soil | DATLASAFVARWCQGSNAEIAGGVFQVREDEPAPRIGAGLHRPP |
| Ga0170819_135377122 | 3300031469 | Forest Soil | AFVARWCVTAKVETAGGVFRVREDEPEPRVRTGLHRTQ |
| Ga0318516_100382305 | 3300031543 | Soil | FDDATLASAFVARWCLSAKVDTAGGVFQARRDEPGSRIEAGLHRTP |
| Ga0318534_105008772 | 3300031544 | Soil | ATLASAFVARWCVGPKVETAGGVFQVRENEPEPRVGAGLHRTP |
| Ga0318541_104408102 | 3300031545 | Soil | LASAFVARWCVGARVETAGGLFQVREDEPEPRVGAGLYRTP |
| Ga0310915_112841881 | 3300031573 | Soil | AFVARWCVGAKVETAGGVFQFREDEPETRFEAAMHRTP |
| Ga0318542_104390381 | 3300031668 | Soil | DATLASAFVARWCVGSKVATAGGVFQMREDDPAPRVGAGLYRTP |
| Ga0318561_104381532 | 3300031679 | Soil | AVLANAFVARWCVGARVEATGGVFQLREGVPVPRLGTTMHRTP |
| Ga0318574_100864071 | 3300031680 | Soil | AFVARWCVGSKVATAGGVFQMREDDPAPRVGAGLYRTP |
| Ga0318572_106929832 | 3300031681 | Soil | YFGDATLASAFVARWCVGAKAETAGGVFQVREDEPEPRVAAGLHRTP |
| Ga0318560_100448301 | 3300031682 | Soil | MLASAFIARWCVGAKVETAGGVFQVHKDQPEPRVGAGLHRTA |
| Ga0318560_101615013 | 3300031682 | Soil | AFVARWCVGTKVETAGGVFQVREDEPEPRVGAGLHRTP |
| Ga0318496_108547961 | 3300031713 | Soil | ARWCVRAKVETVGGMFRVREDELKPRIGARLHRTP |
| Ga0306917_113439521 | 3300031719 | Soil | SIYFADAVLANAFVARWCVGARVEATGGVFQLREGVPVPRLGTTMHRTP |
| Ga0306917_115221071 | 3300031719 | Soil | ADATLASAFVARWCIGAKVETAGGMFEVREDEPEPRVEAGLHRTP |
| Ga0318493_106729681 | 3300031723 | Soil | ANTTLARAFVAQWCVGAKAETAGGVFQVREDEPQPRVGAGLHRTP |
| Ga0318501_100392153 | 3300031736 | Soil | MLASAFIARWCVGAKVETAGGVFQVHKDQPEPRVGAGLHRTARSPYSTRLK |
| Ga0318502_104628072 | 3300031747 | Soil | DATLANAFVARWCVGAKVEPTGGVFQVREDEPAPRVGAGLHRTP |
| Ga0318502_106729333 | 3300031747 | Soil | VLNDALSIYFAGATLASAFVARWCVRAKVDTAGGIFRVREDELKPRIGARLHRTP |
| Ga0318537_102610011 | 3300031763 | Soil | FVTRWCVEAKVETAGGVFQMREDQPEPRVGAVLHRTP |
| Ga0318521_108225081 | 3300031770 | Soil | IYFGDAAFASAFVARWCVGAKVETACGVFQVREDDPEPRVGSGLHGTP |
| Ga0318546_111141321 | 3300031771 | Soil | TLASAFVARWCTASRVETEGGLFRIRDDEPPPRIGAGLHRTP |
| Ga0318543_101237933 | 3300031777 | Soil | MLASAFVARWCAGAKVETAGGVFRVREYEPEPRVGSTLHRTHRDG |
| Ga0318552_105713021 | 3300031782 | Soil | AFAARWCAGAKVQTTGGVFRVREDEPAPRTVAGTHRTL |
| Ga0318565_106126181 | 3300031799 | Soil | THFDDATLASAFVARWCLSAKVDTAGGVFQARRDEPGSRIEAGLHRTP |
| Ga0318568_102386901 | 3300031819 | Soil | ARWCIGAKVETAGGVFQVRDNATGARVGAGLHKTP |
| Ga0318517_103799911 | 3300031835 | Soil | LFCRCDTLASAFVARWCVGAKVETNGGVFQVRENDPEPRVGAALHTTP |
| Ga0318517_105414001 | 3300031835 | Soil | GAFVARWCVATRVETTGGVFQIREDEPEPWVEAVLHRTP |
| Ga0318527_103655762 | 3300031859 | Soil | LASAFVSRWCQTAKIETVGGVFQVREDDPEPRVGAGLHRTP |
| Ga0306919_114451971 | 3300031879 | Soil | FLDATLASAFVARWCTASRVETEGGLFRIRDDEPPPRIGAGLHRTP |
| Ga0306925_119807462 | 3300031890 | Soil | LTDATLASAFVTRRRVGAKVETAGGVFQERDDAPEARVGARLP |
| Ga0318536_104342982 | 3300031893 | Soil | FVARWCVGAKVETNGGVFQVRENDPEPRVGAALHTTP |
| Ga0318551_100947511 | 3300031896 | Soil | LTHFDDATLASAFVARWCLSAKVDTAGGVFQVRRDEPGSRIGAGLHRTP |
| Ga0306921_100989741 | 3300031912 | Soil | FGDAALASAFVARWCVGARVETAGGLFQVREDEPEPRVGAGLHRTP |
| Ga0306921_111741243 | 3300031912 | Soil | FGDAALASAFVARWCVGARVETAGGLFQVREDEPEPRVGAGLYRTP |
| Ga0306921_118334662 | 3300031912 | Soil | VTRWCVVAKVETTGGFFQVREDEPEPRVGAGLYRTP |
| Ga0306921_125186181 | 3300031912 | Soil | SAFVARWCVGAKVETAGGVFQVREDEPEPRLGAGLHRTP |
| Ga0310912_100357281 | 3300031941 | Soil | IYFLDATLASAFVARWCTASRVETEGGLFRIRDDEPPPRIGAGLHRTP |
| Ga0310912_104814922 | 3300031941 | Soil | DATLASAFVARWCVAAKAETAGGVFQVREDEPAPRVGAGLHPTP |
| Ga0310912_111696911 | 3300031941 | Soil | AALASAFVARWCVGSKVETTGGVFQVREDEPAPRVGAGLHRTP |
| Ga0310916_101380091 | 3300031942 | Soil | VRWYVTAKVEPIGGLFQVREGEPEPRVRAALHRTPGAR |
| Ga0310910_102364431 | 3300031946 | Soil | YFADAALAGAFVVRWYVTAKVEPIGGLFQVREGEPEPRVRAALHRTPGAR |
| Ga0310910_103808861 | 3300031946 | Soil | AVSIYFAEATLGSAFVARWCVGTRAAAAGGVFQVREDEPEPRVGTG |
| Ga0306926_103759633 | 3300031954 | Soil | MLASAFIARWCVGAKVETAGGVFQVHKDQPEPRVGAGLHRTARSP |
| Ga0306926_120380482 | 3300031954 | Soil | RHLDLFRGTLASAFVARRCVGSKVETAGGVFQVREGEPAPRIGAGLHRTP |
| Ga0307479_105893421 | 3300031962 | Hardwood Forest Soil | MLAGAFVARWCAGSKVETVGGVFQVREDEPAPRVGAGLHRTP |
| Ga0306922_109161901 | 3300032001 | Soil | AFVARWCVGARVETAGGLFQVREDEPEPRVGAGLYRTP |
| Ga0306922_114680591 | 3300032001 | Soil | FADAPLASGFVARRCVGSKAEGTGGVFQVREDEPAPQVGAALNRTP |
| Ga0306922_115099131 | 3300032001 | Soil | ARWCVGSKVETAGGVFQLHEDKLTPRVSPGLHRTP |
| Ga0318507_102122043 | 3300032025 | Soil | TLASAFVARWCAASKVETEGGLFRIRDDELAPRIAVGLHRTP |
| Ga0310911_103639231 | 3300032035 | Soil | NATIVGAFVARWCVATRVETTGGVFQIREDEPEPWVEAVLHRTP |
| Ga0318559_102581291 | 3300032039 | Soil | FVSRWCQTAKIETVGGVFQVREDDPEPRVGAGLHRTP |
| Ga0318549_102920411 | 3300032041 | Soil | ADATLASALVARWCIGAKVETSGGMFRVREDEPEPRVEAGLHGTP |
| Ga0318545_103431632 | 3300032042 | Soil | LASAFVARWCVAAKLETTGGVFRVREDEPEPPLRYT |
| Ga0318558_105678362 | 3300032044 | Soil | ATLASAFVARWCAASKVETEGGLFRIRDDELAPRIAVGLHRTP |
| Ga0318532_101244701 | 3300032051 | Soil | SRWCQTAKIETVGGVFQVREDDPEPRVGAGLHRTP |
| Ga0318506_104245811 | 3300032052 | Soil | FVARWCVGTKIQTDGGVFRVREDELEPRFGVGLRRTP |
| Ga0318575_101679733 | 3300032055 | Soil | ALASAFVSRWCRRAKAETTGGVCQVREDEPEPRVGAGLHRTP |
| Ga0318575_104275201 | 3300032055 | Soil | CDTLASAFVARWCVGAKVETNGGVFQVRENDPEPRVGAALHTTP |
| Ga0318533_100371944 | 3300032059 | Soil | MRCIVRDAPLASAFVARWCVGAKVETTGGGVFPLREDEPEPRVGAGLHRTS |
| Ga0318533_100412551 | 3300032059 | Soil | FVARWCVGARVETAGGLFQVREDEPEPRVGAGLHRTP |
| Ga0318533_101011306 | 3300032059 | Soil | NAFVARWCVGSKVETAGGVFQMREDEPRRRVGAGLHRTP |
| Ga0318504_105671671 | 3300032063 | Soil | LANTTLARAFVAQWCVGAKAETAGGVFQVREDEPQPRVGAGLHRTP |
| Ga0318513_106308002 | 3300032065 | Soil | FVARWCAASKVETEGGLFRIRDDEPVPWIGAGLHRTP |
| Ga0318553_103150392 | 3300032068 | Soil | GDAALASAFVARWCVGANVETAEGVFQIREDEPKTRFEAGMHRTP |
| Ga0306924_111485701 | 3300032076 | Soil | DPTLATAFVVRWCAGYQIETTGGVFQVREDEPTPRLGASLHRTP |
| Ga0306924_117812191 | 3300032076 | Soil | VSIYFLDATLASAFVARWCTASRVETEGGLFRIRDDEPPPRIGAGLHRTP |
| Ga0318518_103875432 | 3300032090 | Soil | FVARWCVGSRVETTGGVFQVREDEPAPWVGTRQHSIP |
| Ga0318577_103279311 | 3300032091 | Soil | AALASAFVARWCVGANVETAEGVFQIREDEPKTRFEAGMHRTP |
| Ga0307471_1003432723 | 3300032180 | Hardwood Forest Soil | PSNPDATLAGAFVARWCAASRVETEGGVFKMRNDEPKPRLGAAPHRIP |
| Ga0306920_1024439151 | 3300032261 | Soil | VARWCVGTKAETAGGVFQVREDEPEPQVGAGLHRTP |
| Ga0310914_118618881 | 3300033289 | Soil | YFGDATLASAFVAGWCVGAKVETAGGVLQVRDDEPEPQVGAALHRTP |
| ⦗Top⦘ |