 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F054157 |
| Family Type | Metagenome |
| Number of Sequences | 140 |
| Average Sequence Length | 42 residues |
| Representative Sequence | QLDAGKWNYRRLMVRMNAWSTNPDYHEIILQAIVDNKLP |
| Number of Associated Samples | 127 |
| Number of Associated Scaffolds | 140 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.57 % |
| % of genes from short scaffolds (< 2000 bps) | 88.57 % |
| Associated GOLD sequencing projects | 115 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (70.714 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (18.571 % of family members) |
| Environment Ontology (ENVO) | Unclassified (61.429 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (82.857 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.34% β-sheet: 0.00% Coil/Unstructured: 68.66% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 140 Family Scaffolds |
|---|---|---|
| PF04055 | Radical_SAM | 2.14 |
| PF13394 | Fer4_14 | 1.43 |
| PF02622 | DUF179 | 0.71 |
| PF11750 | DUF3307 | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 140 Family Scaffolds |
|---|---|---|---|
| COG1678 | Putative transcriptional regulator, AlgH/UPF0301 family | Transcription [K] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 70.71 % |
| All Organisms | root | All Organisms | 29.29 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 18.57% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 15.71% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 11.43% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 11.43% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 6.43% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.71% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.86% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 2.86% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.14% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.14% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.14% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 2.14% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.43% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.43% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.43% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.43% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.71% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.71% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.71% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.71% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.71% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.71% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.71% |
| Coastal Lagoon | Environmental → Aquatic → Marine → Unclassified → Unclassified → Coastal Lagoon | 0.71% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.71% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.71% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.71% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.71% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water And Sediment | 0.71% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.71% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2222084010 | Coastal lagoon microbial communities from Mar Menor, Spain - Sample 1 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001419 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m) | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005611 | Saline surface water microbial communities from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
| 3300005913 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1 | Environmental | Open in IMG/M |
| 3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007609 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG | Environmental | Open in IMG/M |
| 3300008221 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 | Environmental | Open in IMG/M |
| 3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300011253 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeate | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300013231 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 5m_Station5_GOM_Metagenome | Environmental | Open in IMG/M |
| 3300014973 | Marine microbial communities to study oil droplet degradation from Trondheimsfjord, Norway - 0116 : 2 days incubation | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017964 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017968 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017986 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020051 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020053 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041401AS metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020194 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020367 | Marine microbial communities from Tara Oceans - TARA_B100000508 (ERX556112-ERR599005) | Environmental | Open in IMG/M |
| 3300020372 | Marine microbial communities from Tara Oceans - TARA_B100000787 (ERX556133-ERR599090) | Environmental | Open in IMG/M |
| 3300020374 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291766-ERR318618) | Environmental | Open in IMG/M |
| 3300020395 | Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX555987-ERR599133) | Environmental | Open in IMG/M |
| 3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020457 | Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014) | Environmental | Open in IMG/M |
| 3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
| 3300020465 | Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961) | Environmental | Open in IMG/M |
| 3300020467 | Marine microbial communities from Tara Oceans - TARA_B100000945 (ERX555966-ERR598957) | Environmental | Open in IMG/M |
| 3300020468 | Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993) | Environmental | Open in IMG/M |
| 3300020471 | Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002) | Environmental | Open in IMG/M |
| 3300020475 | Marine microbial communities from Tara Oceans - TARA_B100002029 (ERX555951-ERR599001) | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300021352 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022842 | Saline water microbial communities from Ace Lake, Antarctica - #46 | Environmental | Open in IMG/M |
| 3300022865 | Saline water microbial communities from Ace Lake, Antarctica - #728 | Environmental | Open in IMG/M |
| 3300022934 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG | Environmental | Open in IMG/M |
| 3300022937 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG | Environmental | Open in IMG/M |
| 3300023105 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG | Environmental | Open in IMG/M |
| 3300023110 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300023175 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG | Environmental | Open in IMG/M |
| 3300023180 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG | Environmental | Open in IMG/M |
| 3300023237 | Saline water microbial communities from Ace Lake, Antarctica - #367 | Environmental | Open in IMG/M |
| 3300024297 | Seawater microbial communities from Monterey Bay, California, United States - 71D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025425 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8 (SPAdes) | Environmental | Open in IMG/M |
| 3300025438 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9 (SPAdes) | Environmental | Open in IMG/M |
| 3300025502 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKJ (SPAdes) | Environmental | Open in IMG/M |
| 3300025570 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
| 3300025640 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025685 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 (SPAdes) | Environmental | Open in IMG/M |
| 3300025694 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 (SPAdes) | Environmental | Open in IMG/M |
| 3300025696 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 (SPAdes) | Environmental | Open in IMG/M |
| 3300025821 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300025876 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027704 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027780 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes) | Environmental | Open in IMG/M |
| 3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300027801 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028008 | Seawater microbial communities from Monterey Bay, California, United States - 1D_r | Environmental | Open in IMG/M |
| 3300028197 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m | Environmental | Open in IMG/M |
| 3300031510 | Marine microbial communities from water near the shore, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031598 | Marine microbial communities from water near the shore, Antarctic Ocean - #284 | Environmental | Open in IMG/M |
| 3300031605 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_32.1 | Environmental | Open in IMG/M |
| 3300031626 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_surface | Environmental | Open in IMG/M |
| 3300031655 | Marine microbial communities from water near the shore, Antarctic Ocean - #282 | Environmental | Open in IMG/M |
| 3300031675 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_SCM | Environmental | Open in IMG/M |
| 3300031785 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MG | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300032151 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_SCM | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2225121657 | 2222084010 | Coastal Lagoon | YELFREXKEQQXDEGXWNYRELLEGMTAWSTNPDYGAIILSAIVDNQLP |
| DelMOWin2010_101005041 | 3300000117 | Marine | FREARATQLEDGKWNYRPLMLGMTAWSTNPDYAEIILQTIVDNKLP* |
| JGI11705J14877_101697361 | 3300001419 | Saline Water And Sediment | EQQIDDGKWNYRELLEGMTAWSTNPDYGAIILSAIVDNQLP* |
| KVRMV2_1014523941 | 3300002231 | Marine Sediment | AKNLETGNWNYKELMNGMTAWSTNPDYAKIIIQAIVDNKLP* |
| JGI25132J35274_10697083 | 3300002483 | Marine | KFRTAREHQIDAGKWNYRQLLAGMTAWSTNPDYQEIILQTIVDNKLP* |
| Ga0074648_11863971 | 3300005512 | Saline Water And Sediment | YELFRERKEQQIDDGRWNYRELLEGMTAWSTNPDYGAIILSAIVDNQLP* |
| Ga0074647_10134431 | 3300005611 | Saline Water And Sediment | LFRERKEQQIDDGKWNYRELLEGMTAWSTNPDYGAIILSAIVDNQLP* |
| Ga0075108_1000525810 | 3300005913 | Saline Lake | EDQIDDGKWDYRRLMVRMSAWSTNPDYHEIVLQAIVDSKLP* |
| Ga0075445_101665851 | 3300006193 | Marine | GKWNYRRLMVRLGAWSTNPDYHEIVLQAIVDSKLP* |
| Ga0098055_13912041 | 3300006793 | Marine | KWDYGRLLSGMTAWSTNPDYKKIILQTIVDNKLP* |
| Ga0070746_104291222 | 3300006919 | Aqueous | YDLFRERKERQIDDGKWNYRELLEGMTAWSTNPDYGAIILSAIVDNQLP* |
| Ga0075444_103838731 | 3300006947 | Marine | QLDDGNWNYRRLMVRMNAWSTNPDYHEIILQAVVDNKLP* |
| Ga0075460_102977692 | 3300007234 | Aqueous | FRERKEQQIDDGKWNYRELLEGMTAWSTNPNYGAIILSAIVDNQLP* |
| Ga0099851_11998793 | 3300007538 | Aqueous | QIDDGKWNYRELLEGMTAWSTNPDYGAIILSAIVDNQLP* |
| Ga0099851_13662212 | 3300007538 | Aqueous | DDGKWNYRELLEGMTAWSTNPDYGAIILSAIVDNQLP* |
| Ga0102945_10474474 | 3300007609 | Pond Water | ELFRERKEQQIDDGKWNYRELLEGMTAWSTNPDYGAIILSAIVDNQLP* |
| Ga0114916_10229571 | 3300008221 | Deep Ocean | QLDDGQWNYRKLMVLMNAWSTNPDYHEIILQAVVDNKLP* |
| Ga0115552_14227711 | 3300009077 | Pelagic Marine | YKEFREEREDQIDAGKWDYRRLMVRMSAWSTNPDYHEIVLQAIVDSKLP* |
| Ga0115551_13188291 | 3300009193 | Pelagic Marine | EREKQMDSGKWNYRTLMVLMNAWSTNPDYHEIILQAIVDNKLP* |
| Ga0114994_108765431 | 3300009420 | Marine | QLDSGRWNYRRLMVRMSAWSTNPDYAEMILQAIVDNKLP* |
| Ga0115548_12168831 | 3300009423 | Pelagic Marine | QQLETGTWDYRKLLSGMTAWSTNPDYQEIILQTIVDNKLP* |
| Ga0114997_101891491 | 3300009425 | Marine | GNWNYRRLMVRMNAWSTNPDYHEIILQAVVDNKLP* |
| Ga0115546_11930963 | 3300009435 | Pelagic Marine | REEQIKDGEWNYSELLSGMTAWSTNPDYQKIILSAIVDNKLP* |
| Ga0115546_12125443 | 3300009435 | Pelagic Marine | ESRAEQLEDGKWNYRQLMLGMTAWSTNPDYAEIILQTIVDNKLP* |
| Ga0115007_113004932 | 3300009441 | Marine | PAYKEFRVEREQQLDHGKWNYRKLMVLMNAWSTNPDYHEIILQAIVDNKLP* |
| Ga0115554_13311573 | 3300009472 | Pelagic Marine | DDGKWDYRRLMVRMSAWSTNPDYHEIVLQAIVDSKLP* |
| Ga0114932_104318393 | 3300009481 | Deep Subsurface | YKEFRIEREKQLDIGKWNYRELMVRMSAWSTNPDYAEIILQAIVDNKLP* |
| Ga0115564_104146381 | 3300009505 | Pelagic Marine | KWNYRSLLAGMTAWSSNPDYQEIILQTIVDNKLP* |
| Ga0115572_106230822 | 3300009507 | Pelagic Marine | ERQLDDGKWNYRELMLGMTAWSTNPDYAEIILQTIVDNKLP* |
| Ga0115572_108044731 | 3300009507 | Pelagic Marine | REYRAEQLEDGKWNYSKLLSGMTAWSTNPDYQNIILSAIVDNKLP* |
| Ga0115001_101017306 | 3300009785 | Marine | EFRIERESQLDSGRWNYRRLMVRMSAWSTNPDYAEMILQAIVDNKLP* |
| Ga0115012_110076581 | 3300009790 | Marine | QIDKGQWDYRALMVRMSAWSTNPDYAEIILQAIVDNKLP* |
| Ga0129345_12883312 | 3300010297 | Freshwater To Marine Saline Gradient | DGKWNYRELLEGMTAWSTNPDYGAIILSAIVDNQLP* |
| Ga0133547_102292501 | 3300010883 | Marine | QLDAGKWNYRRLMVRMNAWSTNPDYHEIILQAIVDNKLP* |
| Ga0133547_106309814 | 3300010883 | Marine | GKWNYRTLMVLMNAWSTNPDYHEIILQAIVDNKLP* |
| Ga0151671_10698331 | 3300011253 | Marine | DDGTWNYRKLMVLMNAWSTNPDYHEIILQAIVDNKLP* |
| Ga0160423_104315001 | 3300012920 | Surface Seawater | ARENQIDKGKWNYKELLAGITAWSTNPEYVKIIWTAIVDNNLP* |
| Ga0163111_107453271 | 3300012954 | Surface Seawater | AEFRIEREKQLDKGVWNYRALMVLLSAWSTNPDYAEIILQAIVDNKLP* |
| Ga0129327_105097772 | 3300013010 | Freshwater To Marine Saline Gradient | GKWNYRELLEGMTAWSTNPDYGAIILSAIVDNQLP* |
| Ga0116832_10819272 | 3300013231 | Marine | LFRERKEQQIDAGKWNYRELLEGMTAWSTNPDYGAIILSAIVDNQLP* |
| Ga0134293_10184804 | 3300014973 | Marine | GNWNYRKLMVLMNAWSTNPDYHEIILQAIVDNKLP* |
| Ga0181388_10739721 | 3300017724 | Seawater | QLETGTWDYRRLLSGMTAWSTNPDYQEIILQTIVDNKLP |
| Ga0181428_10577791 | 3300017738 | Seawater | EKFREARATQLEDGKWNYRSLLSGMTAWSTNPDYQKIILQTIVDNKLP |
| Ga0181421_10355581 | 3300017741 | Seawater | PAYKDFRIERESQIDRGKWDYRALMVRMSAWSTNPDYAEIILQAIVDNKLP |
| Ga0181421_10805451 | 3300017741 | Seawater | NLETGKWDYRELLSGMTAWSTNPDYKEIILQAIVDNKLP |
| Ga0181409_10001531 | 3300017758 | Seawater | FREARATQLEDGKWNYRSLLSGMTAWSTNPDYQKIILQTIVDNKLP |
| Ga0181422_12035943 | 3300017762 | Seawater | DKGQWDYRALMVRMNAWSTNPDYAEIILQAIVDNKLP |
| Ga0181385_10845531 | 3300017764 | Seawater | GKWNYRQLMSGMTAWSTNPDYAEIILQTIVDNKLP |
| Ga0187217_12465811 | 3300017770 | Seawater | AQLETGKWNYRSLLAGMTAWSTNPDYQEIILQTIVDNKLP |
| Ga0181380_12349253 | 3300017782 | Seawater | EREKQLEKGKWNYRPLMLGMTAWSTNPEYAEIILQTIVDNKLP |
| Ga0181581_104675303 | 3300017962 | Salt Marsh | DDGKWNYRELLEGMTAWSTNPDYGAIILSAIVDNNLP |
| Ga0181589_107215703 | 3300017964 | Salt Marsh | QQLDSGKWNYRELMEGMTAWSTNPDYSTIILSAIVDNQLP |
| Ga0181590_101946043 | 3300017967 | Salt Marsh | AYELFRERKEQQIDDGKWNYRELLEGMTAWSTNPDYGAIILSAIVDNQLP |
| Ga0181590_111336592 | 3300017967 | Salt Marsh | DGKWNYRELLEGMTAWSTNPDYGAIILSAIVDNQLP |
| Ga0181587_100901741 | 3300017968 | Salt Marsh | KEQQLDSGKWNYRELMEGMTAWSTNPDYSTIILSAIVDNQLP |
| Ga0181569_103793403 | 3300017986 | Salt Marsh | GEWNYSELLSGMTAWSTNEDYAKIILSTIVDNKLP |
| Ga0181572_102448541 | 3300018049 | Salt Marsh | QIADGEWNYSQLLSGMTAWSTNGDYQKIILSAIVDNKLP |
| Ga0181558_103233203 | 3300018417 | Salt Marsh | EKFRKHRSKQLEEGEWNYSLLLSGMTAWSTNPDYQKIILSTIVDNKLP |
| Ga0181591_106634223 | 3300018424 | Salt Marsh | FRERKEQQIDAGKWNYRELLGGMTAWSTNPDYGAIILSAIVDNQLP |
| Ga0181591_108321291 | 3300018424 | Salt Marsh | KQLDAGKWNYRKLMARMSAWSTNPDYAEIILQAIVDNKLP |
| Ga0181566_107050242 | 3300018426 | Salt Marsh | LEDGKWNYSVLLSGMTAWSTNPDYQKIILSTIVANKLP |
| Ga0181555_12176393 | 3300020051 | Salt Marsh | QIEDGEWNYSQLLSGMTAWSTNPDYQKIILSTIVDNKLP |
| Ga0181595_100977734 | 3300020053 | Salt Marsh | RELRAEQLEAGKWNYKLLLSGMTAWSTNPDYQNIILATIVDNKLP |
| Ga0206124_103503091 | 3300020175 | Seawater | EFRIEREKQMDSGKWNYRTLMVLMNAWSTNPDYHEIILQAIVDNKLP |
| Ga0181556_11088834 | 3300020176 | Salt Marsh | RAEREQQIDEGRWDYRRLMERKSAWSTNPDYTEIILQAIVDNQLP |
| Ga0181597_101209231 | 3300020194 | Salt Marsh | YEKFRKYREEQLEDGKWNYSVLLSGMTAWSTNPDYQKIILSTIVANKLP |
| Ga0211703_101589311 | 3300020367 | Marine | LDKGKWDYKKLLEGITAWSTNPDYTKIIWTAIVDNNLP |
| Ga0211683_101486911 | 3300020372 | Marine | LDDGQWNYRKLMVLMNAWSTNPDYHEIILQAVVDNKLP |
| Ga0211477_100434881 | 3300020374 | Marine | EQLENGKWNYRQLMMGMTAWSTNPDYAEIILQTIVDNRLP |
| Ga0211705_102740793 | 3300020395 | Marine | KQIDKGKWDYRVLLKGMTAWSTNPDYHEIILQSIVDNKLP |
| Ga0211653_102258753 | 3300020421 | Marine | NLESGKWDYGRLLSGMTAWSTNPDYKKIILQTIVDNKLP |
| Ga0211708_100463241 | 3300020436 | Marine | RETRKQNLETGKWNYRELMNGMTAWSTNPDYAEIIIQAIVDNKLP |
| Ga0211643_103848221 | 3300020457 | Marine | RESQIDKGTWDYRSLMVRMSAWSTNPDYAEIILQAIVDNKLP |
| Ga0211676_106898962 | 3300020463 | Marine | LEDGKWNYRSLLSGMTAWSTNPDYQKIILQTIVDNKLP |
| Ga0211640_100538281 | 3300020465 | Marine | KDFRIEREKQIDTGKWDYKALMVRMSAWSTNPEYADIILKAIVDNKLP |
| Ga0211713_101215093 | 3300020467 | Marine | SQFRIDREKQIDKGKWDYRVLLKGMTAWSTNPDYHEIILQSIVDNKLP |
| Ga0211475_104028253 | 3300020468 | Marine | GKWDYRALMVRMSAWSTNPDYAEIILQAIVDNKLPK |
| Ga0211614_101229271 | 3300020471 | Marine | FRVERENQIDKGKWNYRNLMVLMSAWSTNPDYAEIILQAIVDNKLP |
| Ga0211541_101640363 | 3300020475 | Marine | IGRWNYRELMIRMNAWSTNPDYHEIILQAIVDNKLP |
| Ga0206126_100458655 | 3300020595 | Seawater | PAYKEFRIEREKQIDSGKWNYRTLMVLMNAWSTNPDYHEIILQAIVDNKLP |
| Ga0206680_101024373 | 3300021352 | Seawater | GKWNYKKLLEGISAWSINEDYSKIISKAIVDRNLP |
| Ga0213869_102732763 | 3300021375 | Seawater | DYREEQIEDGEWNYSELLSSMTAWSTNPDYQNIILATIVDNKLP |
| Ga0222717_105740332 | 3300021957 | Estuarine Water | LFRERKEQQIDAGKWNYRELLEGMTAWSTNPDYGAIILSTIVDNQLP |
| Ga0222718_103840963 | 3300021958 | Estuarine Water | QQIDAGKWNYRELLEGMTAWSTNPDYGAIILSAIVDNQLP |
| Ga0222719_101180465 | 3300021964 | Estuarine Water | EFREEREDQIDDGKWDYRRLMVRMSAWSTNPDYHEIVLQAIVDNKLP |
| Ga0222719_102160013 | 3300021964 | Estuarine Water | GKWNYRPLMMGMTAWSTNPDYAEIILQTIVDNKLP |
| Ga0222632_10090517 | 3300022842 | Saline Water | ERESQLDAGRWNYRRLMVRMSAWSTNPDYAEMILQAIVDNKLP |
| Ga0222668_10301683 | 3300022865 | Saline Water | TGKWDYRRLMVRMSAWSTNPDYHEIVLQAIVDSKLP |
| Ga0255781_101295513 | 3300022934 | Salt Marsh | EKFREYREEQIADGEWNYSQLLSGMTAWSTNGDYQKIILSAIVDNKLP |
| Ga0255770_105011571 | 3300022937 | Salt Marsh | FRERKEQQLDSGKWNYRELMEGMTAWSTNPDYSTIILSAIVDNQLP |
| Ga0255782_104457571 | 3300023105 | Salt Marsh | LEDGKWNYKLLLSGMTAWSTNPDYQKIILSTIVDNKLP |
| Ga0255743_102716363 | 3300023110 | Salt Marsh | YEKFREYREVQIADGEWNYSQLLSGMTAWSTNPDYQKIILSTIVDNKLP |
| Ga0255751_100521981 | 3300023116 | Salt Marsh | VRERKEQQIDDGKWNYRELLEGMTAWSTNPDYGAIILSAIVDNQLP |
| Ga0255777_1003379510 | 3300023175 | Salt Marsh | EQLEDGKWNYSELLSGMTAWSTNPNYQKIILSAIVDNKLP |
| Ga0255768_105299892 | 3300023180 | Salt Marsh | RERKEQQIDAGKWNYRELLGGMTAWSTNPDYGAIILSAIVDNQLP |
| Ga0222650_10601341 | 3300023237 | Saline Water | FRIERESQLDAGRWNYRRLMVRMSAWSTNPDYAEMILQAIVDNKLP |
| Ga0228658_11292051 | 3300024297 | Seawater | ERELQLETGKWNYRSLMSGMTAWSTNPDYQEIILQTIVDNKLP |
| Ga0244775_108497662 | 3300024346 | Estuarine | TSTWNYRELLSGMTAWSTNPDYSEIILQTIVDNKLP |
| Ga0209232_11798093 | 3300025132 | Marine | NAQLEDGEWNYSELLSGMTAWSTNPDYQKIILSAIVDNKLP |
| Ga0209634_10795351 | 3300025138 | Marine | FREEREDQIDTGKWDYRRLMVRMSAWSTNPDYHEIVLQAIVDSKLP |
| Ga0208646_10050807 | 3300025425 | Saline Lake | REKQLDSGKWNYRTLMVLMNAWSTNPDYHEIILQAIVDNKLL |
| Ga0208770_10363583 | 3300025438 | Saline Lake | KEFREEREDQIDDGKWDYRRLMVRMSAWSTNPDYHEIVLQAIVDNKLP |
| Ga0208903_10159317 | 3300025502 | Saline Lake | EREDQIDDGKWDYRRLMVRMSAWSTNPDYHEIVLQAIVDSKLP |
| Ga0208660_11152223 | 3300025570 | Aqueous | QLETGRWNYRELLSGMTAWSTNPDYQEIILQTIVDNKLP |
| Ga0209194_10844973 | 3300025632 | Pelagic Marine | TGKWNYRSLLAGMTAWSTNPDYQEIILQTIVDNKLP |
| Ga0209194_11393472 | 3300025632 | Pelagic Marine | RIEREKQMDSGKWNYRTLMVLMNAWSTNPDYHEIILQAIVDNKLP |
| Ga0209198_10617981 | 3300025640 | Pelagic Marine | FRSARELQLETGTWNYHELLSGMTAWSTNPDYAEIILQTIVDNKLPQ |
| Ga0208161_10368234 | 3300025646 | Aqueous | EQQIDDGKWNYRELLEGMTAWSTNPDYGAIILSAIVDNQLP |
| Ga0209095_11423491 | 3300025685 | Pelagic Marine | QLETGKWNYRSLLAGMTAWSTNPDYQEIILQTIVDNKLP |
| Ga0209406_11082914 | 3300025694 | Pelagic Marine | KFREYRAEQSEAGEWNYSELLSGMTAWSTNPDYQNIILSAIVDNKLP |
| Ga0209532_10209568 | 3300025696 | Pelagic Marine | KQLETGKWNYRSLLAGMTAWSTNPDYQEIILQTIVDNKLP |
| Ga0209600_11549121 | 3300025821 | Pelagic Marine | LETGKWNYRPLMIGMTAWSTNPDYAEIILQTIVDNKLP |
| Ga0208917_10700975 | 3300025840 | Aqueous | RERKEQQIDDGKWNYRELLEGMTAWSTNPDYGAIILSAIVDNQLP |
| Ga0209603_12767013 | 3300025849 | Pelagic Marine | SGKWNYRTLMVLMNAWSTNPDYHEIILQAIVDNKLP |
| Ga0209223_101750631 | 3300025876 | Pelagic Marine | SDLYKEFRIEREKQMDSGKWNYRTLMVLMNAWSTNPDYHEIILQAIVDNKLP |
| Ga0208644_12499543 | 3300025889 | Aqueous | EQQIDEGRWNYRRLMERKSAWSTNPDYAEIILQAIVDNQLP |
| Ga0209816_12093891 | 3300027704 | Marine | KQLDAGNWNYRKLMVLMNAWSTNPDYHEIILQAIVDNKLP |
| Ga0209192_100845111 | 3300027752 | Marine | RVEREQQLDDGTWNYRKLMVLMNAWSTNPDYHEIILQAIVDNKLP |
| Ga0209192_102282433 | 3300027752 | Marine | YKEFREEREGQLDDGKWNYRRLMVRMGAWSTNPDYHEIVLQAIVDSKLP |
| Ga0209709_101140253 | 3300027779 | Marine | KEFRVEREKQLDDGNWNYRRLMVRMNAWSTNPDYHEIILQAVVDNKLP |
| Ga0209502_100215031 | 3300027780 | Marine | RIEREKQLDAGNWNYRKLMVLMNAWSTNPDYHEIILQAIVDNKLP |
| Ga0209502_102821431 | 3300027780 | Marine | AYKEFREEREDQIDAGKWDYRRLMVRMSAWSTNPDYHEIVLQAIINNQLP |
| Ga0209830_101253251 | 3300027791 | Marine | FRVEREQQLDDGMWNYRKLMVLMNAWSTNPDYHEIILQAIVDNKLP |
| Ga0209091_101799923 | 3300027801 | Marine | KQLDDGKWNYRKLMVLMNAWSTNPDYHEIILQAIVDNKLP |
| Ga0209091_103948491 | 3300027801 | Marine | RIEREQQLDHGKWNYRKLMVLMNAWSTNPDYHEIILQAIVDNKLP |
| Ga0209090_101651773 | 3300027813 | Marine | GKWNYRRLMVRMNAWSTNPDYHEIILQAIVDNKLP |
| Ga0209404_102477461 | 3300027906 | Marine | RENQIDKGQWDYRALMVLMSAWSTNPDYAEIILQAIVDNKLP |
| Ga0228674_10990061 | 3300028008 | Seawater | TQLEDGKWNYRPLMLGMTAWSTNPDYAEIILQTIVDNKLP |
| Ga0257110_10461761 | 3300028197 | Marine | KEFRIEREKQLDAGNWNYRKLMVLMNAWSTNPDYHEIILQAIVDNKLP |
| Ga0308010_11039525 | 3300031510 | Marine | KQLDDGNWNYRRLMVRMNAWSTNPDYHEIILQAVVDNKLP |
| Ga0307488_105361583 | 3300031519 | Sackhole Brine | DAGKWDYRRLMVRMSAWSTNPDYHEIVLQAIVDSKLP |
| Ga0308019_100510661 | 3300031598 | Marine | GKWDYRRLLSGMTAWSTNPDYAEIILQTIVDNKLP |
| Ga0302132_104301193 | 3300031605 | Marine | EFREEREDQIDDGKWDYRRLMVRMSAWSTNPDYHEIVLQAIVDSKLP |
| Ga0302121_100648872 | 3300031626 | Marine | RAYKEFREEREDQIDAGKWDYRRLMVRMSAWSTNPDYHEIVLQAIINNQLP |
| Ga0308018_102611182 | 3300031655 | Marine | EQLDSGRWHYRRLMVRMNAWSTNPDYAEMILQAIVDNKLP |
| Ga0302122_100618461 | 3300031675 | Marine | LDDGNWNYRRLMVRMNAWSTNPDYHEIILQAVVDNKLP |
| Ga0310343_105499113 | 3300031785 | Seawater | KGKWDYRSLMVRMSAWSTNPDYAEIILKAIVDNKLP |
| Ga0315320_101945254 | 3300031851 | Seawater | AYEKFRGYREEQIADGEWNYSELLSGMTAWSTNPDYQKIILSTIVDNKLP |
| Ga0315320_103500483 | 3300031851 | Seawater | EKFRIERELQLETGKWNYRSLMSGMTAWSTNPDYQEIILQTIVDNKLP |
| Ga0302127_104188052 | 3300032151 | Marine | KEFRKEREDQIDDGKWDYRRLMVRMSAWSTNPDYHEIVLQAIVDNKLP |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |