| Basic Information | |
|---|---|
| Family ID | F054112 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 140 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MPHTRDVPDDAPPFLGTWRRVYTATLIYLVLIIFVCYLFTRVYR |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 140 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.86 % |
| % of genes near scaffold ends (potentially truncated) | 12.86 % |
| % of genes from short scaffolds (< 2000 bps) | 85.71 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.571 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (7.143 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.571 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.857 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.67% β-sheet: 0.00% Coil/Unstructured: 58.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 140 Family Scaffolds |
|---|---|---|
| PF00474 | SSF | 56.43 |
| PF02567 | PhzC-PhzF | 6.43 |
| PF07715 | Plug | 3.57 |
| PF07635 | PSCyt1 | 1.43 |
| PF08388 | GIIM | 1.43 |
| PF09335 | SNARE_assoc | 1.43 |
| PF05227 | CHASE3 | 1.43 |
| PF05685 | Uma2 | 0.71 |
| PF13895 | Ig_2 | 0.71 |
| PF00905 | Transpeptidase | 0.71 |
| PF12840 | HTH_20 | 0.71 |
| PF13649 | Methyltransf_25 | 0.71 |
| PF01618 | MotA_ExbB | 0.71 |
| PF12681 | Glyoxalase_2 | 0.71 |
| PF03358 | FMN_red | 0.71 |
| PF08448 | PAS_4 | 0.71 |
| PF12543 | DUF3738 | 0.71 |
| PF01135 | PCMT | 0.71 |
| PF13243 | SQHop_cyclase_C | 0.71 |
| PF01656 | CbiA | 0.71 |
| PF15919 | HicB_lk_antitox | 0.71 |
| PF00903 | Glyoxalase | 0.71 |
| PF14622 | Ribonucleas_3_3 | 0.71 |
| PF05016 | ParE_toxin | 0.71 |
| PF13432 | TPR_16 | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 140 Family Scaffolds |
|---|---|---|---|
| COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 6.43 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 1.43 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 1.43 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 1.43 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.71 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.71 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.71 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.71 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.57 % |
| Unclassified | root | N/A | 1.43 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459004|F62QY1Z02GFIN2 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 2170459019|G14TP7Y02GI6YR | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 692 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_103075519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 574 | Open in IMG/M |
| 3300002538|JGI24132J36420_10154101 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300002568|C688J35102_118387901 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300004631|Ga0058899_11386322 | Not Available | 636 | Open in IMG/M |
| 3300005329|Ga0070683_100723115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 954 | Open in IMG/M |
| 3300005330|Ga0070690_101680145 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300005334|Ga0068869_101158092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 678 | Open in IMG/M |
| 3300005367|Ga0070667_101801136 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300005456|Ga0070678_101227487 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 696 | Open in IMG/M |
| 3300005458|Ga0070681_11278799 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300005458|Ga0070681_11493372 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300005459|Ga0068867_101435572 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300005459|Ga0068867_102027865 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300005466|Ga0070685_10744657 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300005526|Ga0073909_10297113 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300005531|Ga0070738_10034712 | All Organisms → cellular organisms → Bacteria | 3439 | Open in IMG/M |
| 3300005543|Ga0070672_100529772 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300005563|Ga0068855_100142254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2733 | Open in IMG/M |
| 3300005616|Ga0068852_100334971 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
| 3300005764|Ga0066903_107212912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 575 | Open in IMG/M |
| 3300005938|Ga0066795_10096120 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300005944|Ga0066788_10016745 | All Organisms → cellular organisms → Bacteria | 1597 | Open in IMG/M |
| 3300005993|Ga0080027_10005702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4606 | Open in IMG/M |
| 3300005993|Ga0080027_10278705 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300006046|Ga0066652_101916110 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300006052|Ga0075029_100781647 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300006162|Ga0075030_100303882 | All Organisms → cellular organisms → Bacteria | 1275 | Open in IMG/M |
| 3300006162|Ga0075030_100388337 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300006162|Ga0075030_100470868 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| 3300006162|Ga0075030_100566376 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300006162|Ga0075030_101359955 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300006162|Ga0075030_101420062 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300006237|Ga0097621_102086014 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300006642|Ga0075521_10129653 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300006642|Ga0075521_10435670 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300006642|Ga0075521_10528695 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300006795|Ga0075520_1036172 | All Organisms → cellular organisms → Bacteria | 2423 | Open in IMG/M |
| 3300006795|Ga0075520_1233695 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300006864|Ga0066797_1066177 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300009029|Ga0066793_10219196 | Not Available | 1106 | Open in IMG/M |
| 3300009098|Ga0105245_11297852 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300009098|Ga0105245_11451842 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300009101|Ga0105247_10425333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 952 | Open in IMG/M |
| 3300009148|Ga0105243_11326015 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300009177|Ga0105248_10673433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1167 | Open in IMG/M |
| 3300009551|Ga0105238_10992513 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300009553|Ga0105249_10800231 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300009660|Ga0105854_1001889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8404 | Open in IMG/M |
| 3300009662|Ga0105856_1192247 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300010358|Ga0126370_11827974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 589 | Open in IMG/M |
| 3300010376|Ga0126381_104677072 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300010399|Ga0134127_13568084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 510 | Open in IMG/M |
| 3300010400|Ga0134122_12197942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 595 | Open in IMG/M |
| 3300010401|Ga0134121_11680785 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300010403|Ga0134123_12274585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 605 | Open in IMG/M |
| 3300011119|Ga0105246_10122774 | All Organisms → cellular organisms → Bacteria | 1927 | Open in IMG/M |
| 3300011119|Ga0105246_11020088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 750 | Open in IMG/M |
| 3300011444|Ga0137463_1172953 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300012202|Ga0137363_11013778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 705 | Open in IMG/M |
| 3300012350|Ga0137372_10382279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1070 | Open in IMG/M |
| 3300012360|Ga0137375_10277903 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
| 3300012930|Ga0137407_12051251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 546 | Open in IMG/M |
| 3300012984|Ga0164309_11315291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 612 | Open in IMG/M |
| 3300014491|Ga0182014_10130009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1455 | Open in IMG/M |
| 3300014498|Ga0182019_10229967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1212 | Open in IMG/M |
| 3300014498|Ga0182019_11029513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 599 | Open in IMG/M |
| 3300014502|Ga0182021_10480325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1480 | Open in IMG/M |
| 3300014502|Ga0182021_13306796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 538 | Open in IMG/M |
| 3300015197|Ga0167638_1008949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2366 | Open in IMG/M |
| 3300015371|Ga0132258_10535848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter | 2932 | Open in IMG/M |
| 3300015374|Ga0132255_105848407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 520 | Open in IMG/M |
| 3300016294|Ga0182041_11345336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 654 | Open in IMG/M |
| 3300016445|Ga0182038_10626163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 931 | Open in IMG/M |
| 3300018004|Ga0187865_1318545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 511 | Open in IMG/M |
| 3300018058|Ga0187766_10849518 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 641 | Open in IMG/M |
| 3300018081|Ga0184625_10378747 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300018468|Ga0066662_12099588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 592 | Open in IMG/M |
| 3300018482|Ga0066669_12152586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 528 | Open in IMG/M |
| 3300019785|Ga0182022_1337175 | All Organisms → cellular organisms → Bacteria | 1634 | Open in IMG/M |
| 3300021168|Ga0210406_10089028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2633 | Open in IMG/M |
| 3300021374|Ga0213881_10503497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 549 | Open in IMG/M |
| 3300021478|Ga0210402_10182493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1924 | Open in IMG/M |
| 3300023091|Ga0224559_1005345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 6063 | Open in IMG/M |
| 3300023091|Ga0224559_1023357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2596 | Open in IMG/M |
| 3300023091|Ga0224559_1254086 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300024238|Ga0224523_1092320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 705 | Open in IMG/M |
| 3300025481|Ga0208079_1005253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 5489 | Open in IMG/M |
| 3300025495|Ga0207932_1019190 | All Organisms → cellular organisms → Bacteria | 1884 | Open in IMG/M |
| 3300025650|Ga0209385_1176780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 611 | Open in IMG/M |
| 3300025906|Ga0207699_11418715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 514 | Open in IMG/M |
| 3300025908|Ga0207643_11150052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 500 | Open in IMG/M |
| 3300025912|Ga0207707_11246248 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300025913|Ga0207695_11019508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 707 | Open in IMG/M |
| 3300025925|Ga0207650_11192539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 648 | Open in IMG/M |
| 3300025930|Ga0207701_11014799 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300025944|Ga0207661_11342070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 657 | Open in IMG/M |
| 3300025949|Ga0207667_10092408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3125 | Open in IMG/M |
| 3300025986|Ga0207658_10732254 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300026215|Ga0209849_1000346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 8202 | Open in IMG/M |
| 3300026221|Ga0209848_1005268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2657 | Open in IMG/M |
| 3300026223|Ga0209840_1058066 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300026273|Ga0209881_1137948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 609 | Open in IMG/M |
| 3300026281|Ga0209863_10003024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 5959 | Open in IMG/M |
| 3300026551|Ga0209648_10752241 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300026865|Ga0207746_1022024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 527 | Open in IMG/M |
| 3300027911|Ga0209698_10354532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1153 | Open in IMG/M |
| 3300027911|Ga0209698_10807394 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300027911|Ga0209698_11366592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 517 | Open in IMG/M |
| 3300028379|Ga0268266_10738565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 950 | Open in IMG/M |
| 3300028379|Ga0268266_11182270 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300028652|Ga0302166_10077749 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300028743|Ga0302262_10313272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 533 | Open in IMG/M |
| 3300029923|Ga0311347_10816428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 567 | Open in IMG/M |
| 3300029990|Ga0311336_10538898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 992 | Open in IMG/M |
| 3300030002|Ga0311350_11066460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 722 | Open in IMG/M |
| 3300030294|Ga0311349_10945844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 809 | Open in IMG/M |
| 3300030838|Ga0311335_11054484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 581 | Open in IMG/M |
| 3300031231|Ga0170824_117826663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 658 | Open in IMG/M |
| 3300031232|Ga0302323_100257211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1792 | Open in IMG/M |
| 3300031232|Ga0302323_102370688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 605 | Open in IMG/M |
| 3300031344|Ga0265316_10066639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 2786 | Open in IMG/M |
| 3300031573|Ga0310915_10432589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 935 | Open in IMG/M |
| 3300031726|Ga0302321_101545927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 765 | Open in IMG/M |
| 3300031910|Ga0306923_12010929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300031939|Ga0308174_11384609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 602 | Open in IMG/M |
| 3300031942|Ga0310916_11437470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 564 | Open in IMG/M |
| 3300031954|Ga0306926_10146399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2923 | Open in IMG/M |
| 3300031954|Ga0306926_11084792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 948 | Open in IMG/M |
| 3300032066|Ga0318514_10775798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 510 | Open in IMG/M |
| 3300032074|Ga0308173_11684537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 597 | Open in IMG/M |
| 3300032174|Ga0307470_11170364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 623 | Open in IMG/M |
| 3300032261|Ga0306920_102823486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 661 | Open in IMG/M |
| 3300032770|Ga0335085_11362016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 746 | Open in IMG/M |
| 3300032783|Ga0335079_10035294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 5741 | Open in IMG/M |
| 3300033433|Ga0326726_12379553 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300034170|Ga0370487_0341088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 512 | Open in IMG/M |
| 3300034282|Ga0370492_0006130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4857 | Open in IMG/M |
| 3300034282|Ga0370492_0032492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2145 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 7.14% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 7.14% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 6.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.29% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 4.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.57% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 3.57% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.57% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.86% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.86% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 2.86% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.14% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 2.14% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 2.14% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.14% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.43% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.43% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.43% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.43% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.43% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.43% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.71% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.71% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.71% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.71% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.71% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.71% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.71% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.71% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.71% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.71% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.71% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.71% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.71% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.71% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.71% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459004 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm (2) | Environmental | Open in IMG/M |
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300002538 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-212 | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
| 3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009660 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 | Environmental | Open in IMG/M |
| 3300009662 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015197 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019785 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300023091 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34 | Environmental | Open in IMG/M |
| 3300024238 | Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T50 | Environmental | Open in IMG/M |
| 3300025481 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025495 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025650 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
| 3300026221 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 (SPAdes) | Environmental | Open in IMG/M |
| 3300026223 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes) | Environmental | Open in IMG/M |
| 3300026273 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 (SPAdes) | Environmental | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026865 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 75 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028652 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_3 | Environmental | Open in IMG/M |
| 3300028743 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4 | Environmental | Open in IMG/M |
| 3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034170 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_16 | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4B_00560150 | 2170459004 | Grass Soil | MPHTRDVPDDAPPFLRTWRRVYTATLIYLVFIIFVCYLFTRVYR |
| 4MG_01515730 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | MHPRDVPDEGPPFLGTWRRVYTGIVIYLAVLITGFYLFTLAYR |
| JGIcombinedJ13530_1030755192 | 3300001213 | Wetland | MSEMPHTRDVPDEAPPFLGTWKRVYVAALVYLAVVIGLCGVFTAVYR* |
| JGI24132J36420_101541012 | 3300002538 | Arctic Peat Soil | MPHTRDVPDEAPPFLRTWRRVYTATLIYLVLIIFVCYLFTRFYR* |
| C688J35102_1183879012 | 3300002568 | Soil | MPHTRDVPDDAPPFLGTWRRVYTATLIYLVLIIFACYLFTRVYR* |
| Ga0058899_113863222 | 3300004631 | Forest Soil | VSDRSDLLSHDVPDEAPPFLRTWQRVYTATLIYLVLIIFGFYLFTVAYR* |
| Ga0070683_1007231152 | 3300005329 | Corn Rhizosphere | MQHSRDVPDDPPPFLRTWRRVYTATLIYLALIISACYAFSRFYR* |
| Ga0070690_1016801451 | 3300005330 | Switchgrass Rhizosphere | MPHTRDVPDDAPPFLGTWRRVYTATLIYLVFIIFVCYLFTRVYR* |
| Ga0068869_1011580922 | 3300005334 | Miscanthus Rhizosphere | NMPELREVPDEAPPFLGTWRRVYTAVLIYLGAIILAAYLFTRSYQ* |
| Ga0070667_1018011362 | 3300005367 | Switchgrass Rhizosphere | MPHTRDVPDDAPPFLGTWRRVYTATLIYLVLIIAVCALFTWVYR* |
| Ga0070678_1012274872 | 3300005456 | Miscanthus Rhizosphere | MQHTRDVPDEAPPFLRTWRRVYIATLVYLVLIIGVCYIFTR |
| Ga0070681_112787992 | 3300005458 | Corn Rhizosphere | MRDEDDPPFLGTWRRVYIATMIYLAALIFGFYVFTRMYR* |
| Ga0070681_114933722 | 3300005458 | Corn Rhizosphere | MRDDGKPPFLGTWRRVYAATMIYLAALIFAFYVFTRSYR* |
| Ga0068867_1014355722 | 3300005459 | Miscanthus Rhizosphere | MQHTRDVPDEAPPFLRTWRRVYIATLVYLVLIIGVCYIFTRIYK* |
| Ga0068867_1020278652 | 3300005459 | Miscanthus Rhizosphere | MPHTRDVPDDAPPFLGTWRRVYTATLIYLVVIIFVCYLFTRVYR* |
| Ga0070685_107446572 | 3300005466 | Switchgrass Rhizosphere | MPHTRDVPDDAPPFLGTWRRVYTATLIYLVVIIFACYLFTRVYR* |
| Ga0073909_102971132 | 3300005526 | Surface Soil | FMPHTRDVPDDAPPFLGTWRRVYIATLIYLVFIIFVCYLFTRIYR* |
| Ga0070738_100347123 | 3300005531 | Surface Soil | MPEKANPRDDPPPFLRTWGRVYAVVLVYLALIIFASYLFTRAYR* |
| Ga0070672_1005297722 | 3300005543 | Miscanthus Rhizosphere | MQHSRDVPDDPPPFLRTWRRVYIATLIYLVLIISVCYLFTRIYK* |
| Ga0068855_1001422543 | 3300005563 | Corn Rhizosphere | MRDEDDPPFLGTWRRVYIATMIYLAALIFVFYIFTRMYR* |
| Ga0068852_1003349712 | 3300005616 | Corn Rhizosphere | FMRDEDDPPFLGTWRRVYIATMIYLAALIFAFYVFTRMYR* |
| Ga0066903_1072129122 | 3300005764 | Tropical Forest Soil | MPHTRDVPDEAPPFLGTWRRVYTATLIYLVFIIAACYVFTRVYR* |
| Ga0066795_100961202 | 3300005938 | Soil | MPDTRDVPDDAPPFLRTWRRVYTATLIYLVLIIFVCYLFTRFYR* |
| Ga0066788_100167452 | 3300005944 | Soil | MSPSNGTPLHTHDVPDEAPPFLRTWRRVYFAILIYLVIVIFAFYLFTRAYR* |
| Ga0080027_100057023 | 3300005993 | Prmafrost Soil | MPGTRDVPDEAPPFLRTWRRVYAGILIYLVLIILVFYWFTETYR* |
| Ga0080027_102787051 | 3300005993 | Prmafrost Soil | DVPDEAPPFLRTWRRIYTATLIYLVLIIFAFYLFTEAYR* |
| Ga0066652_1019161102 | 3300006046 | Soil | MPHTRDVPDDAPPFLRTWGRVYTATLIYLVFIIFACYVFTRVYR* |
| Ga0075029_1007816471 | 3300006052 | Watersheds | MPHTRDVPDDAPPFLRTWRRVYTATLIYLVLIVFACYLFTRFYR* |
| Ga0075030_1003038822 | 3300006162 | Watersheds | VKKGSDLLSHDVPDEAPPFLRTWRRVYTATLIYLVLIIFAFYLFTDAYR* |
| Ga0075030_1003883372 | 3300006162 | Watersheds | MSDRSDLLSHDVPDEAPPFLRTWRRVYTGTLIYLVLIIFGFYLFTVAYR* |
| Ga0075030_1004708682 | 3300006162 | Watersheds | MPHTRDVPDDAPPFLRSWRRVYTATLIYLVLIIFACYVFTRVYR* |
| Ga0075030_1005663762 | 3300006162 | Watersheds | MPHTRDVPDHAPPFLGTWRRVYIATLLYLVLIVFVCYLFTRAYR* |
| Ga0075030_1013599551 | 3300006162 | Watersheds | DVPDDAPPFLRTWRRVYTATLIYLVLIVFACYLFTRFYR* |
| Ga0075030_1014200621 | 3300006162 | Watersheds | MPHTRDVPDEAPPFLRTWRRVYTATLIYLVLVISVCYLFTRVYR* |
| Ga0097621_1020860142 | 3300006237 | Miscanthus Rhizosphere | MPHTRDVPDDAPPFLRTWGRVYTATLIYLVFIIFACYVFTWVYR* |
| Ga0075521_101296532 | 3300006642 | Arctic Peat Soil | MPNTRDVPDDAPPFLRTWRRVYTATLIYLALIIFVCYLFTRAYR* |
| Ga0075521_104356701 | 3300006642 | Arctic Peat Soil | MPHTRDVPDDAPPFLRTWRRVYTATLIYLVLIIAACYWFTRVYR* |
| Ga0075521_105286952 | 3300006642 | Arctic Peat Soil | MPHTRDVPDDAPPFLRSWRRVYIATLIYLVIVISACYLFTRVYR* |
| Ga0075520_10361723 | 3300006795 | Arctic Peat Soil | MPHTRDVPDDAPPFLRSWRRVYIATLIYVVIVISACYLFTRVYR* |
| Ga0075520_12336952 | 3300006795 | Arctic Peat Soil | MPHTRDVPDEAPPFLRTWRRVYTATLIYLVLIISVCYLFTRFYR* |
| Ga0066797_10661773 | 3300006864 | Soil | MPHTRDVPDEAPPFLRTWRRVYTATLIYLVIVISACYLFTRVYR* |
| Ga0066793_102191963 | 3300009029 | Prmafrost Soil | MPHTRDVPDEAPPFLRTWRRVYTATLIYLVLIISVCYLFTRVYR* |
| Ga0105245_112978523 | 3300009098 | Miscanthus Rhizosphere | MPHTRDVPDDAPPFLGTWRRVYTATLIYLVFIIFVCYLF |
| Ga0105245_114518422 | 3300009098 | Miscanthus Rhizosphere | MPHTSDVPDDAPPFLGSWRRVYTATLIYLVLIIAVCGLFTWVYR* |
| Ga0105247_104253331 | 3300009101 | Switchgrass Rhizosphere | MHDVPDDAPPFLGTWRRVYTATLIYLVVIIFVCYLFTRVYR* |
| Ga0105243_113260152 | 3300009148 | Miscanthus Rhizosphere | MQHTRDVPDDAPPFLGTWRRVYIATLIYLVLIISVRYLFTWIYK* |
| Ga0105248_106734332 | 3300009177 | Switchgrass Rhizosphere | MPPTRDVPDDAPPFLGTWRRVYTATLIYLVVIIFVCYLFTRVYR* |
| Ga0105238_109925132 | 3300009551 | Corn Rhizosphere | FMRDEDDPPFLGTWRRVYIATMIYLAALIFVFYVFTRMYR* |
| Ga0105249_108002312 | 3300009553 | Switchgrass Rhizosphere | MQHTRDVPDDAPPFLGTWRRVYIATLIYLVFIIGVCYVFTRIYK* |
| Ga0105854_10018896 | 3300009660 | Permafrost Soil | MSPSNGTPLHTHDVPDEAPPLLRTWRRVYFAILIYLVIVIFAFYLFTRAYR* |
| Ga0105856_11922472 | 3300009662 | Permafrost Soil | MPGTRDVPDEALPFLRTWRRVYAGILIYLVLIILVFYWFTETYR* |
| Ga0126370_118279742 | 3300010358 | Tropical Forest Soil | MPHTRDVPDDAPPFLGTWRRVYIATLVYLVFVILACYLFTRVYR* |
| Ga0126381_1046770721 | 3300010376 | Tropical Forest Soil | MPEPRDVPDDAPPFLGSWRRVYAALVVYLAALIFVFYLFTRAYR* |
| Ga0134127_135680842 | 3300010399 | Terrestrial Soil | MRDEDDPPFLGTWRRVYIATMIYLAALIFAFYVFTRMYR* |
| Ga0134122_121979422 | 3300010400 | Terrestrial Soil | MPHTRDVPDDAPPFQRTWGRVYTATLIYLVFIIFACYVFTWVYR* |
| Ga0134121_116807852 | 3300010401 | Terrestrial Soil | MPHTRDVPDDAPPFLGTWRRVYIATLIYLVVIIFVCYLFTRIYR* |
| Ga0134123_122745852 | 3300010403 | Terrestrial Soil | MQHTRDVPDEAPPFLRTWRRVYIATLIYLVLMIGVCYLFTRIYK* |
| Ga0105246_101227742 | 3300011119 | Miscanthus Rhizosphere | MPHTRDVPDDAPPFLGTWRRVYIATLIYLVVIIFVCYLFTRVYR* |
| Ga0105246_110200881 | 3300011119 | Miscanthus Rhizosphere | MQHSRDVPDDPPPFLRTWRRVYTATLIYLVLIISACYAFSRFYR* |
| Ga0137463_11729532 | 3300011444 | Soil | MPHTRDVPDDAPPFLGTWRRVYTATLIYLVLIIFVCYLFTRVYR* |
| Ga0137363_110137782 | 3300012202 | Vadose Zone Soil | MDHLRDVPDEAPPFLRTWRRVYIAIFIYLVVIIFAFYLFTRAYR* |
| Ga0137372_103822792 | 3300012350 | Vadose Zone Soil | MQHTSDVPDDAPPFLRTWRRVYTATLIYLVGIISVCYLFTRIYR* |
| Ga0137375_102779033 | 3300012360 | Vadose Zone Soil | MPHTRDVPDDAPPFLTTWRRVYIATLIYLVLIITVAYLFTRFYR* |
| Ga0137407_120512511 | 3300012930 | Vadose Zone Soil | PPPFLGTWRRVYGAVLVYLFVIILIAYIFTRAYR* |
| Ga0164309_113152911 | 3300012984 | Soil | MPHTRDVPDDAPPFLRTWRRVYTATLIYLVFIIFACYVFTWVYR* |
| Ga0182014_101300092 | 3300014491 | Bog | MPHTRDVPDEAPPFLRTWRRVYTATLIYLALIIFVCYLFTRFYR* |
| Ga0182019_102299671 | 3300014498 | Fen | MPHTRDVSDDAPPFLRSWRRVYIATLIYLVIVISACYLFTLVYR* |
| Ga0182019_110295131 | 3300014498 | Fen | MPHTRDVPDEAPPFLGTWRRVYTATLVYLVLIIFVC |
| Ga0182021_104803251 | 3300014502 | Fen | MPHTRDVPDDAPPFLRTWRRVYTATLIYLVLIIFVCYLFTRFYR* |
| Ga0182021_133067961 | 3300014502 | Fen | MPHTRDVPDEAPPFLGTWRRVYTATLVYLVLIIFVCYLFTRFYR* |
| Ga0167638_10089492 | 3300015197 | Glacier Forefield Soil | MARSNGTPLHTHDVPDEAPPFLRTWRRVYLAILVYLVIVIVAFYLFTRAYR* |
| Ga0132258_105358483 | 3300015371 | Arabidopsis Rhizosphere | MPELREVPDEAPPFLGTWRRVYTAVLIYLGAIILAAYLFTRSYQ* |
| Ga0132255_1058484071 | 3300015374 | Arabidopsis Rhizosphere | VPDDAPPFLGTWRRVYIATLIYLVFIIGVCYVFTRIYK* |
| Ga0182041_113453361 | 3300016294 | Soil | MPEPRDVPDEAPPFLGTWRRVYIATLIYLVFVILACYLFTRIYR |
| Ga0182038_106261632 | 3300016445 | Soil | MPHTSDVPDHAPPFLGTWRRVYIAVLIYQVLIIFSAYLFNRFYR |
| Ga0187865_13185451 | 3300018004 | Peatland | MPHTRDVPDEAPPFLRTWRRVYTATLIYLVLIISACYLFTRVYR |
| Ga0187766_108495182 | 3300018058 | Tropical Peatland | VPDENPPFLGTWRRVYGAILIYLVLIVAAAWIFTRVYR |
| Ga0184625_103787472 | 3300018081 | Groundwater Sediment | MPHTRDVPDEAPPFLGTWRRVYTATLIYLVLIIFVCYLFTRVYR |
| Ga0066662_120995882 | 3300018468 | Grasslands Soil | DVPDEAPPFLGTWRRVYIAVLIYLAFIITAAWMFTRFYR |
| Ga0066669_121525862 | 3300018482 | Grasslands Soil | MQHTRDVPDDAPPFLRTWRRVYTATLLYLVFIISVCYLFTRIYK |
| Ga0182022_13371754 | 3300019785 | Fen | MPHTRDVPDDAPPFLRTWRRVYTATLIYLVLIISVCYLFTRVYR |
| Ga0210406_100890282 | 3300021168 | Soil | MPHTSDVPDHAPPFLGTWRRVYIAVLIYLVLIIFAAYLFTRFYR |
| Ga0213881_105034972 | 3300021374 | Exposed Rock | MPHPRDVPDEKPPFLGAWGRVYTAILIYLVLVIAASWLFTRAYR |
| Ga0210402_101824931 | 3300021478 | Soil | MPHTRDVPDEAPPFLGTWRRVYIAILIYLAAIISIAYLFTRFYR |
| Ga0224559_10053454 | 3300023091 | Soil | MPHTRDVPDEAPPFLRTWRRVYTATLIYLALIIFVCYLFTRFYR |
| Ga0224559_10233574 | 3300023091 | Soil | MPHTRDVPDEAPPFLRTWRRVYTATLIYLVLIISVCYLFTRFYR |
| Ga0224559_12540861 | 3300023091 | Soil | MRHTRDVPDEAPPFLRTWRRVYTATLIYLALIIFACYLFTRAYR |
| Ga0224523_10923202 | 3300024238 | Soil | RDVPDEAPPFLRTWRRVYTATLIYLALIIFVCYLFTRFYR |
| Ga0208079_10052536 | 3300025481 | Arctic Peat Soil | MPHTRDVPDEAPPFLRTWRRVYTATLIYLVLIIFVCYLFTRFYR |
| Ga0207932_10191902 | 3300025495 | Arctic Peat Soil | MPHTRDVPDEAPPFLRTWRRVYTATLIYLVLIIFACYLFTRVYR |
| Ga0209385_11767802 | 3300025650 | Arctic Peat Soil | MPHTRDVPDDAPPFLRSWRRVYIATLIYLVIVISACYLFTRVYR |
| Ga0207699_114187151 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | HTRDVPDDAPPFLRTWRRVYTATLIYLVFIIFACYVFTWVYR |
| Ga0207643_111500522 | 3300025908 | Miscanthus Rhizosphere | MQHSRDVPDDPPPFLRTWRRVYIATLIYLVLIISVCYLFTRIYK |
| Ga0207707_112462482 | 3300025912 | Corn Rhizosphere | MRDDGKPPFLGTWRRVYAATMIYLAALIFAFYVFTRSYR |
| Ga0207695_110195081 | 3300025913 | Corn Rhizosphere | MPHTRDVPDDAPPFLRTWGRVYTATLIYLVFIIFACYVFTWVYR |
| Ga0207650_111925391 | 3300025925 | Switchgrass Rhizosphere | MQHTRDVPDDAPPFLRTWRRVYIATLVYLVLIIGVCYIFTRIYK |
| Ga0207701_110147992 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MPHTRDVPDDAPPFLGTWRRVYTATLIYLVVIIFACYLFTRVYR |
| Ga0207661_113420702 | 3300025944 | Corn Rhizosphere | MPHTRDVPDDAPPFLGTWRRVYTATLIYLVFIIFVCYLFTRVYR |
| Ga0207667_100924084 | 3300025949 | Corn Rhizosphere | MRDEDDPPFLGTWRRVYIATMIYLAALIFVFYIFTRMYR |
| Ga0207658_107322541 | 3300025986 | Switchgrass Rhizosphere | MPHTRDVPDDAPPFLGTWRRVYTATLIYLVLIIAVCALFTWVYR |
| Ga0209849_10003465 | 3300026215 | Soil | MSPSNGTPLHTHDVPDEAPPFLRTWRRVYFAILIYLVIVIFAFYLFTRAYR |
| Ga0209848_10052681 | 3300026221 | Permafrost Soil | MSPSNGTPLHTHDVPDEAPPLLRTWRRVYFAILIYLVIVIFAFYLFTRAYR |
| Ga0209840_10580663 | 3300026223 | Soil | MPDTRDVPDDAPPFLRTWRRVYTATLIYLVLIIFVCYLFTRFYR |
| Ga0209881_11379481 | 3300026273 | Soil | VPDDAPPFLRTWRRVYTATLIYLVLIIFVCYLFTRFYR |
| Ga0209863_100030245 | 3300026281 | Prmafrost Soil | MPGTRDVPDEAPPFLRTWRRVYAGILIYLVLIILVFYWFTETYR |
| Ga0209648_107522412 | 3300026551 | Grasslands Soil | MPHTRDVPDEAPPFLRTWRRVYIATLIYLVLIIFVCYLFTRVYR |
| Ga0207746_10220242 | 3300026865 | Tropical Forest Soil | MPLTRDVPDEAPPFLRSWRRVYTATLVYLALIIAACYLFTRVYR |
| Ga0209698_103545322 | 3300027911 | Watersheds | MPHTRDVPDDAPPFLRTWRRVYTATLIYLVLIVFACYLFTRFYR |
| Ga0209698_108073942 | 3300027911 | Watersheds | MPHTRDVPDDAPPFLRSWRRVYTATLIYLVLIIFACYVFTRVYR |
| Ga0209698_113665921 | 3300027911 | Watersheds | MPHTRDVPDDAPPFLGTWRRVYIGTLIYLAAIIAIAWLFTRFYR |
| Ga0268266_107385652 | 3300028379 | Switchgrass Rhizosphere | MQHTRDVPDDAPPFLGTWRRVYIATLIYLVFIIGVCYVFTRIYK |
| Ga0268266_111822702 | 3300028379 | Switchgrass Rhizosphere | MPHTRDVPDDAPPFLGTWRRVYTATLIYLVVIIFVCYLFTRVYR |
| Ga0302166_100777492 | 3300028652 | Fen | MPHTSDVPDEAPPFLGTWRRVYTAALVYLAAIIGACYVFTWVYR |
| Ga0302262_103132722 | 3300028743 | Fen | MPHTRDVPDDAPPFLRTWRRVYTATLIYLALIIFVCYLFTRFYR |
| Ga0311347_108164281 | 3300029923 | Fen | MPHPSDVPDDAPPFLGTWRRVYIATLIYLVLIITIAYLFTRFYR |
| Ga0311336_105388983 | 3300029990 | Fen | MPHTRDVPDEAPPFLRTWRRVYTATLIYLVLIISVCYLFTRVYR |
| Ga0311350_110664602 | 3300030002 | Fen | MPHTRDVPDEAPPFLRTWRRVYTATLIYLVIIIFVCYLFTRFYR |
| Ga0311349_109458441 | 3300030294 | Fen | MPHTRDVPDDAPPFLRTWRRVYTATLIYLVLIISVCYVFARVYR |
| Ga0311335_110544842 | 3300030838 | Fen | MPHTRDVPDDPPPFLRTWRRVYTATLIYLVLIIFVCYLFTRFYR |
| Ga0170824_1178266632 | 3300031231 | Forest Soil | MPHTRDVPDEAPPFLGTWRRVYVATLIYLVAIISIAWLFTRSYR |
| Ga0302323_1002572112 | 3300031232 | Fen | TPIMPHTSDVPDEAPPFLGTWRRVYTAALVYLAAIIGACYVFTWVYR |
| Ga0302323_1023706882 | 3300031232 | Fen | MPHTRDVPDEAPPFLRTWRRVYTATLIYLVLIIFDCYLFTRFYR |
| Ga0265316_100666392 | 3300031344 | Rhizosphere | MPPARDVPDEAPPFLRTWRRVYTATLISLALIISLCYLFTRAYR |
| Ga0310915_104325892 | 3300031573 | Soil | MPHTRDVPDHAPPFLGTWRRVYIAVVIYQILIIFIAYLFTRFYR |
| Ga0302321_1015459272 | 3300031726 | Fen | MPHTRDVPDDAPPFLRTWRRVYTAALIYLVLIISVCYVFTWVYR |
| Ga0306923_120109291 | 3300031910 | Soil | MHPRDVPDEGPPFLGTWRRVYTGIVIYLAVIITGFYLFTLAYR |
| Ga0308174_113846092 | 3300031939 | Soil | MQHTSDVPDDAPPFLRTWRRVYTATLIYLVLIISACYLFTRIYK |
| Ga0310916_114374702 | 3300031942 | Soil | MPHTRDVPDEAPPFLGTWRRVYTATLIYLVFIIAACYLFTRVYR |
| Ga0306926_101463992 | 3300031954 | Soil | MPEPRDVPDEAPPFLGTWRRVYIAITIYLAALIFGFYLFTRHYR |
| Ga0306926_110847922 | 3300031954 | Soil | MPHTSDVPDHAPPFLGTWRRVYIAVVIYQILIIFIAYLFTRFYR |
| Ga0318514_107757981 | 3300032066 | Soil | RDVPDEAPPFLGTWRRVYIAITIYLAALIFGFYLFTRHYR |
| Ga0308173_116845372 | 3300032074 | Soil | MQHTSDVPDDGPPFLRTWRRVYTATLIYLVLIISACYLFTRIYK |
| Ga0307470_111703641 | 3300032174 | Hardwood Forest Soil | MPHTRDVPDEAPPFLGTWRRVYTATLIYLVLIIFVCYLFTRVYK |
| Ga0306920_1028234862 | 3300032261 | Soil | MPHTRDVPDDAPPFLGTWRRVYIATLIYLVFVILACYLFTRIYR |
| Ga0335085_113620162 | 3300032770 | Soil | MLLSRDVPDEAPPFLRSWKRVYIAVVCYLAGIITLFYLFTRAYR |
| Ga0335079_100352942 | 3300032783 | Soil | MAGPRDVPDDPPPFLRTWRRVYFAVLVYLAGLIGVFYLFTRAYR |
| Ga0326726_123795532 | 3300033433 | Peat Soil | MPHTRDVPDDAPPFLRTWRRVYTATLIYLVLIVSVCYLFTRLYR |
| Ga0370487_0341088_122_256 | 3300034170 | Untreated Peat Soil | MQHTSDVPDDAPPFLRTWRRVYTATLIYLVLIIFVCYLFTRFYR |
| Ga0370492_0006130_4236_4370 | 3300034282 | Untreated Peat Soil | MAHTSDVPDDAPPFLGTWRRVYIATLIYLALVIFGCYLFTRAYR |
| Ga0370492_0032492_13_147 | 3300034282 | Untreated Peat Soil | MAHPSDVSDEAPPFLGTWRRVYAATLAYLALVVFVCYLFTWAYR |
| ⦗Top⦘ |