NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F054057

Metagenome / Metatranscriptome Family F054057

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F054057
Family Type Metagenome / Metatranscriptome
Number of Sequences 140
Average Sequence Length 91 residues
Representative Sequence MRYTALLVVAALLFSSADAITLSKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGVPTGQKVLYKDGAQKAAAEILLVTK
Number of Associated Samples 99
Number of Associated Scaffolds 140

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 10.00 %
% of genes near scaffold ends (potentially truncated) 63.57 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (69.286 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(30.000 % of family members)
Environment Ontology (ENVO) Unclassified
(80.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(77.857 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 37.29%    β-sheet: 8.47%    Coil/Unstructured: 54.24%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms70.00 %
UnclassifiedrootN/A30.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005516|Ga0066831_10022714All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1708Open in IMG/M
3300005516|Ga0066831_10056246All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1065Open in IMG/M
3300006397|Ga0075488_1558970Not Available540Open in IMG/M
3300006803|Ga0075467_10274488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum906Open in IMG/M
3300007513|Ga0105019_1075855All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1902Open in IMG/M
3300007513|Ga0105019_1158102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1169Open in IMG/M
3300007629|Ga0102895_1186232Not Available540Open in IMG/M
3300008993|Ga0104258_1093899All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium561Open in IMG/M
3300009071|Ga0115566_10147874All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1468Open in IMG/M
3300009420|Ga0114994_10475048All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum825Open in IMG/M
3300009434|Ga0115562_1121639All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1004Open in IMG/M
3300009497|Ga0115569_10101520All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1450Open in IMG/M
3300009606|Ga0115102_10524502All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium695Open in IMG/M
3300009606|Ga0115102_10753286Not Available599Open in IMG/M
3300009677|Ga0115104_11270550All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium522Open in IMG/M
3300009679|Ga0115105_10049600All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum502Open in IMG/M
3300009679|Ga0115105_10870488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum547Open in IMG/M
3300009705|Ga0115000_10912278Not Available537Open in IMG/M
3300009785|Ga0115001_10713256Not Available607Open in IMG/M
3300010981|Ga0138316_10705069All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum576Open in IMG/M
3300010985|Ga0138326_11026145Not Available567Open in IMG/M
3300010986|Ga0138327_11045611Not Available564Open in IMG/M
3300010987|Ga0138324_10507535All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum598Open in IMG/M
3300010987|Ga0138324_10515231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum594Open in IMG/M
3300012414|Ga0138264_1220209Not Available652Open in IMG/M
3300012415|Ga0138263_1397235Not Available797Open in IMG/M
3300012416|Ga0138259_1021687All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium631Open in IMG/M
3300012504|Ga0129347_1007212All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium662Open in IMG/M
3300012520|Ga0129344_1270415Not Available540Open in IMG/M
3300012523|Ga0129350_1099571Not Available550Open in IMG/M
3300012782|Ga0138268_1333739Not Available773Open in IMG/M
3300012953|Ga0163179_10369507All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1155Open in IMG/M
3300012965|Ga0129346_1016634Not Available519Open in IMG/M
3300016746|Ga0182055_1105706Not Available532Open in IMG/M
3300018426|Ga0181566_10478553Not Available877Open in IMG/M
3300018692|Ga0192944_1046744All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium621Open in IMG/M
3300018725|Ga0193517_1059098All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum655Open in IMG/M
3300018725|Ga0193517_1059230All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum654Open in IMG/M
3300018725|Ga0193517_1067392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum590Open in IMG/M
3300018725|Ga0193517_1071437All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum563Open in IMG/M
3300018742|Ga0193138_1040928All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum610Open in IMG/M
3300018765|Ga0193031_1057718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum651Open in IMG/M
3300018765|Ga0193031_1059036All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum644Open in IMG/M
3300018779|Ga0193149_1048918All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum602Open in IMG/M
3300018779|Ga0193149_1048919All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum602Open in IMG/M
3300018855|Ga0193475_1047321All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum690Open in IMG/M
3300018862|Ga0193308_1064955All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum596Open in IMG/M
3300018874|Ga0192977_1051585Not Available836Open in IMG/M
3300018968|Ga0192894_10197599All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum664Open in IMG/M
3300018975|Ga0193006_10193074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum599Open in IMG/M
3300018977|Ga0193353_10198319All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum587Open in IMG/M
3300018989|Ga0193030_10168126All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum715Open in IMG/M
3300018989|Ga0193030_10189221Not Available676Open in IMG/M
3300018989|Ga0193030_10204338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum650Open in IMG/M
3300018989|Ga0193030_10295878Not Available525Open in IMG/M
3300019031|Ga0193516_10110039All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum937Open in IMG/M
3300019031|Ga0193516_10110253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum936Open in IMG/M
3300019031|Ga0193516_10132026All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum847Open in IMG/M
3300019031|Ga0193516_10136001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum833Open in IMG/M
3300019031|Ga0193516_10136551All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum831Open in IMG/M
3300019031|Ga0193516_10138052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum826Open in IMG/M
3300019031|Ga0193516_10181828All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum702Open in IMG/M
3300019031|Ga0193516_10193845All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum675Open in IMG/M
3300019031|Ga0193516_10219822Not Available625Open in IMG/M
3300019031|Ga0193516_10262721All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum559Open in IMG/M
3300019036|Ga0192945_10162537All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium719Open in IMG/M
3300019045|Ga0193336_10588954All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum546Open in IMG/M
3300019048|Ga0192981_10225749Not Available724Open in IMG/M
3300019097|Ga0193153_1019963All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum693Open in IMG/M
3300019118|Ga0193157_1020288Not Available673Open in IMG/M
3300019118|Ga0193157_1027014Not Available594Open in IMG/M
3300019118|Ga0193157_1037579All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum507Open in IMG/M
3300019146|Ga0188881_10016270Not Available921Open in IMG/M
3300019149|Ga0188870_10120554All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium616Open in IMG/M
3300021169|Ga0206687_1433431All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium601Open in IMG/M
3300021342|Ga0206691_1192679Not Available804Open in IMG/M
3300021342|Ga0206691_1224380Not Available617Open in IMG/M
3300021342|Ga0206691_1376112All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum776Open in IMG/M
3300021345|Ga0206688_10183573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum609Open in IMG/M
3300021345|Ga0206688_10328411All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum573Open in IMG/M
3300021345|Ga0206688_10487721All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum568Open in IMG/M
3300021345|Ga0206688_10516740All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum599Open in IMG/M
3300021348|Ga0206695_1142170Not Available623Open in IMG/M
3300021348|Ga0206695_1314487All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum728Open in IMG/M
3300021353|Ga0206693_1595677All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum624Open in IMG/M
3300021353|Ga0206693_1877410All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum642Open in IMG/M
3300021353|Ga0206693_1930192Not Available537Open in IMG/M
3300021355|Ga0206690_10818744All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum588Open in IMG/M
3300021359|Ga0206689_10423724All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum571Open in IMG/M
3300021359|Ga0206689_10549098Not Available585Open in IMG/M
3300021359|Ga0206689_11168324All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum574Open in IMG/M
3300021872|Ga0063132_106867All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium530Open in IMG/M
3300021879|Ga0063113_104664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum583Open in IMG/M
3300021886|Ga0063114_1022180All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum528Open in IMG/M
3300021913|Ga0063104_1080167Not Available551Open in IMG/M
3300021924|Ga0063085_1039888Not Available649Open in IMG/M
3300021930|Ga0063145_1068633Not Available597Open in IMG/M
3300021939|Ga0063095_1016718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium538Open in IMG/M
3300023694|Ga0228683_1030226All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium593Open in IMG/M
3300023704|Ga0228684_1060913All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium588Open in IMG/M
3300025620|Ga0209405_1078997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1004Open in IMG/M
3300025680|Ga0209306_1146610Not Available671Open in IMG/M
3300025699|Ga0209715_1068421All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1428Open in IMG/M
3300025887|Ga0208544_10174049All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum906Open in IMG/M
3300026182|Ga0208275_1014062All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1738Open in IMG/M
3300027687|Ga0209710_1290864Not Available510Open in IMG/M
3300028076|Ga0247562_1027418All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium615Open in IMG/M
3300028333|Ga0247595_1076948All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium559Open in IMG/M
3300028575|Ga0304731_10432908All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum576Open in IMG/M
3300030671|Ga0307403_10519248Not Available644Open in IMG/M
3300030699|Ga0307398_10773607All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum531Open in IMG/M
3300030702|Ga0307399_10460508All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum621Open in IMG/M
3300030702|Ga0307399_10484037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum606Open in IMG/M
3300030722|Ga0308137_1072179Not Available613Open in IMG/M
3300031569|Ga0307489_10329527All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum996Open in IMG/M
3300031580|Ga0308132_1092481All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum622Open in IMG/M
3300031580|Ga0308132_1104685All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum581Open in IMG/M
3300031580|Ga0308132_1111515Not Available562Open in IMG/M
3300031589|Ga0307996_1189459Not Available536Open in IMG/M
3300031674|Ga0307393_1128784All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum563Open in IMG/M
3300031709|Ga0307385_10433324All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum503Open in IMG/M
3300031710|Ga0307386_10578578All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum593Open in IMG/M
3300031725|Ga0307381_10240090All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum641Open in IMG/M
3300031725|Ga0307381_10297437All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum580Open in IMG/M
3300031735|Ga0307394_10389543All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300031738|Ga0307384_10368417All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum665Open in IMG/M
3300031739|Ga0307383_10428018All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum653Open in IMG/M
3300031739|Ga0307383_10551619All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium578Open in IMG/M
3300031739|Ga0307383_10623196All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum545Open in IMG/M
3300031742|Ga0307395_10399354All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum598Open in IMG/M
3300031742|Ga0307395_10436625All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium570Open in IMG/M
3300031743|Ga0307382_10538322All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium536Open in IMG/M
3300032492|Ga0314679_10365324All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium656Open in IMG/M
3300032616|Ga0314671_10510402Not Available654Open in IMG/M
3300032651|Ga0314685_10538941All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium640Open in IMG/M
3300032708|Ga0314669_10512830Not Available661Open in IMG/M
3300032709|Ga0314672_1286054Not Available616Open in IMG/M
3300032728|Ga0314696_10550921Not Available590Open in IMG/M
3300032745|Ga0314704_10531583Not Available646Open in IMG/M
3300032746|Ga0314701_10502742All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium545Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine30.00%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine29.29%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater12.86%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater5.71%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous5.00%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine4.29%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.86%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine2.86%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.43%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.43%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.43%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.71%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.71%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.71%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.71%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300006397Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007629Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3EnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010986Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 9)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012520Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012965Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016746Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101401AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018725Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782256-ERR1712230)EnvironmentalOpen in IMG/M
3300018742Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000534 (ERX1789653-ERR1719224)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018779Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000698 (ERX1789670-ERR1719303)EnvironmentalOpen in IMG/M
3300018855Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002191 (ERX1782341-ERR1711903)EnvironmentalOpen in IMG/M
3300018862Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001652 (ERX1789608-ERR1719146)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018968Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096)EnvironmentalOpen in IMG/M
3300018975Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002350 (ERX1782140-ERR1711881)EnvironmentalOpen in IMG/M
3300018977Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782322-ERR1711977)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019097Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000393 (ERX1782443-ERR1712022)EnvironmentalOpen in IMG/M
3300019118Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000396 (ERX1782223-ERR1711898)EnvironmentalOpen in IMG/M
3300019146Metatranscriptome of marine microbial communities from Baltic Sea - GS860_ls5EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021348Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021355Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021879Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-5 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021886Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021924Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021930Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S29 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021939Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-37M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300023694Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 31R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023704Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 35R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025620Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes)EnvironmentalOpen in IMG/M
3300025680Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes)EnvironmentalOpen in IMG/M
3300025699Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026182Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B (SPAdes)EnvironmentalOpen in IMG/M
3300027687Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes)EnvironmentalOpen in IMG/M
3300028076Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 10R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028333Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 60R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030722Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_943_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031580Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1111_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031589Marine microbial communities from David Island wharf, Antarctic Ocean - #35EnvironmentalOpen in IMG/M
3300031674Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031709Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032709Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032728Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032745Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032746Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0066831_1002271433300005516MarineMKYTSLLVVAALFAVAVKDSNAIKLATEGKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVAITNAAGQSTGQKVLYKDGCQKSAAEILLVTK*
Ga0066831_1005624633300005516MarineMKFVVLVALFAAASALKIEGKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVAITNAAGQSTGQKVLYKDGAQKAAAEILLVTK*
Ga0075488_155897013300006397AqueousMKFTQLAVVAALFASASAITISKDPAPTAADTPTSGYYGADEDDVMNNIFNHYAVPITNAAGQATGTKVLYKDGAQKAAAEILLVTK*
Ga0075467_1027448823300006803AqueousMKYTSLIAVLALFVATNEVSAVHLERKKKKDDPPPTAADTPTSGYYGADEDDVMNNIFNHYAVPITNAAGVGTGQKVLYKDGAQKACAEVLLVTK*
Ga0105019_107585523300007513MarineMKYTSLLLIAALFASADAIQIAKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVAVTNAAGSSTGQKVLYKDGAQKAAAEVLLVTK*
Ga0105019_115810213300007513MarineMRFTHLVAIAALLFASTDAVSLVKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGVPTGQKVLYKDGAQKGAAEVLLVTK*
Ga0102895_118623223300007629EstuarineMKYTSLLVVMALFAASAVDEVQAIHLDRKFKKDEGPPPTAADTPSSGYYGADEDDVMNNIFQHYAVPVKNVAGQWTGQKVLYKDRTQKACAVILLITKQVSRGKDGAVHG*
Ga0104258_109389923300008993Ocean WaterMKYTSILVIAALFAASTSEPVNAVLLAKKKKEDPPPTAADTPTSGYFGADEDDVMNNIFNHYAVEVTNEAGSKTGQKVLYKDGAQKACAEILLVTK*
Ga0115566_1014787433300009071Pelagic MarineMKYTSLLVVAALFAAQADVTVNAVSLDKKKKEDPPPTAADTPTSGYFGADEDDVMNNIFNHYAVEVTNEAGAKTGQKVLYKDGAQKSCAEVLLVTKQVSEAKMEAYMAEFFPRTWA
Ga0114994_1047504813300009420MarineMRYTALVVAAALLFSSADAITLSKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGVPTGQKVLYKDGAQKGAAEVLLVTK*
Ga0115562_112163923300009434Pelagic MarineLSLIVINFGIKFIQTKMKFTTSLLVIAALFAGESSAITLQSAREVPAPTAADTPTSGYYGADEDDVMNNIFNHYAVETTNAAGQPTGTKVLYKDACQKAAAEILLVSK*
Ga0115569_1010152013300009497Pelagic MarineMIVVAALLATSVEAISVTKKTEAAPTAADTPTSGYYGADEDDVMNNIFNHYAVETTNAAGQATGTKVLYKDACQKAAAEILLVSKQVSEAKMEAYM
Ga0115102_1052450223300009606MarineYNLDLESIYKMKYTNLLVVLALFAATAVESTQAVELSKKKKDDPPPTAADTPTSGYFGADEDDVMNNIFNHYAVEVTNEAGAKTGQKVLYKDGAQKSCAEILLVSK*
Ga0115102_1075328613300009606MarineIKFISMKYTNLIVLAALFFVQESSAINLSKQSSKDPAPTAADTPTSGYYGADEDDVMNNIFNHYAVETTNAAGQPTGTKVLYKDACQKASAEILLVSK*
Ga0115104_1127055023300009677MarineKIYKAMKYTNLIVLVALFATQESSAITVHKQGDPAPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGQGTGQKVLYKDGCQKACAEILLVTK*
Ga0115105_1004960013300009679MarineSLLLFAALFASADAIQIAKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGAATGQKVLYKDGAQKAAAEILLVTK*
Ga0115105_1087048823300009679MarineVAALLFASADAITLSKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGVPTGQKVLYKDGAQKAAAEILLVTK*
Ga0115000_1091227813300009705MarineHLRIKFISMKYTSLLVIAALFASADAIQIAKKDKPPPTAADTPTSGYFGADEDDVMNNIFNHYAVGVTNAAGAGTGQKVLYKDGCQKAAAEILLVTK*
Ga0115001_1071325613300009785MarineMKYTSLFVFAALLVSTSAVKIQGPPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGQGTGQKVLYKDGCQKAT
Ga0138316_1070506913300010981MarineMRFTALVAIAAMLFASADAVSLVKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVAVSNAAGVPTGQKVLYKDGCQKAAAEILLVTK*
Ga0138326_1102614513300010985MarineFIRMKYTSLLVFAALFASADSIQIAKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVGVTNAAGAATGQKVLYKDGAQKAAAEILLVTK*
Ga0138327_1104561113300010986MarineISMKYTSLLVFAALFASADAIQIAKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVGVTNAAGAATGQKVLYKDGAQKAAAEILLVTK*
Ga0138324_1050753513300010987MarineNHHSMRFTSLAVVAAMLFASADAITLSKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGAATGQKVLYKDGAQKAAAEVLLVTK*
Ga0138324_1051523113300010987MarineKYTQLFVLAALLMSQSDAIKLTKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYATAVTNAAGALTGAKVLYKEGCQKAAAEILLVTK*
Ga0138264_122020923300012414Polar MarineLLVIAALFAGETNAISLAKKTDAPPPTAADTPTSGYYGADEDDVMNNIFNHYAVETTNAAGQPTGTKVLYKDACQKASAEVLLVSK*
Ga0138263_139723513300012415Polar MarineTSLLVIAALFAGETNAISLAKKTDAPPPTAADTPTSGYYGADEDDVMNNIFNHYAVETTNAAGQPTGTKVLYKDACQKASAEVLLVSK*
Ga0138259_102168713300012416Polar MarineMKYFATSLLVIAALFAGETNAVSLAKKTDAPAPTAADTPTSGYYGADEDDVMNNIFNHYAVETTNAAGQPTGTKVLYKDACQKAAAEVLLVSK*
Ga0129347_100721223300012504AqueousVGCDDDSYDDTINPSNAVKFTQLAVVAALFASASAITISKDPAPTAADTPTSGYYGADEDDVMNNIFNHYAVPITNAAGQATGTKVLYKDGAQKAAAEILLVTK*
Ga0129344_127041513300012520AqueousFTQLAVVAALFASASAITISKDPAPTAADTPTSGYYGADEDDVMNNIFNHYAVPITNAAGQATGTKVLYKDGAQKAAAEILLVTK*
Ga0129350_109957123300012523AqueousKAMKFTQLAVVAALFASASAITISKDPAPTAADTPTSGYYGADEDDVMNNIFNHYAVPITNAAGQATGTKVLYKDGAQKAAAEILLVTK*
Ga0138268_133373913300012782Polar MarineMKNFATSLLVIAALFAGETNAISLAKKTDAPAPTAADTPTSGYYGADEDDVMNNIFNHYAVETTNAAGQPTGTNVLYKDACQKSSAEVLLVSK*
Ga0163179_1036950713300012953SeawaterMKYSQIFVLVALLMSQSDAIKLSKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVAVTNAAGALTGAKVLYKEGCQKAAAEILLVTK*
Ga0129346_101663423300012965AqueousAALFASASAITISKDPAPTAADTPTSGYYGADEDDVMNNIFNHYAVPITNAAGQATGTKVLYKDGAQKAAAEILLVTK*
Ga0182055_110570613300016746Salt MarshMKYSLLLIAALTFANAMKLRGDDKPPPTAADTPSSGYYGADEDDVMNNIFNHYAVPVTNAAGQATGQHVLYRDGAQKACAEILLVTKQVSEAKMEA
Ga0181566_1047855323300018426Salt MarshMKFTQLAVVAALFASASAITISKDPAPTAADTPTSGYYGADEDDVMNNIFNHYAVPITNAAGQATGTKVLYKDGAQKAAAEILLVTK
Ga0192944_104674423300018692MarineMKYTSLLVVAALFAAQADVTVNAVSLDKKKKEDPPPTAADTPTSGYFGADEDDVMNNIFNHYAVEVTNEAGSKTGQKVLYKDGAQKACAEILLVTK
Ga0193517_105909823300018725MarineMRFTALAVVAALLFASADAISLSKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGVPTGQKVLYKDGAQKAAAEILLVTK
Ga0193517_105923013300018725MarineMRFTALVVVAALLFSSADAITLSKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGVPTGQKVLYKDGAQKAAAEILLVTK
Ga0193517_106739213300018725MarineGSDAIKLSKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVAVTNAAGSLTGAKVLYKEGCQKAAAEILLVTK
Ga0193517_107143713300018725MarineALFASADAIQIAKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGVPTGQKVLYKDGAQKAAAEILLVTK
Ga0193138_104092823300018742MarineSSLMRFTALAVVAAMLFASADAITLSKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGVPTGQKVLYKDGAQKAAAEILLVTK
Ga0193031_105771823300018765MarineMRFTSLVAIAAMLFASADAVSLVKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVSNAAGVPTGQKVLYKDGAQKAAAEILLVTK
Ga0193031_105903613300018765MarineMRFAHLAVISALLFASADAITLSKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGVPTGQKVLYKDGAQKGAAEILLVTK
Ga0193149_104891813300018779MarineMKFTQLAVVSALLFASADAITLSKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGVPTGQKVLYKDGAQKAAAEILLVTK
Ga0193149_104891923300018779MarineMRFTALAVIAALLFASADAITLSKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGVPTGQKVLYKDGAQKAAAEILLVTK
Ga0193475_104732123300018855MarineMRFTALVAIAAMLFASADAVTLVKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVAVSNAAGVPTGQKVLYKDGCQKAAAEILLVTK
Ga0193308_106495523300018862MarineFTALVAIAAMLFASTDAVSLVKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGVPTGQKVLYKDGAQKAAAEILLVTK
Ga0192977_105158533300018874MarineMKNFATSLLVIAALFAGETNAISLAKKTDAPPPTAADTPTSGYYGADEDDVMNNIFNHYAVETTNAAGQPTGTKVLYKDACQKASAEVLLVSK
Ga0192894_1019759923300018968MarineMRFTALVAIAAMLFASSDAVSLVKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGAGTGQKVLYKDGAQKAAAEILLVTK
Ga0193006_1019307413300018975MarineMRLLFAVALLVCASDAIKIVKKDDDPPPTAADTPSSGYYGADEDDVMNNIFNHYAVPVTNAAGQATGQKVLYKDGAQKAAAEILLVTK
Ga0193353_1019831913300018977MarineMRFTALVAIAAMLFASTDAVSLVKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGAATGQKVLYKDGAQKAAAEILLVTK
Ga0193030_1016812613300018989MarineMRFTALAVVAAMLFASADAITLSKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGVPTGQKVLYKDGAQKAAAEILLVTK
Ga0193030_1018922113300018989MarineTWDLQLGIKFINMKYTSILVVLALYVSSSEAMRLAKKDVPPPTAADTPSSGQFGADEDDVMNNIFNHYAVEVTNAAGSKTGAKVLYKEGCQKACAEILLVSK
Ga0193030_1020433813300018989MarineMKYSHILVIASLLIANSDALRLSKKDVPPPTAADTPTSGFYGADEDDVMNNIFNHYAVEVTNAAGAKTGAKVLYKAGCEKAAAEILLVSK
Ga0193030_1029587813300018989MarineAEAVHLAKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVEVTNAAGQKTGQKVLYKDGAQKAAAEILLVTK
Ga0193516_1011003923300019031MarineMGIILFLTKMKYTQLFVLVALLMSQSDAIKLTKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYATAVTNAAGALTGAKVLYKEGCQKAAAEILLVTK
Ga0193516_1011025323300019031MarineMSGSDAIKLTKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYATAVTNAAGALTGAKVLYKEGCQKAAAEILLVTK
Ga0193516_1013202613300019031MarineMGYQRRVHGELLILKVNIMKYTALVVAAALLFSSADAITLSKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGVPTGQKVLYKDGAQKAAAEILLVTK
Ga0193516_1013600113300019031MarineMRFSQLAVVAAMLFASADAITLSKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGVPTGQKVLYKDGAQKAAAEILLVTK
Ga0193516_1013655113300019031MarineHGEFNYFILKAITMRFTALVVVAALLFSSADAITLSKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGVPTGQKVLYKDGAQKAAAEILLVTK
Ga0193516_1013805223300019031MarineHGELLTFLKNRMRFTALVAIAAMLFASTDAVSLVKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGVPTGQKVLYKDGAQKAAAEILLVTK
Ga0193516_1018182823300019031MarineMKYTSLLVIAALFASADAIQIAKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVSNAAGVPTGQKVLYKDGAQKAAAEILLVTK
Ga0193516_1019384513300019031MarineIKFISMKYTSLLVIAALFASADAIQIAKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGVPTGQKVLYKDGAQKAAAEILLVTK
Ga0193516_1021982213300019031MarineMKYTSLLVFAALFASADAIQIAKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGAATGQKVLYKDGAQKAAAEILLVTK
Ga0193516_1026272113300019031MarineSSEAIKISKKEKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVAVTNAAGSLTGAKVLYKEGCQKAAAEILLVTK
Ga0192945_1016253723300019036MarineMKYTSLLVVVALFAATAVESTNAVELAKKKKEDPPPTAADTPTSGYFGADEDDVMNNIFNHYAVEVTNEAGSKTGQKVLYKDGAQKACAEILLVTK
Ga0193336_1058895413300019045MarineLFASADAIQIAKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVSNAAGVPTGQKVLYKDGAQKAAAEILLVTK
Ga0192981_1022574913300019048MarineMKFTQLAVIAALFVSASAITVEKKTEASPTAADTPTSGYYGADEDDVMNNIFNHYAVETTNAAGQPTGTKVLYKDACQKASAEVLLVSK
Ga0193153_101996313300019097MarineMRFSQFAVVAAMLFASADAITLSKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGVPTGQKVLYKDGAQKAAAEILLVTK
Ga0193157_102028813300019118MarineMKYTSVLVLLALFVGSSESLRLAKKDVPPPTAADTPTSGHYGADEDDVMNNIFNHYAVEVTNAAGAKTGAKVLYKDGCEKACAEILLVTK
Ga0193157_102701423300019118MarineMRFTAFLAIAAMLALNAESMKLTKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVEVTNAAGQKTGQKVLYKDGAQKAAAEILLVTK
Ga0193157_103757913300019118MarineAESMKLTKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVEVTNAAGQKTGQKVLYKDGAQKAAAEILLVSK
Ga0188881_1001627013300019146Freshwater LakeMKYSALLVLAALTFVKSIHMSKDPPPTAADTPSSGYYGADEDDVMNNIFNHYAVPVTNAAGQATGQHVLYRDGAQKACAEILLVTKQVSETTXXXRSQDGIIHGRILPKNLG
Ga0188870_1012055413300019149Freshwater LakeMKYTSLFVVAALLASTSAIKVDNSLSKDPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGQGTGQKVLYKDGCQKATAEILLVTK
Ga0206687_143343113300021169SeawaterMKYTSLFVVAALLASTSAIKIETSVQGPPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGQGTGQKVLYKDGCQKACAEILLVTK
Ga0206691_119267913300021342SeawaterMKFSQLLVIAALFAATNAVSVDRKKKVEAPPPTAADTPTSGYFGADEDDVMNNIFNHYAVPIQNAAGVPTGQKVLYRDGAEKACAEILLVTK
Ga0206691_122438023300021342SeawaterFSQVLVIAALFAATNAVSVDRKKKVEAPPPTAADTPTSGYFGADEDDVMNNIFNHYAVPIQNAAGVPTGQKVLYRDGAEKACAEILLVTK
Ga0206691_137611233300021342SeawaterMKFVVLVALFAAASALKIEGKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVAITNAAGQSTGQKVLYKDGAQKAAAEVLLVTK
Ga0206688_1018357313300021345SeawaterMKYTSLLVVAALFFTSAHAIKLTKKDDDPPPTAADTPSSGYYGADEDDVMNNIFNHYAVPVTNAAGQATGQKVLYKDGAQKSAAEVLLVTK
Ga0206688_1032841113300021345SeawaterMKYTQIFVLAALFMSGSEAMKLSKKEKPPPTAADTPTSGYYGADEDDVMNNIFNHYATAVTNAAGALTGAKVLYKEGCQKAAAEILLVTK
Ga0206688_1048772113300021345SeawaterMRLLFAVALLVCATDAIKIAKKDDDPPPTAADTPSSGYYGADEDDVMNNIFNHYAVPVTNAAGQATGQKVLYKDGAQKAAAEILLVTK
Ga0206688_1051674013300021345SeawaterMRYTALVVAAALLFSSADAITLSKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGVPTGQKVLYKDGAQKGAAEVLLVTK
Ga0206695_114217013300021348SeawaterMKYSQILVLVALLMSSSEAIKISKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVAVTNAAGSLTGAKVLYKEGCQKAAAEILLVTK
Ga0206695_131448723300021348SeawaterKHIMRFTSLAVVAALLFTSADAISLSKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVSNAAGVPTGQKVLYKDGAQKSAAEILLVTK
Ga0206693_159567723300021353SeawaterMRYTALLVVAALLFSSADAITLSKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGVPTGQKVLYKDGAQKAAAEILLVTK
Ga0206693_187741023300021353SeawaterKYSQIFVLVALLMSQSDAIKLSKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVAVTNAAGALTGAKVLYKEGCQKAAAEILLVTK
Ga0206693_193019213300021353SeawaterSLLVIAALFASADAIQIAKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGVPTGQKVLYKDGAQKAAAEILLVTK
Ga0206690_1081874413300021355SeawaterLMSGSEAMKLSKKEKPPPTAADTPTSGYYGADEDDVMNNIFNHYATAVTNAAGNLTGAKVLYKEGCQKAAAEILLVTK
Ga0206689_1042372423300021359SeawaterSNIMRYTALVVAAALLFSSADAITLSKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGVPTGQKVLYKDGAQKGAAEVLLVTK
Ga0206689_1054909813300021359SeawaterNLMKFSQLLVIAALFAATNAVSVDRKKKVEAPPPTAADTPTSGYFGADEDDVMNNIFNHYAVPIQNAAGVPTGQKVLYRDGAEKACAEILLVTK
Ga0206689_1116832413300021359SeawaterMKYTSLLVAIALLASSSNALKLVKDEPAPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGQGTGQKVLYKDGCQKAAAEIHLVSK
Ga0063132_10686713300021872MarineMKYTSILVIAALFAASTVEPVQAVQLAKKKKDDPPPTAADTPTSGYFGADEDDVMNNIFNHYAVEVTNEAGSKTGQKVLYKDGAQKSCAEILLVTK
Ga0063113_10466413300021879MarineSLMRFTAFAVVAALLFASADAITLSKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGVPTGQKVLYKDGAQKAAAEILLVTK
Ga0063114_102218013300021886MarineTAFAVVAALLFASADAISLSKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGVPTGQKVLYKDGAQKAAAEILLVTK
Ga0063104_108016713300021913MarineLVIAALFAGETNAISLAKKTDAPPPTAADTPTSGYYGADEDDVMNNIFNHYAVETTNAAGQPTGTKVLYKDACQKASAEVLLVSK
Ga0063085_103988813300021924MarineMKNFATSLLVIAALFAGETNAISLAKKTDAPPPPTAADTPTSGYYGADEDDVMNNIFNHYAVETTNAAGQPTGTKVLYKDACQKAAAEVLLVSK
Ga0063145_106863313300021930MarineLVIAALFAGETNAISLAKKTDAPPPPTAADTPTSGYYGADEDDVMNNIFNHYAVETTNAAGQPTGTKVLYKDACQKAAAEVLLVSK
Ga0063095_101671813300021939MarineYTSILVIAALFAASTSEPVNAVLLAKKKKEDPPPTAADTPTSGYFGADEDDVMNNIYNHYAVEVTNEAGAKTGQKVLYKDGAQKACAEILLVTK
Ga0228683_103022613300023694SeawaterKYTSLFVVAALLASTSAIKIETSVQGPPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGQGTGQKVLYKDGCQKACAEILLVTK
Ga0228684_106091313300023704SeawaterFILMKYTSLFVVAALLASTSAIKIETSVQGPPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGQGTGQKVLYKDGCQKACAEILLVTK
Ga0209405_107899723300025620Pelagic MarineMKFTTSLLVIAALFAGESSAITLQSAREVPAPTAADTPTSGYYGADEDDVMNNIFNHYAVETTNAAGQPTGTKVLYKDACQKAAAEILLVSK
Ga0209306_114661013300025680Pelagic MarineMKYTSLLVVAALFAAQADVTVNAVSLDKKKKEDPPPTAADTPTSGYFGADEDDVMNNIFNHYAVEVTNEAGAKTGQKVLYKDGAQKSCAEVLLVTKQVSEAKMEAYMAEFFPRTWAK
Ga0209715_106842113300025699Pelagic MarineMKYTSMIVVAALLATSVEAISVTKKTEAAPTAADTPTSGYYGADEDDVMNNIFNHYAVETTNAAGQATGTKVLYKDACQKAAAEILLVSKQVSE
Ga0208544_1017404923300025887AqueousMKYTSLIAVLALFVATNEVSAVHLERKKKKDDPPPTAADTPTSGYYGADEDDVMNNIFNHYAVPITNAAGVGTGQKVLYKDGAQKACAEVLLVTK
Ga0208275_101406233300026182MarineMKYTSLLVVAALFAVAVKDSNAIKLATEGKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVAITNAAGQSTGQKVLYKDGCQKSAAEILLVTK
Ga0209710_129086413300027687MarineMKYTSLLVVAALFAAQADVTVNAVSLDKKKKEDPPPTAADTPTSGYFGADEDDVMNNIFNHYAVEVTNEAGAKTGQKVLYKDGAQKSCAEVLLVTKQVSEAKMEAYMAEFFP
Ga0247562_102741823300028076SeawaterMKYTSLFVVAALLASTSAIKIETSVQGPPPPTAADTPTSGYFGADEDDVMNNIFNHYAVSVTNAAGQGTGQKVLYKDGCQKACAEILLVTK
Ga0247595_107694823300028333SeawaterFVVAALLASTSAIKIETSVQGPPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGQGTGQKVLYKDGCQKACAEILLVTK
Ga0304731_1043290813300028575MarineMRFTALVAIAAMLFASADAVSLVKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVAVSNAAGVPTGQKVLYKDGCQKAAAEILLVTK
Ga0307403_1051924823300030671MarineMKNFATSLLVIAALFAGETNAISLAKKTDAPAPTAADTPTSGYYGADEDDVMNNIFNHYAVETTNAAGQPTGTKVLYKDACQKASAEVLLVSK
Ga0307398_1077360713300030699MarineMRFAQLAVVSALLFASVDAVSLSKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVSNAAGVPTGQKVLYKDGAQKGAAEVLLVTK
Ga0307399_1046050823300030702MarineKFISMKYTSLLVVAALFASADAIQIAKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVGVSNAAGVPTGQKVLYKDGAQKAAAEVLLVTK
Ga0307399_1048403713300030702MarineINSMRFAQLAVVSALLFASVDAVSLSKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVSNAAGVPTGQKVLYKDGAQKGAAEVLLVTK
Ga0308137_107217913300030722MarineKFISMKYTSLLVIAALFASADAIQIAKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVGVTNAAGAGTGQKVLYKDGCQKAAAEILLVTK
Ga0307489_1032952713300031569Sackhole BrineMKYTTLIVVAALFAAAQVDQVSAIFLERKKKKEDPPPTAADTPTSGYYGADEDDVMNNIFNHYAVPITNAAGVQTGEKVLYKDGCQKATAEVLLVTK
Ga0308132_109248113300031580MarineYTQIFVLAALLMSGSEAVKIAKKEKPPPTAADTPTSGYYGADEDDVMNNIFNHYATAVTNAAGNLTGAKVLYKEGCQKAAAEILLVTK
Ga0308132_110468523300031580MarineRYTALVVAAALLFSSADAITLSKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVTNAAGVPTGQKVLYKDGAQKGAAEVLLVTK
Ga0308132_111151513300031580MarineYTSLLVIAALFASADAIQIAKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVGVTNAAGAGTGQKVLYKDGCQKAAAEILLVTK
Ga0307996_118945913300031589MarineMKFTSLLVVAALFAASSDVSVNAVALDKKKKEDPPPTAADTPTSGYFGADEDDVMNNIFNHYAVEVTNEAGAKTGQKVLYKDGAQKSCAEVLLVTKQVSEAKM
Ga0307393_112878413300031674MarineQEIKFISMKYTSLLVVAALFASADAIQIAKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVGVSNAAGVPTGQKVLYKDGAQKAAAEVLLVTK
Ga0307385_1043332423300031709MarineFAQLAVVSALLFASVDAVSLSKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVSNAAGVPTGQKVLYKDGAQKGAAEVLLVTK
Ga0307386_1057857813300031710MarineIKFISMKYTSLLVVAALFASADAIQIAKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVGVSNAAGVPTGQKVLYKDGAQKAAAEVLLVTK
Ga0307381_1024009013300031725MarineGIKFISMKYTSLLVVAALFASADAIQIAKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVGVSNAAGVPTGQKVLYKDGAQKAAAEVLLVTK
Ga0307381_1029743713300031725MarineLIINSMRFAQLAVVSALLFASVDAVSLSKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVSVSNAAGVPTGQKVLYKDGAQKGAAEVLLVTK
Ga0307394_1038954323300031735MarineVFVIAALLFASAGAVSLTKKDPPPPTAADTPTSGYYGADEDDVMNNIFNHYATATTNAAGALTGAKVLYKEGCQKAAAEILLVTK
Ga0307384_1036841713300031738MarineEIKFISMKYTSLLVVAALFASADAIQIAKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVGVSNAAGVPTGQKVLYKDGAQKAAAEVLLVTK
Ga0307383_1042801813300031739MarineMKYTSLLVVAALFASADAIQIAKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVGVSNAAGVPTGQKVLYKDGAQKAAAEVLLVTK
Ga0307383_1055161913300031739MarineKMKYTQVFVIAALLFASAGAISLSKKDDKPPPTAADTPTSGYYGADEDDVMNNIFNHYATATTNAAGALTGAKVLYKEGCQKAAAEILLVTK
Ga0307383_1062319613300031739MarineMKFFAIAALFATISAVRISDPPPTASDTPTSGYYGADEDDVMNNIFNHYAVPIQNAAGQATGQKVLYKDGAQKAAAEVLLVTK
Ga0307395_1039935413300031742MarineLIKFISMKYTSLLVVAALFASADAIQIAKKDKPPPTAADTPTSGYYGADEDDVMNNIFNHYAVGVSNAAGVPTGQKVLYKDGAQKAAAEVLLVTK
Ga0307395_1043662513300031742MarineMKYTQVFVIAALLFASAGAISLTKKDPPPPTAADTPTSGYYGADEDDVMNNIFNHYATATTNAAGALTGAKVLYKEGCQKAAAEILLVTK
Ga0307382_1053832213300031743MarineYTQVFVIAALLFASAGAISLSKKDDKPPPTAADTPTSGYYGADEDDVMNNIFNHYATATTNAAGALTGAKVLYKEGCQKAAAEILLVTK
Ga0314679_1036532413300032492SeawaterNKMKYTSILVLAALFAVSESPVMAIQLAKKKKEDPPPTAADTPTSGYFGADEDDVMNNIFNHYAVEVTNEAGSKTGQKVLYKDGAQKACAEILLVTK
Ga0314671_1051040223300032616SeawaterMKNFATSLLVIAALFAGETNAISLAKKTDATPPPTAADTPTSGYYGADEDDVMNNIFNHYAVETTNAAGQPTGTKVLYKDACQKAAAEVLLVSK
Ga0314685_1053894113300032651SeawaterNIKKMKYTSLLVVVALFAATAVESTNAVELAKKKKEDPPPTAADTPTSGYFGADEDDVMNNIFNHYAVEVTNEAGAKTGQKVLYKDGAQKSCA
Ga0314669_1051283013300032708SeawaterALFAGETNAISLAKKTDAPPPPTAADTPTSGYYGADEDDVMNNIFNHYAVETTNAAGQPTGTKVLYKDACQKAAAEVLLVSK
Ga0314672_128605413300032709SeawaterMKNFATSLIVIAALFAGETNAISLAKKTDAPPPTAADTPTSGYYGADEDDVMNNIFNHYAVETTNAAGQPTGTKVLYKDACQKAAAEVLLVSK
Ga0314696_1055092123300032728SeawaterALCLVQDSAAISLSAGGPDVPAPTAADTPTSGYYGADEDDVMNNIFNHYAVETTNAAGQPTGTKVLYKDACQKAAAEVLLVSK
Ga0314704_1053158313300032745SeawaterFATSLLVIAALFAGETNAISLAKKTDAPPPPTAADTPTSGYYGADEDDVMNNIFNHYAVETTNAAGQPTGTKVLYKDACQKAAAEVLLVSK
Ga0314701_1050274223300032746SeawaterYTSILVIAALFAASTSEPVNAVLLAKKKKEDPPPTAADTPTSGYFGADEDDVMNNIFNHYAVEVTNEAGSKTGQKVLYKDGAQKACAEILLVTK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.