| Basic Information | |
|---|---|
| Family ID | F054026 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 140 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MLRTTPLQPSIALDRNKATRTKQGEGEEEVGKKKFAAEPP |
| Number of Associated Samples | 67 |
| Number of Associated Scaffolds | 140 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 5.76 % |
| % of genes near scaffold ends (potentially truncated) | 72.14 % |
| % of genes from short scaffolds (< 2000 bps) | 94.29 % |
| Associated GOLD sequencing projects | 65 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.13 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (97.857 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater (24.286 % of family members) |
| Environment Ontology (ENVO) | Unclassified (54.286 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (51.429 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.82% β-sheet: 0.00% Coil/Unstructured: 91.18% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.13 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 140 Family Scaffolds |
|---|---|---|
| PF01436 | NHL | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 97.86 % |
| All Organisms | root | All Organisms | 2.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 24.29% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 22.14% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 21.43% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 10.71% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 10.00% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.29% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.57% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 1.43% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.71% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.71% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002447 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
| 3300003754 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004763 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004790 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005420 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005565 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
| 3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
| 3300007629 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3 | Environmental | Open in IMG/M |
| 3300007636 | Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300008258 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300012714 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES125 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300024863 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027260 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027263 | Estuarine microbial communities from the Columbia River estuary - metaG 1569A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027806 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028557 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4m | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| 3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034023 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| 3300034167 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082 | Environmental | Open in IMG/M |
| 3300034357 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24768J34885_100866561 | 3300002447 | Freshwater And Sediment | LRTTLLQPSIALDRNKATRAKPVKGEEVVGKKKIAAEPP* |
| JGI24768J34885_101454781 | 3300002447 | Freshwater And Sediment | MLRTTLLQPSIALDRNEATRAKPVKGEEVVGKKQFAAEPP* |
| JGI24768J34885_101551982 | 3300002447 | Freshwater And Sediment | MLRTTLLQPSIALDRNQTSLTKQGEGEEVVGKKKFAAEPLSIQTN* |
| JGI24768J34885_102804981 | 3300002447 | Freshwater And Sediment | YTLACCALLLQPSIALDRNEATRAKPVKGEEVVGKKKFAAEPLSIQTN* |
| JGI24768J34885_103197811 | 3300002447 | Freshwater And Sediment | IHIGMLRTTLLQPSIALDRNEATRAKPVKGEEVVGKKNLQLSHPSIQ* |
| JGI25922J50271_100586781 | 3300003413 | Freshwater Lake | MLRTTLLQPSIALDRNEATRAKPGKGEEVVGKKKFAAEPLSIQTN* |
| JGI25925J51416_101231232 | 3300003497 | Freshwater Lake | MLRTTLLQPSIALDRNEATRAKPGKGEEVVGKKNLQLSHPSIQIITYRAP |
| Ga0005853_10120951 | 3300003754 | Freshwater And Sediment | MLRTTPLQPSIALDRNKATRAKPVKGEEVVGKKKFAAEPP* |
| Ga0005853_10152961 | 3300003754 | Freshwater And Sediment | MLRTTLLQPSIALDRNEATRAKPVKGEEVVGKKKFAAEPPSIQ |
| Ga0007746_14292602 | 3300004763 | Freshwater Lake | MLRTTLLQPSIALDRNEATRAKPVKGEEVVGKKKFAAEPLSIQTN* |
| Ga0007758_113428971 | 3300004790 | Freshwater Lake | GMLRTTPLQPSIALDRNKATRAKPGKGEEEVGKKKFAAEPS* |
| Ga0068879_10269792 | 3300005420 | Freshwater Lake | LLQPSIALDRNEATRAKPGKGEEVVGKKKFAAEPLSIQTN* |
| Ga0068877_106687761 | 3300005525 | Freshwater Lake | LQPSIALDRNEATRAKPIKGEEVVGKKKFAAEPPEYSNHYI* |
| Ga0068876_100606043 | 3300005527 | Freshwater Lake | IRVYAYCVDTIGMLRTTPLQPSIALDRNQTSLTNQGEGEEEVGKKNCT* |
| Ga0068876_106145601 | 3300005527 | Freshwater Lake | RTTPLQPSIALDRNKATRAKPIKGEEVVGKKKFAAEPP* |
| Ga0068885_10032043 | 3300005565 | Freshwater Lake | MLRTTLLQPSIALDRNEATRAKPIKGEEVVGKKKFAAKPLSIQTN* |
| Ga0049080_101329081 | 3300005582 | Freshwater Lentic | MLRTTLLQPSIALDRNEATRAKPVKGEEVVGKKKLQLSH |
| Ga0078894_113649141 | 3300005662 | Freshwater Lake | IHIGMLRTTPLQPSIALDRNKATRAKPVKGEEVLGKKKICS* |
| Ga0078894_115176091 | 3300005662 | Freshwater Lake | TPLQPSIALDRNQTSLTKQGEGEEEVSKKKLQLSHLSIQTNDI* |
| Ga0070744_101787942 | 3300006484 | Estuarine | MLRTTLLQPSIALDRNEATRAKPVKGEEAVGKKNLQLSHPSIQ |
| Ga0102873_11918492 | 3300007545 | Estuarine | MLRTTPLQPSIALDRNKATRTKQGEGEEEVGKKKIAAEPLKYSNQLHIDLP* |
| Ga0102913_10461471 | 3300007560 | Estuarine | IHIGMLRTTPLQPSMALDRNQTSLTKQGEDEEEVGKKNCS* |
| Ga0102895_10933901 | 3300007629 | Estuarine | MLRTTPLQPSIALDRNKATRTKQGEGEEEVGKKKFAAEPP* |
| Ga0102856_10553591 | 3300007636 | Estuarine | MMRTTPLQPSIALDRNQTSLTKQGKGEEEVGKKKFAA |
| Ga0114341_101879992 | 3300008108 | Freshwater, Plankton | MLRTTPLQPSIALDRNNANAKKQAKKKLQLSHLSIQTNTY |
| Ga0114341_104172441 | 3300008108 | Freshwater, Plankton | IHIGMLRTTPLQPSIALDRNKATRTKQGEGEEEVGKKNCS* |
| Ga0114341_104207152 | 3300008108 | Freshwater, Plankton | IHIGMLRTTLLQPSIALDRNEATRAKPIKGEEVVGKKKFAAEPPEYSNHYI* |
| Ga0114341_104801921 | 3300008108 | Freshwater, Plankton | MLRTTPLQPSITLDRNKATRAKPIKGEEVVGKKNLQLSHSVFKQTIY |
| Ga0114344_11634801 | 3300008111 | Freshwater, Plankton | IHIGMLRTTLLQPSIALDRNEATRAKPVKGEEVVGKKKICS* |
| Ga0114346_12011051 | 3300008113 | Freshwater, Plankton | IHIGMLRTTLLQPSIALDRNEATRAKPVKGEEVVGKKICS* |
| Ga0114347_11133791 | 3300008114 | Freshwater, Plankton | IHIGMLRTTPLQPSIALDRNKATRTKQGEGEEEVGKKKLQMSH* |
| Ga0114347_11600091 | 3300008114 | Freshwater, Plankton | AYCVDTHGMLRTTPLQPSIALDRNKATRAKPVKGEEVVGKKKFAAEPP* |
| Ga0114350_11041621 | 3300008116 | Freshwater, Plankton | GMLRTTLLQPSIALDRNEATRAKPIKGEEVVGKKKICS* |
| Ga0114350_11572901 | 3300008116 | Freshwater, Plankton | RTTLLQPSIALDRNEATRAKPVKGEEVVGKKKFAAEPLSIQANHI* |
| Ga0114350_11737041 | 3300008116 | Freshwater, Plankton | LQPSIALDRNKATRAKPVKGEEVVGKKKFAAEPP* |
| Ga0114350_11877121 | 3300008116 | Freshwater, Plankton | MLRTTPLQPSIALDRNKATRAKPIKGEEVVGKKKFAAEP |
| Ga0114351_12671321 | 3300008117 | Freshwater, Plankton | IHIGMLRTTPLQPSIALDRNKATRAKPIKGEEVVGKKKFAAEPP* |
| Ga0114354_12230501 | 3300008119 | Freshwater, Plankton | IHIGMLRTTPLQPSIALDRNKATRTKQGEGEEEVGKKKLQLSH* |
| Ga0114354_12272381 | 3300008119 | Freshwater, Plankton | TTLLQPSIALDRNEATRAKPVKGEEVVGKKKNLQLSHPSIQTNYI* |
| Ga0114840_10499361 | 3300008258 | Freshwater, Plankton | MLRTTLLQPSIALDRNEATRAKPVKGEEVVGKKKF |
| Ga0114841_10405492 | 3300008259 | Freshwater, Plankton | MLRTTPLQPSIALDRNKATRTKQGEGEEEVGKKTKFAAEPP* |
| Ga0114841_10657301 | 3300008259 | Freshwater, Plankton | MLRTTPLQPSIALDRNQTSPTKQGEGEEEVGKKKIAAEPLKYSNYM* |
| Ga0114841_10834462 | 3300008259 | Freshwater, Plankton | MLRTTPLQPSIALDRNKATRTKQGKGEEEVGKKKIAAEPPNAN* |
| Ga0114841_11044551 | 3300008259 | Freshwater, Plankton | MNLNVMLRTTPLQPSIALDRNQTSLTKQGEDEEEVGKKKLQLSH* |
| Ga0114841_11194171 | 3300008259 | Freshwater, Plankton | MLRTTPLQPSIALNRNKATRTKQGEGEEEIGKKKLQLSH* |
| Ga0114841_11962881 | 3300008259 | Freshwater, Plankton | MLRTTPLQPSIALDRNQTSLTTQGEGEEEVGKKQLQLSHRGVQTNI* |
| Ga0114841_12330551 | 3300008259 | Freshwater, Plankton | MLRTTPLQPSIALDRNQTSLTKQGEGEEEVGKKKNLQLSHPSIQTN* |
| Ga0114841_12524221 | 3300008259 | Freshwater, Plankton | HIGMLRTTPLQPSIALDRNKATRTKQGEGEEEVGKKKNCS* |
| Ga0114841_12602501 | 3300008259 | Freshwater, Plankton | MLRTTPLQPSIALDRNQTSLTKQGEGEEVGKKKLQLSHLSIQTN |
| Ga0114841_12713491 | 3300008259 | Freshwater, Plankton | MLRTTLLQPSIALDRNEATRAKPVKGEEVVGKKNL |
| Ga0114841_12809032 | 3300008259 | Freshwater, Plankton | MLRTTPLQPSIALDRNQTSLTKQGEGEEEVGKKQIAAEPLKYSNHYI* |
| Ga0114336_10816261 | 3300008261 | Freshwater, Plankton | MLRTTPLQTSISLDRNKATRTKQGEGEEEVGKKKNAAEPQSA |
| Ga0114336_13544741 | 3300008261 | Freshwater, Plankton | TTLLQPAIALDRNEATRAKPGKGEEVVGKKKFAAEPP* |
| Ga0114337_13521311 | 3300008262 | Freshwater, Plankton | MLRTTLLQPSIALDRNKATRTKQGEGEEEVGKKKIAAGALEYSNQLHIDR |
| Ga0157601_12161642 | 3300012714 | Freshwater | THGMLRTTPLQPSIALDRNKATRAKPVKGEEEVGKKNLQLSHPSIQTNYIQSASCLHPR* |
| (restricted) Ga0172372_106985312 | 3300013132 | Freshwater | MLRTTPLQPSIALDRNKATRAKPVKGEEEEKFAAEPP* |
| Ga0169931_107575091 | 3300017788 | Freshwater | MLRTTPLQPSIALDRNKATRAKPVKGEEEVGKKNLQLSHPSI |
| Ga0211734_107793711 | 3300020159 | Freshwater | MLRTTLLQPSIALDRNEATRAKPIKGEEVVGKKKICS |
| Ga0211735_110000641 | 3300020162 | Freshwater | MLRTTPLQPSIALDRNKATRTKQGEGEEEVGKKKLQLSH |
| Ga0211729_104624961 | 3300020172 | Freshwater | GMLRTTPLQPSIALDRNKATRTKQGEGEEEVGKKNLQLSHPSIQTNYIQSASCLHPR |
| Ga0211731_104908381 | 3300020205 | Freshwater | LRTTLLQPSIALDRNEATRAKPGKGEEVVGKKKFAAEPP |
| Ga0211731_107607091 | 3300020205 | Freshwater | MLRTTPLPPSIALDRNQTSLTKQGKGEEEVGKKKIAAEPLKYSN |
| Ga0255246_10838141 | 3300024863 | Freshwater | MLRTTLLQPSIALDRNEATRAKPIKGEEVVGKKKFAAEPLSIQTN |
| Ga0208027_11005451 | 3300027260 | Estuarine | MLRTTLLQPSIALDRNEATRAKPVKGEEGVGKKKFAA |
| Ga0208446_10691341 | 3300027263 | Estuarine | MLRTTLLQPSIALDRNEATRAKPVKGEEVVGKKKFAAE |
| Ga0209769_11500681 | 3300027679 | Freshwater Lake | VYAYCVDTHGMLRTTPLQPWIALDRNKATRTKQDECEEEVGKKKFAAEPP |
| Ga0209768_102159271 | 3300027772 | Freshwater Lake | HLGMLRTTLLQPSIALDRNEATRAKPGKGEEVVGKKKFAAEPLSIQTN |
| Ga0209972_104527851 | 3300027793 | Freshwater Lake | HIGMLRTTLLQPSIALDRNEATRAKPGKGEEVVGKKKFAAEPLSIQTN |
| Ga0209985_102050971 | 3300027806 | Freshwater Lake | YCVIHIGMLRTTLLQPSIALDRNEATRAKPGKGEEVVGKKKFAAEPLSIQTN |
| Ga0209230_100693411 | 3300027836 | Freshwater And Sediment | MLRTTFLQPSIALDRNQTSLTKQGEGEEEVGKKKLQLSHLSIQTKDI |
| Ga0209230_104595892 | 3300027836 | Freshwater And Sediment | LSVYADCVDTHGMLRTTPLQPSIALDRNKATRTRQGECKEEVGKKNCS |
| Ga0209230_105577191 | 3300027836 | Freshwater And Sediment | PLQPSITLDRNKATRAKPVKGEEVVGKKKFAAEPP |
| Ga0209230_105897771 | 3300027836 | Freshwater And Sediment | MLRTTLLQPSIALDRNEATRAKPVKGEEVVGKKKFA |
| Ga0209230_106458381 | 3300027836 | Freshwater And Sediment | LLQPSIALDRNEATRAKPVKGEEVVGKKKFAAEPP |
| Ga0209230_107231512 | 3300027836 | Freshwater And Sediment | IHIGMLRTTPLQPSIALDRNQTSLTKQGEGEEEVSKKKLQLSHLSIQTNDI |
| Ga0209230_107241151 | 3300027836 | Freshwater And Sediment | IHIGMLRTTPLQPSIALDRNKATRAKPIKGEEVVGKKKFAAEPP |
| Ga0209230_107503111 | 3300027836 | Freshwater And Sediment | MLRTTPLQPSIALDRNKATRTKQGKGEEEVGKKKIAAEPPNAN |
| Ga0209230_107966271 | 3300027836 | Freshwater And Sediment | CVDTHGMLRTTPLQPSIALDRNQTSLTKQGEGEEEVGKKNLQLSHLSIQTNDI |
| (restricted) Ga0247832_13018061 | 3300028557 | Freshwater | DYCVDTHGMLRTTPLQPSIALDRNKATRAKPVKGEEEVGKKKFAAEPP |
| Ga0315907_105107761 | 3300031758 | Freshwater | MLRTTPLQPSIALDRNKATRTKQGEGEEEVGKNKIAAEPP |
| Ga0315907_105269451 | 3300031758 | Freshwater | MLRTTPLQPSIALDRNKATRTKQGECKEEVGKKKLQLSHL |
| Ga0315907_105601061 | 3300031758 | Freshwater | HIGMLRTTLLQPSIALDRNEATRAKPGKGEEVVGKKKFAAEPP |
| Ga0315907_107051541 | 3300031758 | Freshwater | RTTPLQPSIALDRNKATRTKQGEGEEEVGKKKKLQLSH |
| Ga0315907_110378031 | 3300031758 | Freshwater | PSISLDRNKATRTKQGEGEEEVGKKKLQLSHRSIQTTYI |
| Ga0315907_111214231 | 3300031758 | Freshwater | IHIGMLRTTLLQPSIALDRNEATRAKPVKGEEVVGKKKICS |
| Ga0315907_112779491 | 3300031758 | Freshwater | LRTTLLQPSIALDRNEATRAKPVKGEEVVGKKKFAAEPP |
| Ga0315899_101066534 | 3300031784 | Freshwater | MNLNVMLRTTPLQPSIALDRNQTSLTKQGEDEEEVGKKKLQLSH |
| Ga0315899_101677114 | 3300031784 | Freshwater | MLRTTPLQPSIALDRNKATRAKPIKGEEVVGKKKFAAE |
| Ga0315899_102523923 | 3300031784 | Freshwater | MLRTTPLQPSIALDRNKATRTKQGEGEEEVGKKKKLQLSH |
| Ga0315899_102750604 | 3300031784 | Freshwater | AYCVIHIGMLRTTLLQPSIALDRNEATRAKPGKGEEVVGKKKFAAEPLSIQTN |
| Ga0315899_103672031 | 3300031784 | Freshwater | MLRTTPLQPSIDLDRNKATRTKQGEGEEEVGKKKIAT |
| Ga0315899_109465632 | 3300031784 | Freshwater | MLRTTPLQPSITLDRNKATRTKQGEGEEEVDKKKLQLSH |
| Ga0315908_103769411 | 3300031786 | Freshwater | MLRTTPLQPSIALDRNKATRVKPVKGEEEVGKKKKFAAEPP |
| Ga0315908_106647231 | 3300031786 | Freshwater | TPLQPSIALDRNQTSLTKQGEGKEEVGKKKLQLSH |
| Ga0315908_109325971 | 3300031786 | Freshwater | IHIGMLRTTPLQPSISLDRNKATRTKQGEGEEEVGKKKLQLSHRSIQTTYI |
| Ga0315908_111586742 | 3300031786 | Freshwater | MLRTTPLQPSIALDRNQTSLTKQGKGEEEVGKKKIAAEPLKYS |
| Ga0315908_111780051 | 3300031786 | Freshwater | MLRTTPLQPSIALDRNQTSPTKQGEGEEEVGKKKIAAEPLKYSNYM |
| Ga0315900_104469322 | 3300031787 | Freshwater | PLQPSIALDRNQTTRTKQGEGEEEVGKKKLQLSHLSIQTNDI |
| Ga0315900_104858461 | 3300031787 | Freshwater | MLRTTLLQPSIALDRNEATRAKPIKGEEVVGKKNLQLSHPSIQIITYR |
| Ga0315909_104978621 | 3300031857 | Freshwater | TLLQPSIALDRNEATRAKPIKGEEVVGKKKKFAAEPPEYSNHHI |
| Ga0315909_106782081 | 3300031857 | Freshwater | MLRTTPLQPSIALDRNQTSLTTQGEGEEEVGKKQLQLSHRGVQTNI |
| Ga0315901_109582031 | 3300031963 | Freshwater | MLRTTLLQPSIALDRNEATRAKPVKGEEVVGKKKNLQ |
| Ga0315905_100714853 | 3300032092 | Freshwater | MLRTTPLQRSIALDRNQTSLTKQGEGEEEVGKKKLQLSH |
| Ga0315905_101097583 | 3300032092 | Freshwater | MLRTTPLQPSIALDRNKATRTKQGEGEEEVGKKTKFAAEPP |
| Ga0315905_103234783 | 3300032092 | Freshwater | TTPLQPSIALDRNKATRTKQGEGEEEVGKKKKLQLSH |
| Ga0315905_107726232 | 3300032092 | Freshwater | MFHTTPLQPSIALDRNKATRTKQGEGEEEVGKKKIA |
| Ga0315905_108414631 | 3300032092 | Freshwater | IGMLRTTLLQPSIALDRNEATRAKPVKGEEVVGKKKICS |
| Ga0315905_110021341 | 3300032092 | Freshwater | LRTTPLQPSIALDRNKATRAKPVKGEEVVGKKKFAAEPP |
| Ga0315905_112457431 | 3300032092 | Freshwater | MLRTTPLQPSIALDRNQTSLTKQGEGEEEVGKKKNLQLSHPSIQTN |
| Ga0315905_113106321 | 3300032092 | Freshwater | MLRTTPLQPSIALDRNKATRAKPVKSEEEVGTKKKIAAEPP |
| Ga0315905_115229432 | 3300032092 | Freshwater | LRTTLLQPSIALDRNEATRAKPGKGEEVVGKKKFAAEPLSIQTN |
| Ga0315903_108825671 | 3300032116 | Freshwater | RTTPLQPSIALDRNKATRTKQGEGEEEVGKKKLQLSH |
| Ga0315903_110411661 | 3300032116 | Freshwater | KHIGMLRTTPLQPSIALDRNKATRTKQGEGEEEVGKKKCS |
| Ga0334978_0377411_242_379 | 3300033979 | Freshwater | MLRTTLLQPSIALDRNEATRAKPGKGEEVVGKKKFAAEPLSIQTN |
| Ga0334981_0164889_87_206 | 3300033980 | Freshwater | MLRTTPLQPSIALDRNQTSLTKQGEGEEEVGKKKLQLSH |
| Ga0334998_0544496_505_639 | 3300034019 | Freshwater | IHIGMLRTTLLQPSIALDRNEATRAKPVKGEEVVGKKKFAAEPP |
| Ga0335021_0612576_2_118 | 3300034023 | Freshwater | RTTLLQPSIALDRNEATRAKPVKGEEVVGKKKFAAEPP |
| Ga0335000_0395528_1_108 | 3300034063 | Freshwater | MLRTTLLQPSIALDRNEATRAKPVKGEEVVGKKNLQ |
| Ga0335019_0279726_903_1052 | 3300034066 | Freshwater | VHLGMLRTTLLQPSIALDRNEATRAKPGKGEEVVGKKKFAAEPLSIQTN |
| Ga0335019_0685917_266_436 | 3300034066 | Freshwater | MLSTTPLQPSIALDRNKVTRTKQGEGEEEVGKKNLQLSHLSFQTNYIQSASCFHPI |
| Ga0335022_0173431_454_567 | 3300034095 | Freshwater | MLRTTPLQPSIALDRNKTTGTKQGEGKEEVGKKKICS |
| Ga0335022_0194908_1113_1217 | 3300034095 | Freshwater | MLRTTPLQPWIALDRNKATRTKQGEGEEEVGKKKF |
| Ga0335022_0369162_620_742 | 3300034095 | Freshwater | MLRTTPLQPSIALDRNQTSLTKQGKGEEEVGKKKFAAEPP |
| Ga0335022_0380806_142_285 | 3300034095 | Freshwater | MLRTTPLQPSIALDRNQTSLTKQGEGEEEVGKKKFAAEPPEYSNKLI |
| Ga0335022_0462026_3_146 | 3300034095 | Freshwater | MLRTTPLQPSIALDRNQTSLTKQGEGEEEVGKKKVAAEPLKYSNQLHI |
| Ga0335022_0507606_482_625 | 3300034095 | Freshwater | MLRTTPLQPSIALDRNQTSLTKQDEGEEEVGKKKLQLSHLSIQTNDI |
| Ga0335022_0587303_375_494 | 3300034095 | Freshwater | MLRTTPLQPSIALDRNQTSLTKQGEGKEEVGKKKLQLSH |
| Ga0335022_0644987_1_132 | 3300034095 | Freshwater | HIGMLRTTLLQPSIALDRNEATRAKPVKGEEVVGKKKFAAEPP |
| Ga0335030_0826161_3_131 | 3300034103 | Freshwater | MLRTTLLQPSIALDRNEATRAKPGKGEEVVGKKKFAAEPLSIQ |
| Ga0335051_0295567_657_785 | 3300034109 | Freshwater | LRTTLLQPSIALDRNEATRAKPGKGEEVVGKKNLQLSHPSIQ |
| Ga0335066_0428270_557_715 | 3300034112 | Freshwater | PTAIHIGMLRTTLLQPSIALDRNEATRAKPGKGEEVVGKKKFAAEPLSIQTN |
| Ga0335068_0462937_453_566 | 3300034116 | Freshwater | MLRTTPLQPSIALDRNKATRTKQGEGEEEVGKKKYCS |
| Ga0335054_0708861_3_113 | 3300034119 | Freshwater | SIALDRNEATRAKPGKGEEVVGKKKFAAEPLSIQTN |
| Ga0335058_0609926_422_556 | 3300034121 | Freshwater | MLRTTPLQPSIALDRNKATRTKQGECEEEVGNFVFADEPPKYSN |
| Ga0335058_0783540_397_519 | 3300034121 | Freshwater | MLRTTLLQPSIALDRNQTSLTKQGEGEEVVGKKNLQLSHPS |
| Ga0335017_0313662_1_123 | 3300034167 | Freshwater | LRTTLLQPSIALDRNEATRAKPVKGEEVVGKKKKFAAEPP |
| Ga0335017_0571384_462_587 | 3300034167 | Freshwater | MLRTTPLQPSIALDRNKATRAKPVKGEEEVGKKKLQLSHPSI |
| Ga0335064_0210385_3_122 | 3300034357 | Freshwater | MLRTTLLQPSIALDRNEATRAKPGKGEEVVGKKKFAAEPL |
| Ga0335064_0471178_618_737 | 3300034357 | Freshwater | MLRTTPLQPSIALDRNKATRTKQGEGEEEVGKKKLQMSH |
| Ga0335064_0589341_589_696 | 3300034357 | Freshwater | MLRTTPLQPSIALDRNKATRAKPVKGEEVVGKKKIL |
| ⦗Top⦘ |