| Basic Information | |
|---|---|
| Family ID | F053959 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 140 |
| Average Sequence Length | 39 residues |
| Representative Sequence | GMRLLSGPPRPGSKAATYKYRLWLNDQLVGHGEVILREK |
| Number of Associated Samples | 124 |
| Number of Associated Scaffolds | 140 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.86 % |
| % of genes near scaffold ends (potentially truncated) | 97.14 % |
| % of genes from short scaffolds (< 2000 bps) | 91.43 % |
| Associated GOLD sequencing projects | 115 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.286 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (30.714 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.857 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.571 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 32.84% Coil/Unstructured: 67.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 140 Family Scaffolds |
|---|---|---|
| PF12836 | HHH_3 | 31.43 |
| PF06078 | DUF937 | 11.43 |
| PF01872 | RibD_C | 7.14 |
| PF13145 | Rotamase_2 | 4.29 |
| PF13616 | Rotamase_3 | 1.43 |
| PF13620 | CarboxypepD_reg | 1.43 |
| PF16694 | Cytochrome_P460 | 1.43 |
| PF13419 | HAD_2 | 0.71 |
| PF00291 | PALP | 0.71 |
| PF00487 | FA_desaturase | 0.71 |
| PF00905 | Transpeptidase | 0.71 |
| PF04093 | MreD | 0.71 |
| PF01590 | GAF | 0.71 |
| PF01850 | PIN | 0.71 |
| PF02620 | YceD | 0.71 |
| PF06271 | RDD | 0.71 |
| PF07238 | PilZ | 0.71 |
| PF02504 | FA_synthesis | 0.71 |
| PF00697 | PRAI | 0.71 |
| PF04343 | DUF488 | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 140 Family Scaffolds |
|---|---|---|---|
| COG3753 | Uncharacterized conserved protein YidB, DUF937 family | Function unknown [S] | 11.43 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 7.14 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 7.14 |
| COG0135 | Phosphoribosylanthranilate isomerase | Amino acid transport and metabolism [E] | 0.71 |
| COG0416 | Acyl-ACP:phosphate acyltransferase (fatty acid/phospholipid biosynthesis) | Lipid transport and metabolism [I] | 0.71 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.71 |
| COG1399 | 23S rRNA accumulation protein YceD (essential in plants, uncharacterized in bacteria) | Translation, ribosomal structure and biogenesis [J] | 0.71 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.71 |
| COG2891 | Cell shape-determining protein MreD | Cell wall/membrane/envelope biogenesis [M] | 0.71 |
| COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 0.71 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.29 % |
| Unclassified | root | N/A | 0.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352024|deeps_contig45615.28572 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300001593|JGI12635J15846_10322270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 958 | Open in IMG/M |
| 3300002124|C687J26631_10233975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101463778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300004080|Ga0062385_10119795 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
| 3300004092|Ga0062389_102779170 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300005167|Ga0066672_10090692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1847 | Open in IMG/M |
| 3300005533|Ga0070734_10376558 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300005537|Ga0070730_10278730 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300005591|Ga0070761_10145591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1386 | Open in IMG/M |
| 3300005921|Ga0070766_10422479 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300005950|Ga0066787_10118660 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300005993|Ga0080027_10289307 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300006755|Ga0079222_10475655 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 904 | Open in IMG/M |
| 3300007258|Ga0099793_10548075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300009038|Ga0099829_11635835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300009088|Ga0099830_10064478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2634 | Open in IMG/M |
| 3300009088|Ga0099830_11500304 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300009089|Ga0099828_10826519 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 829 | Open in IMG/M |
| 3300009089|Ga0099828_11692369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300009683|Ga0116224_10112993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1315 | Open in IMG/M |
| 3300010159|Ga0099796_10206103 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 800 | Open in IMG/M |
| 3300010361|Ga0126378_10272335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1791 | Open in IMG/M |
| 3300010379|Ga0136449_100459369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2230 | Open in IMG/M |
| 3300010379|Ga0136449_100681914 | All Organisms → cellular organisms → Bacteria | 1728 | Open in IMG/M |
| 3300010399|Ga0134127_13636207 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300010858|Ga0126345_1120346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
| 3300011120|Ga0150983_15719941 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300011270|Ga0137391_11148925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300011271|Ga0137393_10336421 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1289 | Open in IMG/M |
| 3300011271|Ga0137393_10721523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 853 | Open in IMG/M |
| 3300012096|Ga0137389_10963159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 732 | Open in IMG/M |
| 3300012096|Ga0137389_11204280 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300012198|Ga0137364_10435588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 983 | Open in IMG/M |
| 3300012202|Ga0137363_11143975 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300012203|Ga0137399_10760940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
| 3300012210|Ga0137378_10577019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1034 | Open in IMG/M |
| 3300012349|Ga0137387_10177556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1524 | Open in IMG/M |
| 3300012349|Ga0137387_10926750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300012359|Ga0137385_11199581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300012361|Ga0137360_10485124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1050 | Open in IMG/M |
| 3300012362|Ga0137361_10376519 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1303 | Open in IMG/M |
| 3300012362|Ga0137361_10475026 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1148 | Open in IMG/M |
| 3300012362|Ga0137361_11053260 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
| 3300012362|Ga0137361_11615525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300012363|Ga0137390_10319264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1535 | Open in IMG/M |
| 3300012363|Ga0137390_11817956 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300012683|Ga0137398_10332327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1026 | Open in IMG/M |
| 3300012917|Ga0137395_10125618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1733 | Open in IMG/M |
| 3300012917|Ga0137395_10622598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 780 | Open in IMG/M |
| 3300012918|Ga0137396_10192816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1496 | Open in IMG/M |
| 3300012927|Ga0137416_11959536 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 537 | Open in IMG/M |
| 3300012929|Ga0137404_12071443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300012931|Ga0153915_10469964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1434 | Open in IMG/M |
| 3300012931|Ga0153915_11026941 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 961 | Open in IMG/M |
| 3300012944|Ga0137410_12013945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300012964|Ga0153916_10787755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1031 | Open in IMG/M |
| 3300013306|Ga0163162_10031376 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5271 | Open in IMG/M |
| 3300014162|Ga0181538_10270216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 931 | Open in IMG/M |
| 3300014200|Ga0181526_10138436 | All Organisms → cellular organisms → Bacteria | 1560 | Open in IMG/M |
| 3300014201|Ga0181537_11241507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300014638|Ga0181536_10521038 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300015054|Ga0137420_1199668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300015264|Ga0137403_11022055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300015357|Ga0134072_10203592 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300017656|Ga0134112_10422473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300017934|Ga0187803_10019284 | All Organisms → cellular organisms → Bacteria | 2721 | Open in IMG/M |
| 3300017938|Ga0187854_10051975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2044 | Open in IMG/M |
| 3300017972|Ga0187781_10104794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1965 | Open in IMG/M |
| 3300017973|Ga0187780_10377491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1004 | Open in IMG/M |
| 3300018012|Ga0187810_10042347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1701 | Open in IMG/M |
| 3300018013|Ga0187873_1060887 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1590 | Open in IMG/M |
| 3300018044|Ga0187890_10164193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1268 | Open in IMG/M |
| 3300018060|Ga0187765_11282614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300018064|Ga0187773_10200800 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1061 | Open in IMG/M |
| 3300018074|Ga0184640_10060193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1589 | Open in IMG/M |
| 3300018088|Ga0187771_10223975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1564 | Open in IMG/M |
| 3300019788|Ga0182028_1533072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2338 | Open in IMG/M |
| 3300020199|Ga0179592_10288191 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300020581|Ga0210399_11342996 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300020583|Ga0210401_10602504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 960 | Open in IMG/M |
| 3300020583|Ga0210401_11086337 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300021088|Ga0210404_10213927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1037 | Open in IMG/M |
| 3300021088|Ga0210404_10602177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300021171|Ga0210405_10166484 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1746 | Open in IMG/M |
| 3300021384|Ga0213876_10479113 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300021401|Ga0210393_11142496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300021403|Ga0210397_10066384 | All Organisms → cellular organisms → Bacteria | 2353 | Open in IMG/M |
| 3300021405|Ga0210387_10837912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300021406|Ga0210386_10482940 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300021433|Ga0210391_10991665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300021475|Ga0210392_11237774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300021478|Ga0210402_11942527 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
| 3300021560|Ga0126371_10939469 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300022532|Ga0242655_10064584 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 935 | Open in IMG/M |
| 3300022724|Ga0242665_10340214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300022724|Ga0242665_10395394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300023250|Ga0224544_1042071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300024286|Ga0247687_1001514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2765 | Open in IMG/M |
| 3300024288|Ga0179589_10385330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
| 3300024330|Ga0137417_1333338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1491 | Open in IMG/M |
| 3300025906|Ga0207699_10511917 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300026214|Ga0209838_1055613 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300026333|Ga0209158_1279374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300026377|Ga0257171_1019609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1137 | Open in IMG/M |
| 3300026540|Ga0209376_1309898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300026547|Ga0209156_10154802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1110 | Open in IMG/M |
| 3300026555|Ga0179593_1143809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4265 | Open in IMG/M |
| 3300027039|Ga0207855_1031763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 713 | Open in IMG/M |
| 3300027575|Ga0209525_1048492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1037 | Open in IMG/M |
| 3300027678|Ga0209011_1095304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
| 3300027826|Ga0209060_10137551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1135 | Open in IMG/M |
| 3300027842|Ga0209580_10096526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1426 | Open in IMG/M |
| 3300027853|Ga0209274_10226879 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 953 | Open in IMG/M |
| 3300027862|Ga0209701_10250636 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300027875|Ga0209283_10168619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1453 | Open in IMG/M |
| 3300027894|Ga0209068_10612390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
| 3300027903|Ga0209488_10700433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
| 3300027905|Ga0209415_10806966 | Not Available | 653 | Open in IMG/M |
| 3300028047|Ga0209526_10151690 | All Organisms → cellular organisms → Bacteria | 1622 | Open in IMG/M |
| 3300028536|Ga0137415_10429376 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1126 | Open in IMG/M |
| 3300028906|Ga0308309_11462816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300030596|Ga0210278_1143296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300031446|Ga0170820_14116151 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300031573|Ga0310915_10733679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
| 3300031711|Ga0265314_10270047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 967 | Open in IMG/M |
| 3300031715|Ga0307476_10151034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1669 | Open in IMG/M |
| 3300031720|Ga0307469_10000593 | All Organisms → cellular organisms → Bacteria | 13301 | Open in IMG/M |
| 3300031720|Ga0307469_10198982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1562 | Open in IMG/M |
| 3300031823|Ga0307478_11671205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300031831|Ga0318564_10302863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
| 3300031941|Ga0310912_11318363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300031945|Ga0310913_11180834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300031962|Ga0307479_10152088 | All Organisms → cellular organisms → Bacteria | 2270 | Open in IMG/M |
| 3300032041|Ga0318549_10438490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300032180|Ga0307471_103044733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300032783|Ga0335079_10830964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 954 | Open in IMG/M |
| 3300032829|Ga0335070_11273383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300033547|Ga0316212_1004740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1971 | Open in IMG/M |
| 3300034124|Ga0370483_0001540 | All Organisms → cellular organisms → Bacteria | 6359 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 30.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.14% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.29% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.29% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.57% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.86% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.86% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.86% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.14% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 2.14% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.43% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.43% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.43% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.43% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.43% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.43% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.71% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.71% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.71% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.71% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.71% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.71% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.71% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.71% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.71% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.71% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.71% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.71% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002124 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010858 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300024286 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026214 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027039 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030596 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO085SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_00103830 | 2199352024 | Soil | AGMRLLSGPPRPGIKAATFKYRLWLNDQLVGQGEVILREK |
| JGI12635J15846_103222702 | 3300001593 | Forest Soil | QAPAGMRLLSGPPRAGIKGATFKYRLWLNDQLVGQGEVILRDK* |
| C687J26631_102339751 | 3300002124 | Soil | RLLSGTARPGSKPGSYRYRLWLNDQLIGQGEVILREA* |
| JGIcombinedJ26739_1014637782 | 3300002245 | Forest Soil | PAGMRLLSGPARVGIKDGTYKYRIWLNDQMVGQGEVILRGK* |
| Ga0062385_101197954 | 3300004080 | Bog Forest Soil | PVGMRLLSGPPRVGIKAGTYKYRVWLNDQMVGQGEVILREK* |
| Ga0062389_1027791702 | 3300004092 | Bog Forest Soil | PGRQLQSGPPRPGTNPGGYKYRLWMNDQLIGQGEVILRDK* |
| Ga0066672_100906924 | 3300005167 | Soil | QAPAGMRLLSGPPRPGSKAATYKYRLWLNDQLVGHGEVILREK* |
| Ga0070734_103765583 | 3300005533 | Surface Soil | LLSGPPVTGTKAGSYKYRLWLNDQMVGRGEVIVREK* |
| Ga0070730_102787303 | 3300005537 | Surface Soil | SGPPRPGLKGATYKYRLWLNDQLVGQGEVILREK* |
| Ga0070761_101455911 | 3300005591 | Soil | LSGPPRVGLKAATYKYRLWLNDQLVGQGEVILREK* |
| Ga0070766_104224793 | 3300005921 | Soil | GMRLLSGPPRVGLKSATYKYRVWLNDQLVGQGEVILREK* |
| Ga0066787_101186602 | 3300005950 | Soil | SGPPRVGIKAGTYKYRVWLNDQMVGQGEVILREK* |
| Ga0080027_102893071 | 3300005993 | Prmafrost Soil | SGPARPGIKAATYKYRLWLNDQLVGHGEVILREK* |
| Ga0079222_104756551 | 3300006755 | Agricultural Soil | PAGMRLLSGPPRIGTKDGTYKYRVWLNDQMIGQGEVVLRGK* |
| Ga0099793_105480752 | 3300007258 | Vadose Zone Soil | GMRLLSGPPRVGIKDGTYKYRIWLNDQMVGQGEVILRGK* |
| Ga0099829_116358352 | 3300009038 | Vadose Zone Soil | APAGMRLLSGPARPGTKDGTYKYRLWLNDQMVGQGEVVLRGK* |
| Ga0099830_100644781 | 3300009088 | Vadose Zone Soil | PAGMRLLSGPARVGTKDGTYKYRVWLNDQMVGQGEVILRGK* |
| Ga0099830_115003042 | 3300009088 | Vadose Zone Soil | VFQAPTGMRLLSGPPRPGSKAATYKYRLWLNDQLVGQGEVILREK* |
| Ga0099828_108265193 | 3300009089 | Vadose Zone Soil | SGPPTIGTKPGTYKYRLWLNDQLVGRGEVILREK* |
| Ga0099828_116923691 | 3300009089 | Vadose Zone Soil | SGTPRPGTKPGSYKYRLWLNDQMIGSGEIILREK* |
| Ga0116224_101129931 | 3300009683 | Peatlands Soil | LQSGPPRPGINPGSYKYRLWLNDQPIGNGEVILREK* |
| Ga0099796_102061033 | 3300010159 | Vadose Zone Soil | AGMRLLSGPPRVGIKDGAYKYRVWLNDQMVGQGEVILRGK* |
| Ga0126378_102723353 | 3300010361 | Tropical Forest Soil | QAPSGVRLLSGPPRPGSKATTYKYRLWLNDQLVGQGEVILREK* |
| Ga0136449_1004593693 | 3300010379 | Peatlands Soil | LSGPARAGTKAGAYHYRVWLNEQLIGAGEIILRES* |
| Ga0136449_1006819141 | 3300010379 | Peatlands Soil | LQSGPPRPGTNPGGFKYRLWMNEQQVGQGEVILREK* |
| Ga0134127_136362071 | 3300010399 | Terrestrial Soil | PAGMRLLSGTPRAGTNPGAFKYRVWLNDQLIGSGEIILREA* |
| Ga0126345_11203462 | 3300010858 | Boreal Forest Soil | PAGMRLLSGPPTVGTKSGTYKYRLWLNDQMVGRGEVILRDK* |
| Ga0150983_157199411 | 3300011120 | Forest Soil | QLQSGPPRPGTNPGSFKYRLWLNDQPIGNGEVILREK* |
| Ga0137391_111489252 | 3300011270 | Vadose Zone Soil | SGPARVGTKDGTYKYRIWLNDQMVGQGEVVLRGK* |
| Ga0137393_103364211 | 3300011271 | Vadose Zone Soil | AGMRLLSGPPRPGSKAATYKYKLWLNDQLVGHGEVILREK* |
| Ga0137393_107215232 | 3300011271 | Vadose Zone Soil | AGMRLLSGPARVGTKDGAYKYRIWLNDQMVGQGEVILRGK* |
| Ga0137389_109631591 | 3300012096 | Vadose Zone Soil | SGPPRPGSKAATYKYKLWLNDQLVGHGEVILREK* |
| Ga0137389_112042801 | 3300012096 | Vadose Zone Soil | MRLMSGPTIAGTKPGSFKYRLWLNDQMVGRGEVIVR* |
| Ga0137364_104355882 | 3300012198 | Vadose Zone Soil | MRLLSGPPRPGSKAATYKYRLWLNDQLVGHGEVILREK* |
| Ga0137363_111439753 | 3300012202 | Vadose Zone Soil | GMRLLSGPTIAGTKPGSFKYRLWLNDQMVGRGEVIVR* |
| Ga0137399_107609401 | 3300012203 | Vadose Zone Soil | GMRLLSGPPRPGSKAATYKYRLWLNDQLVGHGEVILREK* |
| Ga0137378_105770193 | 3300012210 | Vadose Zone Soil | SGPPRSGSKAATYKYRLWLNDQLVGHGEVILREK* |
| Ga0137387_101775563 | 3300012349 | Vadose Zone Soil | PAGMRLLSGPPRPGSKAATYKYRLWLNDQLVGHGEVILREK* |
| Ga0137387_109267502 | 3300012349 | Vadose Zone Soil | RLLSGPPRAGSKAATYKYRLWLNDQLVGHGEVILREK* |
| Ga0137385_111995812 | 3300012359 | Vadose Zone Soil | VFQAPSGMRLLSGPARPGSKAATYKYRLWLNDQLVGQGEVILREK* |
| Ga0137360_104851243 | 3300012361 | Vadose Zone Soil | PAGMRLLSGPPRPGSKAATYKYKLWLNDQLVGHGEVILREK* |
| Ga0137361_103765193 | 3300012362 | Vadose Zone Soil | AGMRLLSGPARVGTKDGTYKYRVWLNDQMVGQGEVILRGK* |
| Ga0137361_104750263 | 3300012362 | Vadose Zone Soil | LSGPARVGTKDGTYKYRIWLNDQMVGQGEVILRGK* |
| Ga0137361_110532603 | 3300012362 | Vadose Zone Soil | SGPPRPGSKAATYKYRLWLNDQLVGHGEVILREK* |
| Ga0137361_116155252 | 3300012362 | Vadose Zone Soil | LLSGPPRPGSKAATYKYRLWLNDQLVGHGEVILREK* |
| Ga0137390_103192643 | 3300012363 | Vadose Zone Soil | GMRLLSGPPRPGSKAATYKYRLWLNDQLVGHGEVILRDK* |
| Ga0137390_118179561 | 3300012363 | Vadose Zone Soil | SGPARPGTKDGTYKYRLWLNDQMVGQGEVVLRGK* |
| Ga0137398_103323271 | 3300012683 | Vadose Zone Soil | RLLSGPPRVGIKDGAYKYRVWLNDQMVGQGEVILRGK* |
| Ga0137395_101256181 | 3300012917 | Vadose Zone Soil | QAPAGMRLLSGPPRVGIKDGAYKYRVWLNDQMVGQGEVILRGR* |
| Ga0137395_106225981 | 3300012917 | Vadose Zone Soil | QAPAGMRLLSGPPRVGIKDGAYKYRVWLNDQMVGQGEVILRGK* |
| Ga0137396_101928164 | 3300012918 | Vadose Zone Soil | QAPAGFRLLSGPPRPGSKAATYKYKLWLNDQLVGHGEVILREK* |
| Ga0137416_119595362 | 3300012927 | Vadose Zone Soil | QAPAGMRLLSGPPRIGTKDGTYKYRVWLNDQMVGQGEVVLRGK* |
| Ga0137404_120714432 | 3300012929 | Vadose Zone Soil | GMRLLSGPPRVGIKDGAYKYRVWLNDQMVGQGEVILRGK* |
| Ga0153915_104699641 | 3300012931 | Freshwater Wetlands | VFQAPMGMRLLSGPPRIGTKAGIYKYRLWLNDQMVGQGEVILREA* |
| Ga0153915_110269411 | 3300012931 | Freshwater Wetlands | MRLLSGPPRIGTKTGIYKYRLWLNDQKVGQGEVILREG* |
| Ga0137410_120139451 | 3300012944 | Vadose Zone Soil | ASAGMRLFSGPPRPGSKAAMYKYRFWLNDQLVGHGEVILRDK* |
| Ga0153916_107877554 | 3300012964 | Freshwater Wetlands | GMRLLSGPPRIGTKAGIYKYRLWLNDQMVGQGEVILREA* |
| Ga0163162_100313768 | 3300013306 | Switchgrass Rhizosphere | MRLLSGPPRTGAKAASYKYRLWLNEQIVGQGEVILRDK* |
| Ga0181538_102702161 | 3300014162 | Bog | PGRQLQSGPARPGVNPGGYKYRLWMNDQPIGHGEVILRDK* |
| Ga0181526_101384363 | 3300014200 | Bog | MGMRLLSGPAMVGTKAGSYKYRLWLNEQMVGRGEVILREK* |
| Ga0181537_112415071 | 3300014201 | Bog | GRQLQSGPPRPGTNTGSFKYRLWLNDQPVGNGEVILREK* |
| Ga0181536_105210382 | 3300014638 | Bog | RQLQSGPSRPGVNPGAYKYRLWMNDQPIGHGEVILREK* |
| Ga0137420_11996681 | 3300015054 | Vadose Zone Soil | PRPGPPRPGSKAATYKYRLWLNDQLVGHGEVILREK* |
| Ga0137403_110220551 | 3300015264 | Vadose Zone Soil | SGPPRMGTKTGTYKYRVWLNDQMVGQGEVILREK* |
| Ga0134072_102035921 | 3300015357 | Grasslands Soil | AGMRLLSGPPRAGSKAAAYKYRLWLNDQLVGQGEVILREK* |
| Ga0134112_104224732 | 3300017656 | Grasslands Soil | AGIRLLSGPPRAGSKAATYKYRLWLNDQLVGHGEVILREK |
| Ga0187803_100192841 | 3300017934 | Freshwater Sediment | MRLLSGPVAAGTKVGSYKYRLWLNEQMVGKGEVIVR |
| Ga0187854_100519751 | 3300017938 | Peatland | MHLQSGPPRPGVNPGSYRYRLWLNDQPVGAGEVILREK |
| Ga0187781_101047941 | 3300017972 | Tropical Peatland | MRLQSGPVVPGTKGGNYKYRLFLNEQMVGRGEVIVREK |
| Ga0187780_103774912 | 3300017973 | Tropical Peatland | SSGATRPGLNPGSYKYRLWMNDQPIGQGEVILREK |
| Ga0187810_100423471 | 3300018012 | Freshwater Sediment | PPGRQLHSGPPRPGTNQGSYKYRLWLNEQPIGNGEVILRER |
| Ga0187873_10608873 | 3300018013 | Peatland | RLLGGPPVPGTRAGSYKYKLWLNEQRVGRGEVILRDR |
| Ga0187890_101641932 | 3300018044 | Peatland | AGMRLLSGPARAGVKAGTFKYRLWLNEQIVGQGEVILRDK |
| Ga0187765_112826142 | 3300018060 | Tropical Peatland | LLSGPVVSGTKTGSYKYRLWLNDQMVGRGEVLVREK |
| Ga0187773_102008001 | 3300018064 | Tropical Peatland | MSGPVVPGTKTGTYKYRLWLNEQMVGRGEVVVREK |
| Ga0184640_100601931 | 3300018074 | Groundwater Sediment | PAGMRLLSGTARPGSKPGSYRYRLWLNDQLIGQGEVILREA |
| Ga0187771_102239751 | 3300018088 | Tropical Peatland | APEGSRLMSGPVVPGTKSGNYKYRLWLNEQLVGRGEVIVREKP |
| Ga0182028_15330722 | 3300019788 | Fen | MGMRLLSGPPVVGTKTGSYKYKLWLNEQMVGRGEVILRDR |
| Ga0179592_102881912 | 3300020199 | Vadose Zone Soil | LLSGPPRPGSKAASYKYRLWLNDQLVGHGEVILREK |
| Ga0210399_113429962 | 3300020581 | Soil | PAGMRLHSGPPRVGTKAGTYKYRLWLNDQPVGQGEVILREK |
| Ga0210401_106025041 | 3300020583 | Soil | NVFQVPAGMRLMSGPTIAGTKPGTFKYRLWLNDQMVGRGEVIVR |
| Ga0210401_110863373 | 3300020583 | Soil | QVPAGMRLMSGPTIAGTKPGTFKYRLWLNDQMVGRGEVIVR |
| Ga0210404_102139272 | 3300021088 | Soil | QAPAGMRLLSGPARVGIKDGAYKYRIWLNDQMVGQGEVILRGR |
| Ga0210404_106021772 | 3300021088 | Soil | LLSGPARVGIKDGTYKYRIWLNDQMVGQGEVILRGK |
| Ga0210405_101664843 | 3300021171 | Soil | RQLQSGPPRPGTNPGSFKYRLWLNDQPIGNGEVILREK |
| Ga0213876_104791131 | 3300021384 | Plant Roots | PAGMRLLSGPPRVGLKGSSFKYRLWLNDQFVGQAEVILRDK |
| Ga0210393_111424963 | 3300021401 | Soil | LQSGPPRPGINPGSYKYRLWLNDQPVGNGEVILREK |
| Ga0210397_100663847 | 3300021403 | Soil | MRLLSGPVRPGLKPGGYKYKLWLNEQMIGQGEVLLRG |
| Ga0210387_108379121 | 3300021405 | Soil | LLSGPPRVGLKGATYKYRLWLNDQLVGQGEVILREK |
| Ga0210386_104829403 | 3300021406 | Soil | NIFQAPVGMRLLSGPPRVGIKAGAYKYRVWLNDQMVGQGEVILREK |
| Ga0210391_109916651 | 3300021433 | Soil | FQASAGMRLLSGPPRVGLKGATYKYRLWLNDQLVGQGEVILREK |
| Ga0210392_112377742 | 3300021475 | Soil | GMRLLSGPPRPGSKAATYKYRLWLNDQLVGHGEVILREK |
| Ga0210402_119425271 | 3300021478 | Soil | APAGMRLLSGPPRVGTKTGNYKYRLWLNDQMVGQGEVILREK |
| Ga0126371_109394693 | 3300021560 | Tropical Forest Soil | LSGPARPGSKAATYKYRLWLNDQPVGQGEVILRER |
| Ga0242655_100645841 | 3300022532 | Soil | RLLSGPPRVGLKGSTYKYRLWLNDQLVGQGEVILREK |
| Ga0242665_103402142 | 3300022724 | Soil | AGMRLMSGPTIAGTKPGSFKYRLWLNDQMVGRGEVIVR |
| Ga0242665_103953941 | 3300022724 | Soil | PAGMRLLSGPPRPGNKAATYKYRVWLNDQLVGQGEVILREK |
| Ga0224544_10420711 | 3300023250 | Soil | MHLNSGPPRPATKPGSYRYKLWLNDQPVGAGEVILRER |
| Ga0247687_10015145 | 3300024286 | Soil | LLSGPPRPGLKAATYKYRLWLNDQLVGQGEVILREK |
| Ga0179589_103853302 | 3300024288 | Vadose Zone Soil | LLSGPPRVGIKDGTYKYRVWLNDQMVGQGEVILRGK |
| Ga0137417_13333384 | 3300024330 | Vadose Zone Soil | MRLLSGPPRPGSKAATYKYKLWLNDQLVGHGEVILRRNRG |
| Ga0207699_105119171 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | PAGMRLLSGPPRTGAKPATYKYRLWLNEQIVGQGEVILRDK |
| Ga0209838_10556132 | 3300026214 | Soil | RLLSGPPRVGIKAGTYKYRVWLNDQMVGQGEVILREK |
| Ga0209158_12793742 | 3300026333 | Soil | LLSGPPRPGSKAATYKYRLWLNDQLVGQGEVILRDK |
| Ga0257171_10196094 | 3300026377 | Soil | LSGPPRPGSKAATYKYKLWLNDQLVGHGEVILREK |
| Ga0209376_13098982 | 3300026540 | Soil | VRLLSGPPRPGSKAATYKYRLWLNDQLVGQGEVILREK |
| Ga0209156_101548022 | 3300026547 | Soil | LSGPPRPGSKATTYKYRLWLNDQLVGQGEVILREK |
| Ga0179593_11438091 | 3300026555 | Vadose Zone Soil | MRLLSGPPRPGSKAATYKYRLWLNDQLVGQGEVILRGK |
| Ga0207855_10317631 | 3300027039 | Tropical Forest Soil | SNIFQAPMGMRLLSGPPVAGTKAGTYKYRLWLNDQMVGRGEVIVREK |
| Ga0209525_10484923 | 3300027575 | Forest Soil | PAGMRLLSGPPRVGLKGATYKYRVWLNDQLVGQGEVILREK |
| Ga0209011_10953041 | 3300027678 | Forest Soil | RLLSGPPAVNTKAGSYKYRLWLNDQMVGRGEVIIRDK |
| Ga0209060_101375511 | 3300027826 | Surface Soil | LLSGPPVTGTKAGSYKYRLWLNDQMVGRGEVIVREK |
| Ga0209580_100965263 | 3300027842 | Surface Soil | QLQSGPPRPGVNAGSYKYRLWMNDQPIGHGEVILREK |
| Ga0209274_102268793 | 3300027853 | Soil | PAGMRLLSGPPRVGLKGATYKYRLWLNDQLVGQGEVILREK |
| Ga0209701_102506361 | 3300027862 | Vadose Zone Soil | SNVFQVPAGIRLLSGPPTIGTKPGTYKYRLWLNDQLVGRGEVILREK |
| Ga0209283_101686191 | 3300027875 | Vadose Zone Soil | SGMRLLSGPPRPGSKAATYKYRLWLNDQLVGQGEVILREK |
| Ga0209068_106123902 | 3300027894 | Watersheds | LSGPPRPGTKAATYKYRLWLNEQIVGQGEVILRDK |
| Ga0209488_107004332 | 3300027903 | Vadose Zone Soil | AAAGMRLLSGPPRPGSKAATYKYRLWLNDQLVGHGEVILREK |
| Ga0209415_108069663 | 3300027905 | Peatlands Soil | QLQSGPPRPGTNPGGFKYRLWMNEQQVGQGEVILREK |
| Ga0209526_101516901 | 3300028047 | Forest Soil | VGMRLLSGPPRVGTKGGTYKYRVWLNDQMVGQGEVILREK |
| Ga0137415_104293763 | 3300028536 | Vadose Zone Soil | PAGMRLLSGPARVGTKDGTYKYRVWLNDQMVGQGEVILRGK |
| Ga0308309_114628161 | 3300028906 | Soil | SNIFQAPVGMRLLSGPPRVGTKSGTYKYRVWLNDQMVGQGEVILREK |
| Ga0210278_11432962 | 3300030596 | Soil | RLLSGPPRIGLKGATYKYRLWLNDQLVGQGEVILREK |
| Ga0170820_141161512 | 3300031446 | Forest Soil | RLLSGPTIAGTKPGSFKYRLWLNDQMVGRGEVIVR |
| Ga0310915_107336791 | 3300031573 | Soil | GMRLLSGPAVAGTKPGSYKYRLWLNEQMVGKGEVIVR |
| Ga0265314_102700471 | 3300031711 | Rhizosphere | QGRQLQSGPPRPGINPGGYKYRLWMNDQPIGHGEVILRDK |
| Ga0307476_101510343 | 3300031715 | Hardwood Forest Soil | MGMRLLSGPVVTNTKAGSYKYRLWLNEQMVGKGEVLVRDK |
| Ga0307469_100005931 | 3300031720 | Hardwood Forest Soil | LSGPPRVGTKPASYKYRLWLNDQMVGQGEVILRGK |
| Ga0307469_101989821 | 3300031720 | Hardwood Forest Soil | LLSGPPRVGTKEGTYKYRVWLNDQMVGQGEVILRGK |
| Ga0307478_116712051 | 3300031823 | Hardwood Forest Soil | AGMRLLSGPPRTGTKDGTYKYRVWLNDQMVGQGEVILRGK |
| Ga0318564_103028631 | 3300031831 | Soil | VGMRLLSGPAVAGTKPGSYKYRLWLNEQMVGKGEVIVR |
| Ga0310912_113183632 | 3300031941 | Soil | GVRLLSGPPRPGSKAATYKYRLWLNDQLVGQGEVILREK |
| Ga0310913_111808341 | 3300031945 | Soil | MRLLSGPAVAGTKPGSYKYRLWLNEQMVGKGEVIVR |
| Ga0307479_101520881 | 3300031962 | Hardwood Forest Soil | PAGMRLLSGPPRPGSKAATYKYRLWLNDQLVGHGEVILRGK |
| Ga0318549_104384901 | 3300032041 | Soil | RLLSGPAVAGTKPGSYKYRLWLNEQMVGKGEVIVR |
| Ga0307471_1030447331 | 3300032180 | Hardwood Forest Soil | AGMRLLSGPPRPGSKAATYKYKLWLNDQLVGHGEVILREK |
| Ga0335079_108309643 | 3300032783 | Soil | MSGPPRTAINPGSYKYRVWLNDQHVADGEIVIRQKQP |
| Ga0335070_112733832 | 3300032829 | Soil | AGMRLLSGPVTVGTKSGSFKYRLWLNDQMVGRGEVIVRA |
| Ga0316212_10047406 | 3300033547 | Roots | MRLLSGPPRVGLKGATYKYRVWLNDQLVGQGEVILREK |
| Ga0370483_0001540_6240_6356 | 3300034124 | Untreated Peat Soil | MRLLSGPARAGVKAGTFKYRLWLNEQIVGQGEVILRDK |
| ⦗Top⦘ |