| Basic Information | |
|---|---|
| Family ID | F053863 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 140 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MATTWELMAICIEDAVRAEDLVRELAFRRELRLDPQKALSAFELRAKPAR |
| Number of Associated Samples | 118 |
| Number of Associated Scaffolds | 140 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 71.43 % |
| % of genes near scaffold ends (potentially truncated) | 32.86 % |
| % of genes from short scaffolds (< 2000 bps) | 81.43 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.857 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.571 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.571 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.85% β-sheet: 0.00% Coil/Unstructured: 46.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 140 Family Scaffolds |
|---|---|---|
| PF00005 | ABC_tran | 50.00 |
| PF01061 | ABC2_membrane | 5.71 |
| PF00520 | Ion_trans | 3.57 |
| PF02585 | PIG-L | 1.43 |
| PF00583 | Acetyltransf_1 | 1.43 |
| PF02771 | Acyl-CoA_dh_N | 0.71 |
| PF07992 | Pyr_redox_2 | 0.71 |
| PF01544 | CorA | 0.71 |
| PF00009 | GTP_EFTU | 0.71 |
| PF07676 | PD40 | 0.71 |
| PF00137 | ATP-synt_C | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 140 Family Scaffolds |
|---|---|---|---|
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 1.43 |
| COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 0.71 |
| COG0636 | FoF1-type ATP synthase, membrane subunit c/Archaeal/vacuolar-type H+-ATPase, subunit K | Energy production and conversion [C] | 0.71 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.86 % |
| Unclassified | root | N/A | 27.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001661|JGI12053J15887_10046067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2445 | Open in IMG/M |
| 3300004156|Ga0062589_101133059 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300004157|Ga0062590_102150231 | Not Available | 583 | Open in IMG/M |
| 3300004463|Ga0063356_101118026 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
| 3300004463|Ga0063356_103918518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 641 | Open in IMG/M |
| 3300004479|Ga0062595_101709210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 593 | Open in IMG/M |
| 3300005093|Ga0062594_101837652 | Not Available | 640 | Open in IMG/M |
| 3300005166|Ga0066674_10011086 | All Organisms → cellular organisms → Bacteria | 3728 | Open in IMG/M |
| 3300005289|Ga0065704_10567196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 625 | Open in IMG/M |
| 3300005293|Ga0065715_10137380 | All Organisms → cellular organisms → Bacteria | 1906 | Open in IMG/M |
| 3300005334|Ga0068869_100140294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1866 | Open in IMG/M |
| 3300005345|Ga0070692_10709984 | Not Available | 677 | Open in IMG/M |
| 3300005354|Ga0070675_100669171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 944 | Open in IMG/M |
| 3300005438|Ga0070701_10318534 | Not Available | 961 | Open in IMG/M |
| 3300005440|Ga0070705_100382760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1036 | Open in IMG/M |
| 3300005467|Ga0070706_100000654 | All Organisms → cellular organisms → Bacteria | 39587 | Open in IMG/M |
| 3300005530|Ga0070679_100897905 | Not Available | 830 | Open in IMG/M |
| 3300005536|Ga0070697_100549498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1013 | Open in IMG/M |
| 3300005545|Ga0070695_101452771 | Not Available | 570 | Open in IMG/M |
| 3300005549|Ga0070704_100304859 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300005556|Ga0066707_10473305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 813 | Open in IMG/M |
| 3300005559|Ga0066700_10668264 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300005617|Ga0068859_100396582 | All Organisms → cellular organisms → Bacteria | 1476 | Open in IMG/M |
| 3300005617|Ga0068859_100773166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1049 | Open in IMG/M |
| 3300006049|Ga0075417_10000875 | All Organisms → cellular organisms → Bacteria | 7600 | Open in IMG/M |
| 3300006049|Ga0075417_10104637 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
| 3300006846|Ga0075430_100186081 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Microgenomates | 1727 | Open in IMG/M |
| 3300006852|Ga0075433_10154310 | All Organisms → cellular organisms → Bacteria | 2043 | Open in IMG/M |
| 3300006852|Ga0075433_10283176 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
| 3300006853|Ga0075420_100575433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 972 | Open in IMG/M |
| 3300006876|Ga0079217_10459417 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300006894|Ga0079215_10113700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1220 | Open in IMG/M |
| 3300006894|Ga0079215_11380741 | Not Available | 549 | Open in IMG/M |
| 3300006918|Ga0079216_10174185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1150 | Open in IMG/M |
| 3300007004|Ga0079218_10268853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1360 | Open in IMG/M |
| 3300007004|Ga0079218_10920992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 862 | Open in IMG/M |
| 3300007004|Ga0079218_11374937 | Not Available | 751 | Open in IMG/M |
| 3300007076|Ga0075435_100297261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1380 | Open in IMG/M |
| 3300007258|Ga0099793_10268760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 825 | Open in IMG/M |
| 3300009012|Ga0066710_100309490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2318 | Open in IMG/M |
| 3300009038|Ga0099829_10045266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3230 | Open in IMG/M |
| 3300009053|Ga0105095_10815455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 523 | Open in IMG/M |
| 3300009088|Ga0099830_11611391 | Not Available | 541 | Open in IMG/M |
| 3300009089|Ga0099828_11345060 | Not Available | 631 | Open in IMG/M |
| 3300009090|Ga0099827_10058280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2933 | Open in IMG/M |
| 3300009147|Ga0114129_10040272 | All Organisms → cellular organisms → Bacteria | 6587 | Open in IMG/M |
| 3300009176|Ga0105242_11239417 | Not Available | 767 | Open in IMG/M |
| 3300009823|Ga0105078_1027695 | Not Available | 682 | Open in IMG/M |
| 3300010397|Ga0134124_10655088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1034 | Open in IMG/M |
| 3300010399|Ga0134127_11857283 | Not Available | 679 | Open in IMG/M |
| 3300010400|Ga0134122_10022890 | All Organisms → cellular organisms → Bacteria | 4700 | Open in IMG/M |
| 3300012189|Ga0137388_10514092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1112 | Open in IMG/M |
| 3300012203|Ga0137399_10125187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2025 | Open in IMG/M |
| 3300012203|Ga0137399_10175316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1728 | Open in IMG/M |
| 3300012203|Ga0137399_10765320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 813 | Open in IMG/M |
| 3300012204|Ga0137374_10086198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3020 | Open in IMG/M |
| 3300012206|Ga0137380_10184396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1897 | Open in IMG/M |
| 3300012225|Ga0137434_1077449 | Not Available | 530 | Open in IMG/M |
| 3300012355|Ga0137369_10138445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1946 | Open in IMG/M |
| 3300012355|Ga0137369_10740610 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300012355|Ga0137369_10889895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 599 | Open in IMG/M |
| 3300012358|Ga0137368_10687162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 644 | Open in IMG/M |
| 3300012360|Ga0137375_11195125 | Not Available | 583 | Open in IMG/M |
| 3300012363|Ga0137390_10164838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2204 | Open in IMG/M |
| 3300012685|Ga0137397_10023430 | All Organisms → cellular organisms → Bacteria | 4357 | Open in IMG/M |
| 3300012918|Ga0137396_10110888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1969 | Open in IMG/M |
| 3300012925|Ga0137419_10127232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria | 1808 | Open in IMG/M |
| 3300012925|Ga0137419_11277524 | Not Available | 616 | Open in IMG/M |
| 3300012925|Ga0137419_11775477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 527 | Open in IMG/M |
| 3300013100|Ga0157373_10970184 | Not Available | 633 | Open in IMG/M |
| 3300015371|Ga0132258_10665654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2619 | Open in IMG/M |
| 3300015372|Ga0132256_100187891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2105 | Open in IMG/M |
| 3300015374|Ga0132255_102946507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 727 | Open in IMG/M |
| 3300017657|Ga0134074_1236102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 655 | Open in IMG/M |
| 3300017997|Ga0184610_1267809 | Not Available | 566 | Open in IMG/M |
| 3300018027|Ga0184605_10076367 | All Organisms → cellular organisms → Bacteria | 1456 | Open in IMG/M |
| 3300018027|Ga0184605_10468604 | Not Available | 553 | Open in IMG/M |
| 3300018028|Ga0184608_10018247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2510 | Open in IMG/M |
| 3300018028|Ga0184608_10104292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1187 | Open in IMG/M |
| 3300018028|Ga0184608_10150311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1003 | Open in IMG/M |
| 3300018031|Ga0184634_10074333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1449 | Open in IMG/M |
| 3300018054|Ga0184621_10033025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1664 | Open in IMG/M |
| 3300018056|Ga0184623_10124891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1190 | Open in IMG/M |
| 3300018063|Ga0184637_10797005 | Not Available | 504 | Open in IMG/M |
| 3300018071|Ga0184618_10074921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1283 | Open in IMG/M |
| 3300018076|Ga0184609_10132058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1141 | Open in IMG/M |
| 3300018078|Ga0184612_10411803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 678 | Open in IMG/M |
| 3300018079|Ga0184627_10133508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1315 | Open in IMG/M |
| 3300018433|Ga0066667_10039453 | All Organisms → cellular organisms → Bacteria | 2747 | Open in IMG/M |
| 3300020003|Ga0193739_1007045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3000 | Open in IMG/M |
| 3300020202|Ga0196964_10558748 | Not Available | 562 | Open in IMG/M |
| 3300021073|Ga0210378_10027442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2279 | Open in IMG/M |
| 3300021073|Ga0210378_10302461 | Not Available | 601 | Open in IMG/M |
| 3300021080|Ga0210382_10351361 | Not Available | 651 | Open in IMG/M |
| 3300021972|Ga0193737_1011161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1228 | Open in IMG/M |
| 3300022534|Ga0224452_1019164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1891 | Open in IMG/M |
| 3300022694|Ga0222623_10285673 | Not Available | 634 | Open in IMG/M |
| 3300025901|Ga0207688_10612270 | Not Available | 687 | Open in IMG/M |
| 3300025908|Ga0207643_10201523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1212 | Open in IMG/M |
| 3300025910|Ga0207684_10000362 | All Organisms → cellular organisms → Bacteria | 61367 | Open in IMG/M |
| 3300025917|Ga0207660_10065969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2617 | Open in IMG/M |
| 3300025922|Ga0207646_11043841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 721 | Open in IMG/M |
| 3300025927|Ga0207687_11585491 | Not Available | 562 | Open in IMG/M |
| 3300025933|Ga0207706_11659381 | Not Available | 516 | Open in IMG/M |
| 3300025934|Ga0207686_10489536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 952 | Open in IMG/M |
| 3300025942|Ga0207689_10178719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1750 | Open in IMG/M |
| 3300026480|Ga0257177_1078453 | Not Available | 534 | Open in IMG/M |
| 3300026538|Ga0209056_10174265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1609 | Open in IMG/M |
| 3300027454|Ga0207623_103112 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 550 | Open in IMG/M |
| 3300027471|Ga0209995_1008708 | All Organisms → cellular organisms → Bacteria | 1638 | Open in IMG/M |
| 3300027546|Ga0208984_1004896 | All Organisms → cellular organisms → Bacteria | 2388 | Open in IMG/M |
| 3300027617|Ga0210002_1069020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 622 | Open in IMG/M |
| 3300027633|Ga0208988_1013628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2055 | Open in IMG/M |
| 3300027637|Ga0209818_1111799 | Not Available | 734 | Open in IMG/M |
| 3300027639|Ga0209387_1064533 | Not Available | 834 | Open in IMG/M |
| 3300027669|Ga0208981_1008599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2579 | Open in IMG/M |
| 3300027671|Ga0209588_1234994 | Not Available | 563 | Open in IMG/M |
| 3300027678|Ga0209011_1043343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1393 | Open in IMG/M |
| 3300027695|Ga0209966_1128847 | Not Available | 584 | Open in IMG/M |
| 3300027738|Ga0208989_10112038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 927 | Open in IMG/M |
| 3300027738|Ga0208989_10257607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 567 | Open in IMG/M |
| 3300027846|Ga0209180_10309122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 905 | Open in IMG/M |
| 3300027873|Ga0209814_10003896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 5603 | Open in IMG/M |
| 3300027873|Ga0209814_10163070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 958 | Open in IMG/M |
| 3300027882|Ga0209590_10092065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1795 | Open in IMG/M |
| 3300027886|Ga0209486_10378761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 853 | Open in IMG/M |
| 3300027886|Ga0209486_10394933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 838 | Open in IMG/M |
| 3300028380|Ga0268265_10901262 | Not Available | 868 | Open in IMG/M |
| 3300028536|Ga0137415_11445209 | Not Available | 511 | Open in IMG/M |
| 3300028708|Ga0307295_10162734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 623 | Open in IMG/M |
| 3300028784|Ga0307282_10132089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1175 | Open in IMG/M |
| 3300028819|Ga0307296_10473148 | Not Available | 685 | Open in IMG/M |
| 3300028875|Ga0307289_10134804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1014 | Open in IMG/M |
| 3300028875|Ga0307289_10372900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 587 | Open in IMG/M |
| 3300028881|Ga0307277_10148670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1015 | Open in IMG/M |
| 3300030997|Ga0073997_11982457 | Not Available | 626 | Open in IMG/M |
| 3300030997|Ga0073997_12192481 | Not Available | 854 | Open in IMG/M |
| 3300030998|Ga0073996_12396724 | Not Available | 849 | Open in IMG/M |
| 3300031740|Ga0307468_100549565 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 930 | Open in IMG/M |
| 3300031965|Ga0326597_10461267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1395 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.57% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 10.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 7.86% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.43% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.43% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.57% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.86% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.14% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.14% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.14% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.14% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.14% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.43% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.43% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.43% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.43% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.71% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.71% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.71% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.71% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009823 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012225 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2 | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300020202 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021972 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m2 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027454 | Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G09K2-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300030997 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030998 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12053J15887_100460673 | 3300001661 | Forest Soil | MATTWEMIAVCFEDAVRAEDLVRELAFRRELRLDPQKALSAFELRSAKAAR* |
| Ga0062589_1011330592 | 3300004156 | Soil | MATTWEMIAICMDDAVRAEDLARELAFRRELRIDPQKALSAFELRTKPAR* |
| Ga0062590_1021502312 | 3300004157 | Soil | MATTWEMIAICIDDAVRAEDLARELAFRRELRIDPQKALSAFELRTKPAR* |
| Ga0063356_1011180262 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSSTLELMAACIEDASRAEDLFSQLAFRRELRIDPQKALSAFELRPKSVRQR* |
| Ga0063356_1039185181 | 3300004463 | Arabidopsis Thaliana Rhizosphere | ICMEDAVRAEDLVKELAFRRELRIDPQRALSAFELRAKPAR* |
| Ga0062595_1017092101 | 3300004479 | Soil | MATTWEMIAICMDDAVRAEDLARELAFRRELRIDPQKALSAFELRAKPAR* |
| Ga0062594_1018376521 | 3300005093 | Soil | TTWEMIAICMEDAVRAEDLVKELAFRRELRIDPQKALSAFELRAKPAR* |
| Ga0066674_100110864 | 3300005166 | Soil | MATTWEMIAVCIEDAVRAEDLVRELAFRRELRLDPMKALSAFEIRSKPAR* |
| Ga0065704_105671962 | 3300005289 | Switchgrass Rhizosphere | MATTWEMIAICMEDAVRAEDLVKELVFRRELRIDPQKALSAFELRAKPAR* |
| Ga0065715_101373802 | 3300005293 | Miscanthus Rhizosphere | MATTWEMIAICMEDAVRAEDLVKELAFRRELRIDPQKALSAFELRAKPAR* |
| Ga0068869_1001402944 | 3300005334 | Miscanthus Rhizosphere | MIAICMDDAVRAEDLARELAFRRELRIDPQKALSAFELRTKPAR* |
| Ga0070692_107099841 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | WEMIAICMDDAVRAEDLARELAFRRELRIDPQKALSAFELRTKPAR* |
| Ga0070675_1006691713 | 3300005354 | Miscanthus Rhizosphere | LPERAPEVTEMATTWEMIAICMDDAVRAEDLARELAFRRELRIDPQKALSAFELRTKPAR |
| Ga0070701_103185342 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MATTWEMIAICMEDAVRAEDLVKELAFRRELRIDPQRALSAFELRAKPAR* |
| Ga0070705_1003827601 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSTWELMVVCIEDAARAEDLVRELAFRRELRFDPQKALAAFELRAKPSR* |
| Ga0070706_1000006546 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MATTWEMIAVCLEDAVRAEDLVRELAFRRELRLDPLKALSAFQLRSKPER* |
| Ga0070679_1008979052 | 3300005530 | Corn Rhizosphere | MATTWEMIAICMEDAVRAEDLARELTFRRELRIDPQKALSAFEVRAKPAR* |
| Ga0070697_1005494981 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | ERAPEVTEMATTWEMIAICMEDAVRAEDLVKELAFRRELRIDPQKALSAFELRAKPAR* |
| Ga0070695_1014527712 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | ATTWEMIAICMEDAVRAEDLVKELVFRRELRIDPQKALSAFELRAKPAR* |
| Ga0070704_1003048593 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | TWEMIAICMEDAVRAEDLVKELAFRRELRIDPQKALSAFELRAKPAR* |
| Ga0066707_104733052 | 3300005556 | Soil | MATTWEMIAVCIEDAVRAEDLVRELAFRRELRLDPQKALSAFEIRSKPAR* |
| Ga0066700_106682642 | 3300005559 | Soil | MATTWEMIAVCIEDAVRAEDLVRELAFRRELRLDPQRALSAFEIRSKPAR* |
| Ga0068859_1003965824 | 3300005617 | Switchgrass Rhizosphere | MDDAVRAEDLARELAFRRELRIDPQKALSAFELRTKPAR* |
| Ga0068859_1007731662 | 3300005617 | Switchgrass Rhizosphere | MATTWEMIAICMEDAVRAEDLVKELAFRRELHIDPQRALSAFELRAKPAR* |
| Ga0075417_100008757 | 3300006049 | Populus Rhizosphere | MSSTWELMAVCTRDAARAEDLVRELAFRRELRLDPQKALAAFELRGKPAR* |
| Ga0075417_101046372 | 3300006049 | Populus Rhizosphere | MCIDDAVRAEDLVRELAFRRQLRVDPQKALAAFELRRSKPAR* |
| Ga0075430_1001860811 | 3300006846 | Populus Rhizosphere | MATTWELLAICLEDAVRAEDLVRELAFRRELRLDPQKALSA |
| Ga0075433_101543102 | 3300006852 | Populus Rhizosphere | MATTWEMIAICMEDAVRAEDLVTELAFRRELRIDPQKALSAFELRAKPARRLT* |
| Ga0075433_102831761 | 3300006852 | Populus Rhizosphere | AVRAEDLVRELAFLRELRLDPQKALSAFQLRSKPAR* |
| Ga0075420_1005754333 | 3300006853 | Populus Rhizosphere | MATTWELLAICLEDAVRAEDLVRELAFRRELRLDPQKALSAFELRAKPSRQR* |
| Ga0079217_104594172 | 3300006876 | Agricultural Soil | MSSTWELMTVCIQDAARAEDLAGELAFRRELRLDPQKALSAFELRAKPAR* |
| Ga0079215_101137002 | 3300006894 | Agricultural Soil | MSSTWELMTVCIQDAARAEDLVKELAFRRELRLDPQKALSAFVLRAKPAR* |
| Ga0079215_113807412 | 3300006894 | Agricultural Soil | TEVTEMSSTWELMTVCIQDAARAEDLAGELAFRRELRLDPQKALSAFELRAKPAR* |
| Ga0079216_101741852 | 3300006918 | Agricultural Soil | MSSTWELMTVCNQDAARAEDLAGELAFRRELRLDPQKALSAFELRAKPAR* |
| Ga0079218_102688532 | 3300007004 | Agricultural Soil | MSSTWELMTVCIQDAARAEDLAGELAFRRELRLDPQKALSAFELRAKPAVS* |
| Ga0079218_109209922 | 3300007004 | Agricultural Soil | MSPHEGAEVKAMSSTWELMAICTRDAARAEDLVRELAFRRELRLDPQKALAAFELRAKPAR* |
| Ga0079218_113749371 | 3300007004 | Agricultural Soil | MSSTWELMTVCIQDAARAEDLAGKLAFRRELRLDPQKALSAFELRAKPAR* |
| Ga0075435_1002972611 | 3300007076 | Populus Rhizosphere | RAEDLVRELAFLRELRLDPQKALSAFQLRSKPAR* |
| Ga0099793_102687602 | 3300007258 | Vadose Zone Soil | MATTWELMAICIEDAVRAEDLVRELAFRRELRLDPQKALSAFELRAKPAR* |
| Ga0066710_1003094902 | 3300009012 | Grasslands Soil | MATTWEMIAVCIEDAVRAEDLVRELAFRRELRLDPQKALSAFEIRSKPAR |
| Ga0099829_100452664 | 3300009038 | Vadose Zone Soil | MATTWEMIAVCLEDAVRAEDLVRELAFRRELRLDPQKALSAFELRSKPER* |
| Ga0105095_108154551 | 3300009053 | Freshwater Sediment | MSSTWELMAICTRDAARAEDLVRELAFRRELRLDPQKALSAFELRGKPA |
| Ga0099830_116113912 | 3300009088 | Vadose Zone Soil | MATTWELIAVCLEDAVRAEDLVRELAFRRELRLDPQKALSAFELRSKPER* |
| Ga0099828_113450602 | 3300009089 | Vadose Zone Soil | CLEDAVRAEDLVRELAFRRELRLDPLKALSAFQLRSKPER* |
| Ga0099827_100582803 | 3300009090 | Vadose Zone Soil | MSSQERTGVKEMATTWEMIAVCIEDAVRAEDLVRELAFRRDLRLDPQKALSAFEIRSKPAR* |
| Ga0114129_100402727 | 3300009147 | Populus Rhizosphere | MTTTWELMAMCIDDAVRAEDLVRELAFRRQLRVDPQKALAAFELRRSKPAR* |
| Ga0105242_112394172 | 3300009176 | Miscanthus Rhizosphere | MATTWEMIAICMEDAVRAEDLVKELAFRRELRIDPQKALSAFEVRAKPAR* |
| Ga0105078_10276952 | 3300009823 | Groundwater Sand | MCTYEDAEVTAMSSTWELMVVCIQDAARAEDLVRELAFRRELRFDPQKALSAFELRAKPSR* |
| Ga0134124_106550881 | 3300010397 | Terrestrial Soil | IAICMDDAVRAEDLARELAFRRELRIDPQKALSAFELRTKPAR* |
| Ga0134127_118572831 | 3300010399 | Terrestrial Soil | VRAEDLVKELAFRRELRIDPQRALSAFELRAKPAR* |
| Ga0134122_100228902 | 3300010400 | Terrestrial Soil | MATTWEMIAICMEDAVRAEDLVKELAFRRELRVDPQKALSAFELRAKPAR* |
| Ga0137388_105140921 | 3300012189 | Vadose Zone Soil | MATTWEMIAVCLEDAVRAEDLVRELAFRRELRLDPLKALSAFQLHSKPER* |
| Ga0137399_101251873 | 3300012203 | Vadose Zone Soil | MATTWELMAICIEDAVRAEDLVRELAFRRELRLDPQKALSAFELRSKPAR* |
| Ga0137399_101753164 | 3300012203 | Vadose Zone Soil | TTWELMAICIEDAARADDLVKELAFRRELRLDPLKALAAFELRTRPDR* |
| Ga0137399_107653201 | 3300012203 | Vadose Zone Soil | MATTWEMIAVCIEDAVRAEDLVRELAFRRELRLDPQKALSAFEIRSKLAR* |
| Ga0137374_100861984 | 3300012204 | Vadose Zone Soil | MATTWEMIAICMEDAVRAEDLIKELAFRRELRIDPQKALSAFELRAKPAR* |
| Ga0137380_101843962 | 3300012206 | Vadose Zone Soil | MATTWEMIAVCIEDAVRAEDLVRELAFRRELRLDPQKALSAFEIRSEPAR* |
| Ga0137434_10774491 | 3300012225 | Soil | MCSYEDAEVTAMSSTWELLAVCTRDAARAEDLVRELAFRRELRFDPQKALSAFELRAKPSR* |
| Ga0137369_101384454 | 3300012355 | Vadose Zone Soil | MATTWELISVCIDDAVRAEDLVRELAFRRDLRLDPQKALSAFELRRTKPER* |
| Ga0137369_107406103 | 3300012355 | Vadose Zone Soil | MATTWELLAVCLEDALRAEDLVRELAFRRELRLDPQKALSAFEL |
| Ga0137369_108898952 | 3300012355 | Vadose Zone Soil | MATTWEMIAICMDDAVRAEDLVKELAFRRELRIDPQKALSAFELRSKPAR* |
| Ga0137368_106871621 | 3300012358 | Vadose Zone Soil | MATTWELLTICIDDAVRAEDLVRELAFRRELRLDPKKALEAFELRRTRSGR* |
| Ga0137375_111951251 | 3300012360 | Vadose Zone Soil | MATTWELLTICIDDAVRAEDLVRELAFRRELRLDPKKALAAFELRRTRSGR* |
| Ga0137390_101648384 | 3300012363 | Vadose Zone Soil | MATTWEMIAVCLEDAVRAEDLVRELAFRRELRLDPQKALSSFQLRSKPER* |
| Ga0137397_100234305 | 3300012685 | Vadose Zone Soil | MATTGELMAICIEDAVRAEDLVRELAFRRELRLDPQKALSAFELRSKPAR* |
| Ga0137396_101108882 | 3300012918 | Vadose Zone Soil | MATTWELMAICIEDAARADDLVKELAFRRELRLDPLKALAAFELRTRPDR* |
| Ga0137419_101272323 | 3300012925 | Vadose Zone Soil | MATTWELMAICIEDAVRAEDLVRELAFRRELRLDPQKALSAFELR |
| Ga0137419_112775241 | 3300012925 | Vadose Zone Soil | MATTWEMIAVCMEDAVRAEDLVRELAFRRDLRFDPQKALSAFKLRSTTSDR* |
| Ga0137419_117754772 | 3300012925 | Vadose Zone Soil | MATTWEMIAVCIEDAVRAEDLVRELAFRRELRLDPQKALSAFELRSAKAAR* |
| Ga0157373_109701841 | 3300013100 | Corn Rhizosphere | TEMATTWEMIAICMEDAVRAEDLAGELAFRRELRIDPQKALSAFEVRAKPAR* |
| Ga0132258_106656544 | 3300015371 | Arabidopsis Rhizosphere | MATTWELMAVCIEDAKRAEDLVRELAFRRELRLDPQRALSAFELRAKQARQR* |
| Ga0132256_1001878912 | 3300015372 | Arabidopsis Rhizosphere | MAGVTEMATTWELMAVCIEDAKRAEDLVRELAFRRELRLDPQRALSAFELRAKQARQR* |
| Ga0132255_1029465071 | 3300015374 | Arabidopsis Rhizosphere | MAVCIEDAKRAEDLVRELAFRRELRLDPQGALSAFELRAKQARQR* |
| Ga0134074_12361021 | 3300017657 | Grasslands Soil | MATTWEMIAVCIEDAVRAEDLVRELAFRRELRLDPMKALSAFEIR |
| Ga0184610_12678092 | 3300017997 | Groundwater Sediment | MSSTWELMVVCIEDAARAEDLVRELAFRRELRLDPQKALSAFELRAKPAR |
| Ga0184605_100763672 | 3300018027 | Groundwater Sediment | MATTWEMIAICMEDAVRAEDLVKELAFRRELRIDPQKALSAFELRSKPAR |
| Ga0184605_104686041 | 3300018027 | Groundwater Sediment | MSSTWELMAVCMEDAARAEDLVRELAFRRELRFDPQKALAAFELRAKPAR |
| Ga0184608_100182472 | 3300018028 | Groundwater Sediment | MATTWEMIAICMEDAVRAEDLVKELAFRRELRIDPQKALSAFELRAKPAR |
| Ga0184608_101042921 | 3300018028 | Groundwater Sediment | MSSTWELMAVCMEDAARAEDLVRELAFRRELRLDPQKA |
| Ga0184608_101503112 | 3300018028 | Groundwater Sediment | MATTWEMIAICMEDAVRAEDLVKELAFRRELRIVPQKALSAFELRAKPSR |
| Ga0184634_100743332 | 3300018031 | Groundwater Sediment | MSSTWELMAICIEDAARAEDLVTEVAFRRELRLDPQKALSAFELRAKPAR |
| Ga0184621_100330252 | 3300018054 | Groundwater Sediment | MATTWEMIAICMEDAVRAEDLVKELAFRREPRIDPQKALSAFELRAKPAR |
| Ga0184623_101248912 | 3300018056 | Groundwater Sediment | MSNTWELMVVCIEDAARAEDLVRELAFRRELRLDPQKALSAFELRAKPAR |
| Ga0184637_107970052 | 3300018063 | Groundwater Sediment | MSSTWELMAVCIEDAARAEDLVRELAFRRELRLDPQKALSAFELRAKPAR |
| Ga0184618_100749212 | 3300018071 | Groundwater Sediment | MATTWEMIAICMEDAVRAEDLVKELAFRRELRIDPQKALSAFQLRSKPAR |
| Ga0184609_101320582 | 3300018076 | Groundwater Sediment | MSSTWELMAVCTRDAARAEDLVRELAFRRELRLDPQKALAAFELTGKPAR |
| Ga0184612_104118031 | 3300018078 | Groundwater Sediment | MSSTWELMVVCIEDAARAEDLVRELAFRRELRLDPQKALAAFELRAKPAR |
| Ga0184627_101335083 | 3300018079 | Groundwater Sediment | MSSTWELMVVCIEDAARAEDLVRELAFRRELRLDPQKALSAFELRAK |
| Ga0066667_100394533 | 3300018433 | Grasslands Soil | MATTWEMIAVCIEDAVRAEDLVRELAFRRELRLDPMKALSAFEIRSKPAR |
| Ga0193739_10070455 | 3300020003 | Soil | MSSTWELMAICTRDAARAEDLVRELAFRRELRLDPQKALAAFELRGKPAR |
| Ga0196964_105587482 | 3300020202 | Soil | MSNTWELMAVCIRDAQRAEDLARELVFRRELRRDPQKALAAFELRAETAR |
| Ga0210378_100274423 | 3300021073 | Groundwater Sediment | MATTWEMIAICMGDAVRAEDLVKELAFRRELRIDPQKALSAFELRAKPAR |
| Ga0210378_103024612 | 3300021073 | Groundwater Sediment | VCMEDAARAEDLVRELAFRRELRLDPQKALAAFELRGKPAR |
| Ga0210382_103513612 | 3300021080 | Groundwater Sediment | MATTWELMAICIEDAVRAEDLVTELAFRRELRLDPQKALSAFELRAKPAR |
| Ga0193737_10111612 | 3300021972 | Soil | MSSTWELMAICTRDAARAEDLVRELAFRRELRLDPQKALAAFELRGKPE |
| Ga0224452_10191644 | 3300022534 | Groundwater Sediment | MATTWEMIAICMEDAVRAEDLVKELAFRRELRIDPQRALSAFELRAKPAR |
| Ga0222623_102856731 | 3300022694 | Groundwater Sediment | MATTWEMIAICMEDAVRAEDLMKELAFRRELRIDPHKALSAFELRAKPAR |
| Ga0207688_106122702 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MATTWEMIAICMDDAVRAEDLARELAFRRELRIDPQKALSAFELRTKPAR |
| Ga0207643_102015232 | 3300025908 | Miscanthus Rhizosphere | MATTWEMIAICMEDAVRAEDLARELTFRRELRIDPQKALSAFEVRAKPAR |
| Ga0207684_100003626 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MATTWEMIAVCLEDAVRAEDLVRELAFRRELRLDPLKALSAFQLRSKPER |
| Ga0207660_100659695 | 3300025917 | Corn Rhizosphere | QERAPEVTEMATTWEMIAICMEDAVRAEDLARELTFRRELRIDPQKALSAFEVRAKPAR |
| Ga0207646_110438412 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VIEVATTWEMIAVCLEDAVRAEDLVRELAFRRELRLDPLKALSAFQLRSKPER |
| Ga0207687_115854911 | 3300025927 | Miscanthus Rhizosphere | WEMIAICMEDAVRAEDLVKELAFRRELRIDPQRALSAFELRAKPAR |
| Ga0207706_116593812 | 3300025933 | Corn Rhizosphere | PEVTEMATTWEMIAICMDDAVRAEDLARELAFRRELRIDPQKALSAFELRTKPAR |
| Ga0207686_104895362 | 3300025934 | Miscanthus Rhizosphere | MATTWEMIAICMEDAVRAEDLVKELAFRRELRIDPQKALSAFEVRAKPAR |
| Ga0207689_101787191 | 3300025942 | Miscanthus Rhizosphere | PEIAICMDDAVRAEDLARELAFRRELRIDPQKALSAFELRTKPAR |
| Ga0257177_10784531 | 3300026480 | Soil | VCLEDAVRAEDLVRELAFRRELRLDPQKALSAFELRSKPER |
| Ga0209056_101742651 | 3300026538 | Soil | MATTWEMIAVCIEDAVRAEDLVRELAFRRELRLDPMKALSAFEIRSTPAR |
| Ga0207623_1031122 | 3300027454 | Soil | DAVRAEDLARELAFRRELRIDPQKALSAFELRTKPAR |
| Ga0209995_10087082 | 3300027471 | Arabidopsis Thaliana Rhizosphere | MSSTWELMVVCIEDAARAEDLMRQLAFRRELRLDPQKALSAFELRKKPAR |
| Ga0208984_10048963 | 3300027546 | Forest Soil | MATTWEMIAVCFEDAVRAEDLVRELAFRRELRLDPQKALSAFELRSAKAAR |
| Ga0210002_10690203 | 3300027617 | Arabidopsis Thaliana Rhizosphere | MSSTWELMAVCIEDAARAEDLVKELAFRRELRLDPQKALSAFELRRKP |
| Ga0208988_10136284 | 3300027633 | Forest Soil | MATTWEMIAVCFEDAVRAEDLVRELAFRRELRLDPQKALSAF |
| Ga0209818_11117992 | 3300027637 | Agricultural Soil | MSSTWELMTVCIQDAARAEDLAGELAFRRELRLDPQKALSAFELRAKPAR |
| Ga0209387_10645332 | 3300027639 | Agricultural Soil | MSSTWELMTVCIQDAARAEDLVKELAFRRELRLDPQKALSAFVLRAKPAR |
| Ga0208981_10085995 | 3300027669 | Forest Soil | MATTWEMIAVCFEDAVRAEDLVRELAFRRELRLDPQKALSAFELRSTKAAR |
| Ga0209588_12349942 | 3300027671 | Vadose Zone Soil | MATTWEMIAVSLRDAVRAEDLVCELAFRRELRLDPQKALSAFQLRSKPER |
| Ga0209011_10433432 | 3300027678 | Forest Soil | MATTWEMVAICMEDAVRAEDLVRELAFRRDLRLDPQKALSAFKLRSTKPER |
| Ga0209966_11288472 | 3300027695 | Arabidopsis Thaliana Rhizosphere | MSSTWELMAICTRDAARAEDLVRELAFRRELRLDPQKALSAFELRKKPAR |
| Ga0208989_101120381 | 3300027738 | Forest Soil | MATTWEMIATCIEDAVRAEDLVRELAFRRDLRFDPQKALSAFKLRSTTSDR |
| Ga0208989_102576071 | 3300027738 | Forest Soil | MATTWEMIAVCFEDAVRAEDLVRELAFRRELRLDPQKALSAFELRSAK |
| Ga0209180_103091222 | 3300027846 | Vadose Zone Soil | MATTWEMIAVCLEDAVRAEDLVRELAFRRELRLDPQKALSAFELRSKPER |
| Ga0209814_100038964 | 3300027873 | Populus Rhizosphere | MSSTWELMAVCTRDAARAEDLVRELAFRRELRLDPQKALAAFELRGKPAR |
| Ga0209814_101630702 | 3300027873 | Populus Rhizosphere | MCIDDAVRAEDLVRELAFRRQLRVDPQKALAAFELRRSKPAR |
| Ga0209590_100920652 | 3300027882 | Vadose Zone Soil | MATTWEMIAVCIEDAVRAEDLVRELAFRRDLRLDPQKALSAFEIRSKPAR |
| Ga0209486_103787613 | 3300027886 | Agricultural Soil | HRTKMAEVTEMSSTWELVTVCMQDAARAEDLAGELAFRRELRLDPQKALSAFELRAKPAV |
| Ga0209486_103949332 | 3300027886 | Agricultural Soil | MSSTWELMTVCIQDAARAEDLAGELAFRRELRLDPQKALSAFELRAKPAVS |
| Ga0268265_109012622 | 3300028380 | Switchgrass Rhizosphere | MATTWEMIAICMDDAVRAEDLARELAFRRELRIDPQKALSAFELRAKPAR |
| Ga0137415_114452092 | 3300028536 | Vadose Zone Soil | VTEMATTWELMAICIEDAVRAEDLVRELAFRRELRLDPQKALSAFELRSKPAR |
| Ga0307295_101627342 | 3300028708 | Soil | MATTWEMIAICMEDAVRAEDLVKELAFRRELRIDPQKALSAFELRAKPAP |
| Ga0307282_101320893 | 3300028784 | Soil | RDLQERAPEVTEMATTWEMIAICMEDAVRAEDLVKELAFRRELRIDPQKALSAFELRAKPAR |
| Ga0307296_104731481 | 3300028819 | Soil | SSPERAPEVTEMATTWEMIAICMEDAVRAEDLMKELAFRRELRIDPHKALSAFELRAKPA |
| Ga0307289_101348042 | 3300028875 | Soil | MATTWEMIAICMEDAVRAEDLVKELAFRRELRIDPQKALSAFELRA |
| Ga0307289_103729002 | 3300028875 | Soil | RGWPRRGEMIAICMEDAVRAEDLVKELAFRRELRIDPQKALSAFELRAKPAP |
| Ga0307277_101486701 | 3300028881 | Soil | MEDAVRAEDLARELAFRRELRIDPQKALSAFELRAKPAR |
| Ga0073997_119824571 | 3300030997 | Soil | EMATTWEMITVCIQDAVRAEDLVRELAFRRELRLDPQKALSAFELRHAKPSR |
| Ga0073997_121924812 | 3300030997 | Soil | EMATTWEMIAVSFEDAVRAENLVEELAFRRELRLDPQKALSAFELRSTKAAR |
| Ga0073996_123967243 | 3300030998 | Soil | GGTEMATTWEMIAVSFEDAVRAENLVEELAFRRELRLDPQKALSAFELRSTKAAR |
| Ga0307468_1005495652 | 3300031740 | Hardwood Forest Soil | MATTWEMIAMCMEDAVRAEDLTRELVFRRELRIDPQKALSAFELRAKPAR |
| Ga0326597_104612673 | 3300031965 | Soil | MCSYEDAEVTAMSSTWELMAICTRDAARAEDLVRELAFRRELRLDPQKALSAFELRAKPS |
| ⦗Top⦘ |