| Basic Information | |
|---|---|
| Family ID | F053846 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 140 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VDFEQVLKEVVWRLVTEGRISYRRIKLSFALDDDGLEELR |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 140 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 92.81 % |
| % of genes near scaffold ends (potentially truncated) | 94.29 % |
| % of genes from short scaffolds (< 2000 bps) | 92.14 % |
| Associated GOLD sequencing projects | 110 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.714 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (60.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (57.857 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (52.857 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.24% β-sheet: 0.00% Coil/Unstructured: 61.76% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 140 Family Scaffolds |
|---|---|---|
| PF13432 | TPR_16 | 7.86 |
| PF00239 | Resolvase | 5.00 |
| PF01850 | PIN | 2.86 |
| PF02604 | PhdYeFM_antitox | 2.14 |
| PF00732 | GMC_oxred_N | 2.14 |
| PF13700 | DUF4158 | 1.43 |
| PF12006 | DUF3500 | 1.43 |
| PF01066 | CDP-OH_P_transf | 1.43 |
| PF00248 | Aldo_ket_red | 1.43 |
| PF00211 | Guanylate_cyc | 1.43 |
| PF14559 | TPR_19 | 1.43 |
| PF03693 | ParD_antitoxin | 1.43 |
| PF13185 | GAF_2 | 0.71 |
| PF01527 | HTH_Tnp_1 | 0.71 |
| PF00999 | Na_H_Exchanger | 0.71 |
| PF13271 | DUF4062 | 0.71 |
| PF02622 | DUF179 | 0.71 |
| PF02843 | GARS_C | 0.71 |
| PF13414 | TPR_11 | 0.71 |
| PF04140 | ICMT | 0.71 |
| PF08031 | BBE | 0.71 |
| PF00589 | Phage_integrase | 0.71 |
| PF13565 | HTH_32 | 0.71 |
| PF14319 | Zn_Tnp_IS91 | 0.71 |
| PF00118 | Cpn60_TCP1 | 0.71 |
| PF04820 | Trp_halogenase | 0.71 |
| PF15916 | DUF4743 | 0.71 |
| PF02852 | Pyr_redox_dim | 0.71 |
| PF04392 | ABC_sub_bind | 0.71 |
| PF00496 | SBP_bac_5 | 0.71 |
| PF13191 | AAA_16 | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 140 Family Scaffolds |
|---|---|---|---|
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 5.00 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 5.00 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 2.14 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 2.14 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 2.14 |
| COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 1.43 |
| COG3609 | Transcriptional regulator, contains Arc/MetJ-type RHH (ribbon-helix-helix) DNA-binding domain | Transcription [K] | 1.43 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.43 |
| COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 1.43 |
| COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 1.43 |
| COG1678 | Putative transcriptional regulator, AlgH/UPF0301 family | Transcription [K] | 0.71 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.71 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.71 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.71 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.71 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.71 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.71 |
| COG0151 | Phosphoribosylamine-glycine ligase | Nucleotide transport and metabolism [F] | 0.71 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.71 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 50.71 % |
| All Organisms | root | All Organisms | 49.29 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003223|JGI26343J46809_1009615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 738 | Open in IMG/M |
| 3300004080|Ga0062385_11259847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseobacter → unclassified Roseobacter → Roseobacter sp. R2A57 | 508 | Open in IMG/M |
| 3300005764|Ga0066903_108067790 | Not Available | 540 | Open in IMG/M |
| 3300005921|Ga0070766_11243606 | Not Available | 516 | Open in IMG/M |
| 3300006893|Ga0073928_10796232 | Not Available | 653 | Open in IMG/M |
| 3300006954|Ga0079219_10285382 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300007258|Ga0099793_10272717 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300009553|Ga0105249_12890042 | Not Available | 551 | Open in IMG/M |
| 3300010048|Ga0126373_11418072 | Not Available | 760 | Open in IMG/M |
| 3300010358|Ga0126370_10613174 | Not Available | 942 | Open in IMG/M |
| 3300010359|Ga0126376_12533581 | Not Available | 561 | Open in IMG/M |
| 3300010359|Ga0126376_13148506 | Not Available | 511 | Open in IMG/M |
| 3300010361|Ga0126378_12512016 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300010366|Ga0126379_12681947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 595 | Open in IMG/M |
| 3300010366|Ga0126379_12754905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 588 | Open in IMG/M |
| 3300010376|Ga0126381_100482649 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1745 | Open in IMG/M |
| 3300011120|Ga0150983_12465560 | Not Available | 669 | Open in IMG/M |
| 3300012203|Ga0137399_11122238 | Not Available | 662 | Open in IMG/M |
| 3300012203|Ga0137399_11493725 | Not Available | 563 | Open in IMG/M |
| 3300012361|Ga0137360_11629388 | Not Available | 550 | Open in IMG/M |
| 3300012361|Ga0137360_11692550 | Not Available | 538 | Open in IMG/M |
| 3300012361|Ga0137360_11750944 | Not Available | 527 | Open in IMG/M |
| 3300012918|Ga0137396_10524666 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300012922|Ga0137394_10225392 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1602 | Open in IMG/M |
| 3300012989|Ga0164305_12104178 | Not Available | 517 | Open in IMG/M |
| 3300016319|Ga0182033_10594565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 961 | Open in IMG/M |
| 3300016319|Ga0182033_10761547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 851 | Open in IMG/M |
| 3300016319|Ga0182033_12100572 | Not Available | 515 | Open in IMG/M |
| 3300016341|Ga0182035_11099304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 707 | Open in IMG/M |
| 3300016404|Ga0182037_10605698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 930 | Open in IMG/M |
| 3300016445|Ga0182038_10890263 | Not Available | 784 | Open in IMG/M |
| 3300017943|Ga0187819_10835060 | Not Available | 517 | Open in IMG/M |
| 3300018006|Ga0187804_10374293 | Not Available | 628 | Open in IMG/M |
| 3300020581|Ga0210399_10067901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2883 | Open in IMG/M |
| 3300020581|Ga0210399_11243941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 589 | Open in IMG/M |
| 3300021178|Ga0210408_10796272 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 740 | Open in IMG/M |
| 3300021178|Ga0210408_11183632 | Not Available | 585 | Open in IMG/M |
| 3300021180|Ga0210396_11327607 | Not Available | 597 | Open in IMG/M |
| 3300021361|Ga0213872_10369353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300021401|Ga0210393_11289634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 586 | Open in IMG/M |
| 3300021403|Ga0210397_10759392 | Not Available | 747 | Open in IMG/M |
| 3300021405|Ga0210387_10489057 | Not Available | 1093 | Open in IMG/M |
| 3300021420|Ga0210394_10321912 | Not Available | 1357 | Open in IMG/M |
| 3300021475|Ga0210392_10603997 | Not Available | 814 | Open in IMG/M |
| 3300021476|Ga0187846_10134385 | Not Available | 1052 | Open in IMG/M |
| 3300021478|Ga0210402_10282611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1535 | Open in IMG/M |
| 3300021478|Ga0210402_11056005 | Not Available | 739 | Open in IMG/M |
| 3300021479|Ga0210410_10122286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 2309 | Open in IMG/M |
| 3300021559|Ga0210409_11275049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 611 | Open in IMG/M |
| 3300022531|Ga0242660_1097961 | Not Available | 713 | Open in IMG/M |
| 3300025915|Ga0207693_10159960 | Not Available | 1772 | Open in IMG/M |
| 3300027045|Ga0207726_1039917 | Not Available | 647 | Open in IMG/M |
| 3300027105|Ga0207944_1016847 | Not Available | 637 | Open in IMG/M |
| 3300027313|Ga0207780_1094077 | Not Available | 501 | Open in IMG/M |
| 3300027583|Ga0209527_1004452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2857 | Open in IMG/M |
| 3300027684|Ga0209626_1074928 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300027738|Ga0208989_10005726 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4179 | Open in IMG/M |
| 3300028047|Ga0209526_10963047 | Not Available | 513 | Open in IMG/M |
| 3300031128|Ga0170823_15507845 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
| 3300031469|Ga0170819_11877285 | Not Available | 536 | Open in IMG/M |
| 3300031469|Ga0170819_12967093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300031543|Ga0318516_10671111 | Not Available | 589 | Open in IMG/M |
| 3300031545|Ga0318541_10011436 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4002 | Open in IMG/M |
| 3300031561|Ga0318528_10076255 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1733 | Open in IMG/M |
| 3300031561|Ga0318528_10108171 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1463 | Open in IMG/M |
| 3300031561|Ga0318528_10160577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1199 | Open in IMG/M |
| 3300031564|Ga0318573_10191313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1083 | Open in IMG/M |
| 3300031564|Ga0318573_10242825 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300031572|Ga0318515_10086432 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1632 | Open in IMG/M |
| 3300031573|Ga0310915_10079507 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2177 | Open in IMG/M |
| 3300031573|Ga0310915_10669744 | Not Available | 733 | Open in IMG/M |
| 3300031640|Ga0318555_10085275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1649 | Open in IMG/M |
| 3300031679|Ga0318561_10074216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Skermanella → Skermanella aerolata | 1748 | Open in IMG/M |
| 3300031680|Ga0318574_10118746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1482 | Open in IMG/M |
| 3300031681|Ga0318572_10251563 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300031681|Ga0318572_10304136 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 943 | Open in IMG/M |
| 3300031682|Ga0318560_10224596 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300031682|Ga0318560_10529969 | Not Available | 638 | Open in IMG/M |
| 3300031723|Ga0318493_10199263 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300031744|Ga0306918_10777547 | Not Available | 748 | Open in IMG/M |
| 3300031747|Ga0318502_10576274 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 677 | Open in IMG/M |
| 3300031747|Ga0318502_10761189 | Not Available | 586 | Open in IMG/M |
| 3300031753|Ga0307477_10284621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1142 | Open in IMG/M |
| 3300031764|Ga0318535_10557042 | Not Available | 508 | Open in IMG/M |
| 3300031768|Ga0318509_10112794 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
| 3300031769|Ga0318526_10343197 | Not Available | 611 | Open in IMG/M |
| 3300031770|Ga0318521_10116986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1486 | Open in IMG/M |
| 3300031770|Ga0318521_10281795 | Not Available | 975 | Open in IMG/M |
| 3300031777|Ga0318543_10426624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 594 | Open in IMG/M |
| 3300031781|Ga0318547_10284234 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300031794|Ga0318503_10315031 | Not Available | 508 | Open in IMG/M |
| 3300031795|Ga0318557_10304973 | Not Available | 731 | Open in IMG/M |
| 3300031797|Ga0318550_10255514 | Not Available | 850 | Open in IMG/M |
| 3300031797|Ga0318550_10651421 | Not Available | 505 | Open in IMG/M |
| 3300031799|Ga0318565_10455413 | Not Available | 619 | Open in IMG/M |
| 3300031805|Ga0318497_10600523 | Not Available | 617 | Open in IMG/M |
| 3300031819|Ga0318568_10038146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2724 | Open in IMG/M |
| 3300031819|Ga0318568_10306356 | Not Available | 986 | Open in IMG/M |
| 3300031831|Ga0318564_10133529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1106 | Open in IMG/M |
| 3300031833|Ga0310917_11160328 | Not Available | 514 | Open in IMG/M |
| 3300031835|Ga0318517_10479278 | Not Available | 561 | Open in IMG/M |
| 3300031845|Ga0318511_10098544 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
| 3300031859|Ga0318527_10162804 | Not Available | 938 | Open in IMG/M |
| 3300031879|Ga0306919_10160446 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1647 | Open in IMG/M |
| 3300031880|Ga0318544_10261211 | Not Available | 671 | Open in IMG/M |
| 3300031890|Ga0306925_10127364 | All Organisms → cellular organisms → Bacteria | 2729 | Open in IMG/M |
| 3300031893|Ga0318536_10334338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 767 | Open in IMG/M |
| 3300031894|Ga0318522_10207909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 741 | Open in IMG/M |
| 3300031896|Ga0318551_10478876 | Not Available | 713 | Open in IMG/M |
| 3300031897|Ga0318520_10776062 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300031897|Ga0318520_10887195 | Not Available | 561 | Open in IMG/M |
| 3300031910|Ga0306923_10214925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 2199 | Open in IMG/M |
| 3300031912|Ga0306921_11993192 | Not Available | 618 | Open in IMG/M |
| 3300031947|Ga0310909_11383626 | Not Available | 563 | Open in IMG/M |
| 3300032025|Ga0318507_10137862 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300032035|Ga0310911_10633311 | Not Available | 620 | Open in IMG/M |
| 3300032035|Ga0310911_10723802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 576 | Open in IMG/M |
| 3300032039|Ga0318559_10229018 | Not Available | 857 | Open in IMG/M |
| 3300032041|Ga0318549_10159871 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300032041|Ga0318549_10329405 | Not Available | 688 | Open in IMG/M |
| 3300032044|Ga0318558_10183693 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300032051|Ga0318532_10092073 | Not Available | 1065 | Open in IMG/M |
| 3300032054|Ga0318570_10432198 | Not Available | 601 | Open in IMG/M |
| 3300032055|Ga0318575_10134645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1220 | Open in IMG/M |
| 3300032055|Ga0318575_10534742 | Not Available | 595 | Open in IMG/M |
| 3300032063|Ga0318504_10432934 | Not Available | 628 | Open in IMG/M |
| 3300032063|Ga0318504_10630589 | Not Available | 515 | Open in IMG/M |
| 3300032065|Ga0318513_10185885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 999 | Open in IMG/M |
| 3300032066|Ga0318514_10332205 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300032076|Ga0306924_12448516 | Not Available | 525 | Open in IMG/M |
| 3300032090|Ga0318518_10732484 | Not Available | 502 | Open in IMG/M |
| 3300032091|Ga0318577_10076639 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1540 | Open in IMG/M |
| 3300032094|Ga0318540_10020319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2757 | Open in IMG/M |
| 3300032094|Ga0318540_10120123 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1247 | Open in IMG/M |
| 3300032160|Ga0311301_11000763 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1106 | Open in IMG/M |
| 3300032205|Ga0307472_100747116 | Not Available | 886 | Open in IMG/M |
| 3300033289|Ga0310914_10211418 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1735 | Open in IMG/M |
| 3300033289|Ga0310914_11489298 | Not Available | 580 | Open in IMG/M |
| 3300033290|Ga0318519_10491557 | Not Available | 738 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 60.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.57% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.71% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.29% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.14% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.43% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.43% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.43% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.43% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.71% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.71% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.71% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.71% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003223 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027045 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027105 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF018 (SPAdes) | Environmental | Open in IMG/M |
| 3300027313 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI26343J46809_10096152 | 3300003223 | Bog Forest Soil | VNFSRVLKEVVWCLVTEGSISYRRIKRSFGLDDDALEDLRR |
| Ga0062385_112598471 | 3300004080 | Bog Forest Soil | VDFEQVLKEVVWRLVTEGRISYRRIKLSFALDDDGLEELRS |
| Ga0070698_1009786121 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIAANEGGSVNFERVLQKVLWCLVTEGSVAYRRIKRSFGLDDDALEDVRR |
| Ga0066903_1080677901 | 3300005764 | Tropical Forest Soil | MNFERVLQKVLWRLVTEGSISYRRIKLSFGLDHDGLE |
| Ga0070766_112436062 | 3300005921 | Soil | VNFARVLKEVLWCLVTEGGISYRRIKLSFGLDDEGLEELRRELIGI |
| Ga0073928_107962323 | 3300006893 | Iron-Sulfur Acid Spring | VNFERVLKEVLWCLVTEGGISYRRIKLSFALDDDGLE |
| Ga0079219_102853821 | 3300006954 | Agricultural Soil | MNFERVLQKVLWRLVTEGSISYRRIMLSFGLDNDGLEELRRELIV |
| Ga0099793_102727172 | 3300007258 | Vadose Zone Soil | VNVVANGGGNVNFARVLKEVLWCLVTEGGISYRRIRLSFGLDDDGLEEIRRELI |
| Ga0105249_128900421 | 3300009553 | Switchgrass Rhizosphere | VDFEQALKEVIWRLVTEGGISYRRIKLSFGLDDDALEELRRELIGIKRLAADV |
| Ga0126373_114180721 | 3300010048 | Tropical Forest Soil | MNFARVLKEVLWCLVTEGSISYRRIKLSFGLDHDGLEELRRELIVIKRV |
| Ga0126370_106131742 | 3300010358 | Tropical Forest Soil | MNFERVLQKVLWRLVTEGSISYRRIKLSFGLDHDGLEELRRE* |
| Ga0126376_125335811 | 3300010359 | Tropical Forest Soil | VNFTRVLKEVLWCLVTEGGISHRRIKLSYGLDDDAL |
| Ga0126376_131485062 | 3300010359 | Tropical Forest Soil | MNFERMLQTVLWRLVTEGSISYRRIKLSFGLDNDGLE |
| Ga0126378_125120161 | 3300010361 | Tropical Forest Soil | VDFEQVLKEVVWRLVTEGRISYRRIKLSFALDDDGLEELRRELIGIKRVAAD |
| Ga0126379_126819472 | 3300010366 | Tropical Forest Soil | VNFARVLKEVLWCLVTEGSISYRRIKRGFDLDDDALE |
| Ga0126379_127549052 | 3300010366 | Tropical Forest Soil | MNFERVLQKVLWRLVTEGSISYRRIKLSFGLDHDGLEELRRELIGI |
| Ga0126381_1004826494 | 3300010376 | Tropical Forest Soil | MGAKVNFARVLKEVLWCLVTEGSISYRRIKRGFDLDD |
| Ga0150983_124655601 | 3300011120 | Forest Soil | VDFDQVLKEVLWRLVTEGSISYRRIRLNFGLDDEGLEELRRELIGIKRVAADVDG |
| Ga0137399_111222382 | 3300012203 | Vadose Zone Soil | VDFEQVLKEVLWRLVTEGSISYRRIRRGFSLDDDAL |
| Ga0137399_114937251 | 3300012203 | Vadose Zone Soil | MKFERVLQKVLWRLVTEGSISYRRIKLSFGLDNDGLEELRRELIVIKRVAADL |
| Ga0137360_116293881 | 3300012361 | Vadose Zone Soil | VDFEQVLKEVVWRLVTEGRISYRRIKLSFALDDDGLEEP* |
| Ga0137360_116925501 | 3300012361 | Vadose Zone Soil | VNFERVLQKVLWCLVSEGSVAYRRIKRSFGLDDDALEDVRRALISGLH |
| Ga0137360_117509441 | 3300012361 | Vadose Zone Soil | VDFEQVLKEVVWRLVTEGSVSYRRIKRSFGLDDDALEDVRRALISGLH |
| Ga0137396_105246662 | 3300012918 | Vadose Zone Soil | MSWRTGAENVNFARVLKEVLWCLVTEGGISYRRIKLSFGLDDDGIEE |
| Ga0137394_102253921 | 3300012922 | Vadose Zone Soil | MNFARVLKEVLWCLVTEGGISYRRIRLSFGLDDDGLEEIRREL |
| Ga0164305_121041781 | 3300012989 | Soil | VNFEWVLQKVLWRLVTEGSISYRRIKRGFNLDDETLEDAAAK* |
| Ga0182033_105945652 | 3300016319 | Soil | VKIVANEGGSVDFDQVLKEVLWRLVTEGGISYRRIKLNFSLDDNGLEELRRELIGIK |
| Ga0182033_107615471 | 3300016319 | Soil | MNFERVLQKVLWRLVTECSISYRRIKLSVGLDNDGLEEL |
| Ga0182033_121005721 | 3300016319 | Soil | MDFEQVLKEVVWRLVTEGRISYRRIKLSFALDDDG |
| Ga0182035_110993042 | 3300016341 | Soil | MDFEQVLKEVLWRLVTEGRISYRRIKRGFDLDDDALKDVRRDDQYIAHSGRC |
| Ga0182037_106056981 | 3300016404 | Soil | MNFERVLQKVLWRLVTEGSISYRRIKLSFALDDDGLEELRS |
| Ga0182038_108902632 | 3300016445 | Soil | VANGGGSVDFEQVLKEVVWRLVTEGRISYRRIKLSFALDDDGLE |
| Ga0187819_108350602 | 3300017943 | Freshwater Sediment | VNFARVLKEVLWCLVTEGGISYRRIKLSYGLDDAAVEE |
| Ga0187804_103742931 | 3300018006 | Freshwater Sediment | MNFERVLQKVLWRLVTEGSISYRRIRLSFGLDHDG |
| Ga0210399_100679013 | 3300020581 | Soil | VDFEQVLKEVVWRLVTEGRISYRRIKLSFAPDDDGLEE |
| Ga0210399_112439411 | 3300020581 | Soil | VNFERVLKEVLWCLVTEGGISYRRIKLSFALDDEGLEELRRELI |
| Ga0210408_107962721 | 3300021178 | Soil | VDFEQVLKEVVWRLVTEGSVSYRRIKRSFGLDDDALDDVRRVLIGALHVATDLD |
| Ga0210408_111836321 | 3300021178 | Soil | VNFARVLKEVLWCLVTEGSISYRRIKRGFGLDDDALED |
| Ga0210396_113276071 | 3300021180 | Soil | VDFEQVLKEVLWRLVAEGRIKLSFALDDDGLEELRSEL |
| Ga0213872_103693531 | 3300021361 | Rhizosphere | MNFERVLQKVLWRLVTEGSISYRRIKLSFRLDDDG |
| Ga0210393_112896341 | 3300021401 | Soil | VDFEQVLKEVVWRLVTEGSVSYRRIRRGFGLDDEALEDLRR |
| Ga0210397_107593922 | 3300021403 | Soil | VDFEQVLKEVVWRLVTEGRISYRRIKLSFALDDDGLEE |
| Ga0210387_104890572 | 3300021405 | Soil | MNFERVLQKVLWRLVTEGSISYRRIKLSFGLDDDGLEEL |
| Ga0210394_103219122 | 3300021420 | Soil | VDFEQVLKEVLWRLVTEGSISYRRIKRVFDLDDDAL |
| Ga0210392_106039972 | 3300021475 | Soil | VDFEQVLKEVVWRLVTEGSVSYRRIKRSFGLDDDAL |
| Ga0187846_101343851 | 3300021476 | Biofilm | MDFEQVLKEVLWRLVTEGSISYRRIRRVFGLDDDALDDVRREMISTLR |
| Ga0210402_102826111 | 3300021478 | Soil | VDFEQVLKEVLWRLVTEGSVSYRRIKRGFDLDDDALDDVRRELIGALHVATDL |
| Ga0210402_110560051 | 3300021478 | Soil | VDFEQVLKEVLWRLVTEGSSSCRRIKRVFDLDDEALDDVRRELISA |
| Ga0210410_101222861 | 3300021479 | Soil | VNFERVLQKVLWRLVTEGSISYRRIKRRFGLDDDALEDVR |
| Ga0210409_112750492 | 3300021559 | Soil | VNFERVLQKVLWRLVTEGSISYRRIKLSFGLDNDGLEELRRELIVIKRVAAD |
| Ga0242660_10979613 | 3300022531 | Soil | VAANEGGSVDFEQVLKEVVWRLVTEGRISYRRIKLSFAEHGAMPQ |
| Ga0207693_101599601 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFERVLQKVLWRLVTEGSISYRRIKLSFGLDNEGL |
| Ga0207726_10399171 | 3300027045 | Tropical Forest Soil | VDFEQVLKEVVWRLVTEGRISYRRIKLSFALDDDGLEELRRELIGLKRL |
| Ga0207944_10168471 | 3300027105 | Forest Soil | VNFARVLKEVLWCLVTEGGISYRRIRLSFGLDDDGIEELRR |
| Ga0207780_10940771 | 3300027313 | Tropical Forest Soil | VDFEQVLKEVVWRLVTEGRISYRRIKLSFGLDDDG |
| Ga0209527_10044523 | 3300027583 | Forest Soil | VNFERVLQKVLWRLVTEGSVSYRRIKRSFGLDDDAL |
| Ga0209626_10749282 | 3300027684 | Forest Soil | VNFARVLKEVLWCLVTEGGISYRRIKLSFGLDDEGLEELRREL |
| Ga0208989_100057265 | 3300027738 | Forest Soil | VKFERVLQKVLWRLVTEGSISYRRIKLSFSLDEDGL |
| Ga0209526_109630471 | 3300028047 | Forest Soil | VDFEQVLKEVVWRLVTEGRISYRRIKLSFALDDDGLEELRSELIGI |
| Ga0170823_155078451 | 3300031128 | Forest Soil | MKVAANEGGSVDFEQVLKEVLWRLVTEGGISYRRIKLNFGLDDDGLEELRRELI |
| Ga0170819_118772851 | 3300031469 | Forest Soil | VNFTRVLKEVLWCLVTEGSMSYRRIKRGFDLDDDALEDVR |
| Ga0170819_129670931 | 3300031469 | Forest Soil | MNFERVLQKVLWRLVTEGGISYRRVKLSFGLDDDGLEEL |
| Ga0318516_106711112 | 3300031543 | Soil | VDFEQVLKEVVWRLVTEGSVSYRRIKRSFGLDDDALEDVRRVLIGA |
| Ga0318541_100114363 | 3300031545 | Soil | VDFDQVLKEVLWRLVTEGSISYRRIRLNFGLDDDGLEEL |
| Ga0318528_100762551 | 3300031561 | Soil | VNFGRVLKEVLWCLVTEGSISYRRIKRGFDLDDDALEEV |
| Ga0318528_101081712 | 3300031561 | Soil | MNFERVLQKVLWRLVTEGSISYRRIKLSFGLDDDGLE |
| Ga0318528_101605771 | 3300031561 | Soil | MDFEQVLKEVLWRLVTEGRISYRRIKRGFDLDDDALKD |
| Ga0318573_101913131 | 3300031564 | Soil | MNFERVLQKVLWRLVTEGSISYRRIKLSFGLDNDRLEE |
| Ga0318573_102428252 | 3300031564 | Soil | MDFEQVLKEVLWRLVTEGCISYRRIKRGFDLDDDALKDVRREMISTLRIAA |
| Ga0318515_100864321 | 3300031572 | Soil | VDFDQVLKEVLWRLVTEGSISYRRIRLNFGLDDDGLE |
| Ga0310915_100795071 | 3300031573 | Soil | VDFDQVLKEVLWRLVTEGSISYRRIRLNFGLDDDGLEELRRELIRIK |
| Ga0310915_106697441 | 3300031573 | Soil | VNFARVLKEVLWCLVAEGSISYRRIKLSFGLDHDGLEE |
| Ga0318555_100852751 | 3300031640 | Soil | MDFEQVLKEVLWRLVTEGCISYRRIKRGFDLDDDALKDVRREMISTLRI |
| Ga0318561_100742163 | 3300031679 | Soil | VDFEQVLKEVVWRLVTEGSVSYRRIKRSFGLDDDALEDVRRVLIGAL |
| Ga0318574_101187461 | 3300031680 | Soil | MDFEQVLKEVVWRLVTEGRISYRRIKLSFALDEDGLAELRSELIGIKRVAADV |
| Ga0318572_102515631 | 3300031681 | Soil | MDFEQVLKEVLWRLVTEGCISYRRIKRGFDLDDDALKDVRREMIS |
| Ga0318572_103041362 | 3300031681 | Soil | VDFEQVLKEVVWRLVTEGSVSYRRIKRSFGLDDDALEDVRRVVIGALH |
| Ga0318560_102245961 | 3300031682 | Soil | MDFEQVLKEVVWRLVTEGRISYRRIKLSFALDEDGLAE |
| Ga0318560_105299692 | 3300031682 | Soil | VNFARVLKEVLWCLVTEGSISYRRIKRGFDLDDDALEDLRRE |
| Ga0318493_101992632 | 3300031723 | Soil | MNFERVLQKVLWRLVTEGSISYRRIKLSFGFDDDGLEEL |
| Ga0306918_107775472 | 3300031744 | Soil | MDFEQVLKEVLWRLVTEGRISYRRIKRGFDLDDDALKDVR |
| Ga0318502_105762741 | 3300031747 | Soil | VNFARVLKEVLWCLVAEGSISYRRIKLSFGLDHDGLEELRR |
| Ga0318502_107611891 | 3300031747 | Soil | VDFEQVLKEVVWRLVTEGRISYRRIKLSFALDDDGLEELRRE |
| Ga0307477_102846211 | 3300031753 | Hardwood Forest Soil | VDFEQVLKEVVWRLVTEGRISYRRIKLSFALDDDGLEELRRELI |
| Ga0318535_105570422 | 3300031764 | Soil | VDFEQVLKEVVWRLVTEGSVSYRRIKRSFGLDDDALEDVRRVLIGALHIAT |
| Ga0318509_101127942 | 3300031768 | Soil | MDFEQVLKEVLWRLVTEGCISYRRIKRGFDLDDDALKDVRREMISTL |
| Ga0318526_103431972 | 3300031769 | Soil | MDFEQVLKEVLWRLVTEGRISYRRIKRGFDLDDDAL |
| Ga0318521_101169861 | 3300031770 | Soil | VDFEQVLKEVVWRLVTEGGVSYRRIKLSFGLDDDGLDE |
| Ga0318521_102817951 | 3300031770 | Soil | VNFARVLKEVLWCLVAEGSISYRRIKLSFGLDHDGLE |
| Ga0318543_104266242 | 3300031777 | Soil | MNFERVLQKVLWRLVTEGSISYRRIKLSFGLDHDGLEE |
| Ga0318547_102842341 | 3300031781 | Soil | MNFERVLQKVLWRLVTEGSISYRRIKLSFGFDDDGLEELCRELIVIKR |
| Ga0318503_103150311 | 3300031794 | Soil | VDFDQVLKEVLWRLVTEGSISYRRIKLSFGLEDDGLEELRR |
| Ga0318557_103049731 | 3300031795 | Soil | MDFEQVLKEVVWRLVTEGRISYRRIKLSFALDEDGLAELR |
| Ga0318550_102555142 | 3300031797 | Soil | VDFDQVLKEVLWRLVTEGSISYRRIRLNFGLDDDGLEE |
| Ga0318550_106514211 | 3300031797 | Soil | MDFEQVLKEVVWRLVTEGRISYRRIKLSFALDDDGLEELRSELIGIK |
| Ga0318565_104554132 | 3300031799 | Soil | MNFERVLQKVLWRLVTEGSISYRRIKLSFGLDQDGLEELRRE |
| Ga0318497_106005232 | 3300031805 | Soil | VDFEQVLKEVVWRLVTEGSVSYRRIKRGFDLDDEPSTTSG |
| Ga0318568_100381464 | 3300031819 | Soil | VDFDQVLKEVLWRLVTEGGISYRRIKLNFGLDDNGLEELRRELSGLKR |
| Ga0318568_103063561 | 3300031819 | Soil | VDFDQVLKEVLWRLVTEGSISYRRIRLNFGLDDDGLEELRRELIRIKRL |
| Ga0318564_101335292 | 3300031831 | Soil | VDFEQVLKEVVWRLVTEGSVSYRRIKRGFDLDDDALDDVRRELIGALHVAT |
| Ga0310917_111603281 | 3300031833 | Soil | VNFARVLKEVLWCLVTEGSISYRRIKRGFDLDDDALEDV |
| Ga0318517_104792781 | 3300031835 | Soil | VNFDRILKEVVWCLLTEGGVSYHRIKLRFGLDDDALA |
| Ga0318511_100985442 | 3300031845 | Soil | MDFEQVLKEVLWRLVTEGCISYRRIKRGFDLDDDALKDVRREMISTLRIAAD |
| Ga0318527_101628041 | 3300031859 | Soil | VDFDQVLKEVLWRLVTEGSISYRRIRLNFGLDDDGLEELRRELIRIKR |
| Ga0306919_101604461 | 3300031879 | Soil | VNFGRVLKEVLWCLVTEGSISYRRIKRGFDLDDDAL |
| Ga0318544_102612111 | 3300031880 | Soil | VDFEQVLKEVVWRLVTEGSISYRRIKLSFALDDDGLEELRSELI |
| Ga0306925_101273643 | 3300031890 | Soil | VNFARVLKEVLWCLVTEGSISYRRIKRGFDLDDDALEDSGAN |
| Ga0318536_103343381 | 3300031893 | Soil | VNFGRVLKEVLWCLVTEGSISYRRIKRGFDLDDDALED |
| Ga0318522_102079092 | 3300031894 | Soil | MNFERVLQKVLWRLVTEGSISYRRIKLSFGLDHDGLEELRRE |
| Ga0318551_104788761 | 3300031896 | Soil | VDFDQVLKEVLWRLVTEGSISYRRIRLNFGLDDDGL |
| Ga0318520_107760622 | 3300031897 | Soil | VDFEQILKEVLWRLVTEGSVSYRRIKRGFGLDDDALEDVRRELIGA |
| Ga0318520_108871951 | 3300031897 | Soil | MDFEQVLKEVVWRLITEGSISYRRIKLSFGLDHDGLEELR |
| Ga0306923_102149251 | 3300031910 | Soil | VDFDQVLKEVLWRLVTEGSISYRRIKLNFHLDDDGLEELRRELIG |
| Ga0306921_119931921 | 3300031912 | Soil | VNFARVLKEVLWCLVAEGSISYRRIKLSFGLDHDGLEELRRELIGVKRVAA |
| Ga0310909_113836261 | 3300031947 | Soil | MNFERVLQKVLWRLVTEGSISYRRIKLSFGLDHDSLEE |
| Ga0318507_101378622 | 3300032025 | Soil | MDFEQVLKEVVWRLVTEGRISYRRIKLSFALDEDG |
| Ga0310911_106333111 | 3300032035 | Soil | VDFDQVLKEVLWRLVTEGSISYRRIKLSFGLEDDGLEELRRELIGIKRV |
| Ga0310911_107238021 | 3300032035 | Soil | VDFEQVLKEVVWRLVTESSISYRRIKLSFALDDDGLEEL |
| Ga0318559_102290181 | 3300032039 | Soil | MDFEQVLKEVLWRLVTEGRISYRRIKRGFDLDDDALKDVRREM |
| Ga0318549_101598711 | 3300032041 | Soil | MDFEQVLKEVLWRLVTEGSISYRRIKRGFDLDDDALEDVRREMISTL |
| Ga0318549_103294051 | 3300032041 | Soil | VNFARVLKEVLWCLVTEGSISYRRIKRGFDLDDDALEDLRSE |
| Ga0318558_101836932 | 3300032044 | Soil | MDFEQVLKEVLWRLVTEGCISYRRIKRGFDLDDDALKD |
| Ga0318532_100920731 | 3300032051 | Soil | VNFARVLKEVLWCLVAEGSISYRRIKLSFGLDHDGLEELRRELIG |
| Ga0318570_104321982 | 3300032054 | Soil | VDFEQVLKEVVWRLVTEGRISYRRIKLSFALDDDGLEELR |
| Ga0318575_101346451 | 3300032055 | Soil | VDFDQVLKEVLWRLVTEGSISYRRISLNFGLDDDA |
| Ga0318575_105347421 | 3300032055 | Soil | VDFEQVLQEVVWRLVTEGSVSYRRIKRSFGLDDDALEDVRRVLIGALHI |
| Ga0318504_104329341 | 3300032063 | Soil | VDFEQVLKEVVWRLVTEGSVSYRRIKRGFDLDDDALDDVRRELI |
| Ga0318504_106305891 | 3300032063 | Soil | VDFDQVLKEVLWRLVTEGSISYRRIKLNFHLDDDGLEELRRELIGIKRLA |
| Ga0318513_101858853 | 3300032065 | Soil | MNFERVLQKVLWRLVTEGSISYRRIKLSFGLDDDGLEELRRELIVIKG |
| Ga0318514_103322051 | 3300032066 | Soil | VNFGRVLKEVLWCLVTEGSISCRRIKRGFDLDDDALEDVRREMISTLRVAADVD |
| Ga0306924_124485161 | 3300032076 | Soil | MDFERVLQKVLWRLVTEGSISYRRIKLSFGLDHDGLEELRRELIGIKRVA |
| Ga0318518_107324841 | 3300032090 | Soil | MDFEQVLKEVVWRLVTEGRISYRRIKLSFALDDDGLEELRN |
| Ga0318577_100766393 | 3300032091 | Soil | VDFDQVLKEVLWRLVTEGSISYRRIRLNFGLDDEGLE |
| Ga0318540_100203192 | 3300032094 | Soil | VDFEQVLKEVVWRLVTEGSVSYRRIKRGFDLDDEPSTTSGAS |
| Ga0318540_101201231 | 3300032094 | Soil | VNFGRVLKEVLWCLVTEGSISYRRIKRGFDLDDDALEDVR |
| Ga0311301_110007631 | 3300032160 | Peatlands Soil | VNFERVLQKVLWRLVTEGSISYRRIKRRFGLDDDALEDVRSRAD |
| Ga0307472_1007471163 | 3300032205 | Hardwood Forest Soil | VDFDQVLKEVLWRLVTEGSISYRRIRLNSGLGDDGLEELRRELIGIKRLATDVR |
| Ga0310914_102114183 | 3300033289 | Soil | MDFEQVLKEVVWRLVTEGRISYRRIKLSFALDDDGLEELRSELIGIKRV |
| Ga0310914_114892981 | 3300033289 | Soil | VDFEQVLKEVVWRLITEGSVSYRRIKLSFGLDDDGLEELRRELIGIKRVAADIDG |
| Ga0318519_104915571 | 3300033290 | Soil | MDFEQVLKEVVWRLVTEGRISYRRIKLSFALDDDGLEELRNELIGIKRVAADVDG |
| ⦗Top⦘ |