NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F053614

Metagenome / Metatranscriptome Family F053614

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F053614
Family Type Metagenome / Metatranscriptome
Number of Sequences 141
Average Sequence Length 46 residues
Representative Sequence REEIRKSVAELFDAALESRAAIAIKGAPEQHAEGANVPGDEDG
Number of Associated Samples 112
Number of Associated Scaffolds 141

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 6.38 %
% of genes near scaffold ends (potentially truncated) 93.62 %
% of genes from short scaffolds (< 2000 bps) 92.91 %
Associated GOLD sequencing projects 110
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (85.106 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(34.752 % of family members)
Environment Ontology (ENVO) Unclassified
(24.113 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.610 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 26.76%    β-sheet: 0.00%    Coil/Unstructured: 73.24%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 141 Family Scaffolds
PF12867DinB_2 3.55
PF00248Aldo_ket_red 2.84
PF01872RibD_C 2.13
PF08241Methyltransf_11 2.13
PF03575Peptidase_S51 1.42
PF08386Abhydrolase_4 1.42
PF11716MDMPI_N 1.42
PF14535AMP-binding_C_2 1.42
PF13468Glyoxalase_3 1.42
PF03824NicO 1.42
PF13561adh_short_C2 1.42
PF00206Lyase_1 1.42
PF13360PQQ_2 0.71
PF00717Peptidase_S24 0.71
PF00378ECH_1 0.71
PF13377Peripla_BP_3 0.71
PF05988DUF899 0.71
PF01638HxlR 0.71
PF00296Bac_luciferase 0.71
PF16901DAO_C 0.71
PF08044DUF1707 0.71
PF02861Clp_N 0.71
PF08874DUF1835 0.71
PF13185GAF_2 0.71
PF13411MerR_1 0.71
PF14014DUF4230 0.71
PF00392GntR 0.71
PF13466STAS_2 0.71
PF00270DEAD 0.71
PF04226Transgly_assoc 0.71
PF00027cNMP_binding 0.71
PF09084NMT1 0.71
PF00156Pribosyltran 0.71
PF01243Putative_PNPOx 0.71
PF01636APH 0.71
PF03050DDE_Tnp_IS66 0.71
PF00440TetR_N 0.71
PF13493DUF4118 0.71
PF02775TPP_enzyme_C 0.71
PF03551PadR 0.71
PF01869BcrAD_BadFG 0.71

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 141 Family Scaffolds
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 2.13
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 2.13
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 1.42
COG0542ATP-dependent Clp protease, ATP-binding subunit ClpAPosttranslational modification, protein turnover, chaperones [O] 0.71
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.71
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.71
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.71
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.71
COG2261Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein familyGeneral function prediction only [R] 0.71
COG3436TransposaseMobilome: prophages, transposons [X] 0.71
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 0.71
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.71


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.11 %
UnclassifiedrootN/A14.89 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573002|GZIGXIF01DAFB7Not Available527Open in IMG/M
3300001593|JGI12635J15846_10472404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii744Open in IMG/M
3300004092|Ga0062389_101557491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium litorale844Open in IMG/M
3300004092|Ga0062389_103513101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia588Open in IMG/M
3300005437|Ga0070710_10111560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1643Open in IMG/M
3300005602|Ga0070762_10605953All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii727Open in IMG/M
3300006028|Ga0070717_10774331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii872Open in IMG/M
3300006162|Ga0075030_101463082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria535Open in IMG/M
3300009672|Ga0116215_1514037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii518Open in IMG/M
3300009683|Ga0116224_10259351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii829Open in IMG/M
3300009698|Ga0116216_10080047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2010Open in IMG/M
3300009700|Ga0116217_10250416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1150Open in IMG/M
3300009759|Ga0116101_1127481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Phytoactinopolyspora609Open in IMG/M
3300010048|Ga0126373_11792064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii677Open in IMG/M
3300010371|Ga0134125_12847419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii526Open in IMG/M
3300010376|Ga0126381_104671761All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii527Open in IMG/M
3300010376|Ga0126381_104917098Not Available513Open in IMG/M
3300010866|Ga0126344_1212589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia628Open in IMG/M
3300010876|Ga0126361_10976383All Organisms → cellular organisms → Bacteria → Terrabacteria group540Open in IMG/M
3300010880|Ga0126350_10509643All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300011120|Ga0150983_16475775All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii596Open in IMG/M
3300012357|Ga0137384_10780720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii773Open in IMG/M
3300014501|Ga0182024_11962015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii649Open in IMG/M
3300016357|Ga0182032_10122125All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1881Open in IMG/M
3300017821|Ga0187812_1137642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia789Open in IMG/M
3300017821|Ga0187812_1228698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii593Open in IMG/M
3300017948|Ga0187847_10472492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii693Open in IMG/M
3300017948|Ga0187847_10820562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi527Open in IMG/M
3300017959|Ga0187779_10028236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3221Open in IMG/M
3300017999|Ga0187767_10097617All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300018034|Ga0187863_10135852Not Available1373Open in IMG/M
3300018034|Ga0187863_10377682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia789Open in IMG/M
3300018042|Ga0187871_10309950Not Available873Open in IMG/M
3300018085|Ga0187772_10208461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1315Open in IMG/M
3300018090|Ga0187770_11585298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia534Open in IMG/M
3300020580|Ga0210403_10915425All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → unclassified Nocardioidaceae → Nocardioidaceae bacterium691Open in IMG/M
3300020581|Ga0210399_10562483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia945Open in IMG/M
3300020582|Ga0210395_10199474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1500Open in IMG/M
3300020583|Ga0210401_11312520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia581Open in IMG/M
3300021171|Ga0210405_10807398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii718Open in IMG/M
3300021171|Ga0210405_11134229Not Available583Open in IMG/M
3300021178|Ga0210408_10223357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1499Open in IMG/M
3300021180|Ga0210396_10174121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1928Open in IMG/M
3300021180|Ga0210396_11421320Not Available573Open in IMG/M
3300021181|Ga0210388_10383666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1235Open in IMG/M
3300021181|Ga0210388_10505178Not Available1061Open in IMG/M
3300021181|Ga0210388_10825024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia802Open in IMG/M
3300021401|Ga0210393_10111207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2186Open in IMG/M
3300021401|Ga0210393_11391810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia560Open in IMG/M
3300021402|Ga0210385_10524358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia900Open in IMG/M
3300021402|Ga0210385_11044433Not Available628Open in IMG/M
3300021403|Ga0210397_11601087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia505Open in IMG/M
3300021406|Ga0210386_10094511All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2442Open in IMG/M
3300021406|Ga0210386_11299147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia612Open in IMG/M
3300021407|Ga0210383_10881120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia763Open in IMG/M
3300021407|Ga0210383_10910600All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa ferruginea749Open in IMG/M
3300021420|Ga0210394_10966304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia739Open in IMG/M
3300021432|Ga0210384_11497798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii580Open in IMG/M
3300021477|Ga0210398_11162778Not Available611Open in IMG/M
3300021479|Ga0210410_10701850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia893Open in IMG/M
3300021479|Ga0210410_11721903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii521Open in IMG/M
3300021560|Ga0126371_11165753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia908Open in IMG/M
3300025134|Ga0207416_1121613All Organisms → cellular organisms → Bacteria → Terrabacteria group906Open in IMG/M
3300025588|Ga0208586_1103934All Organisms → cellular organisms → Bacteria → Terrabacteria group612Open in IMG/M
3300025905|Ga0207685_10043338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1695Open in IMG/M
3300026489|Ga0257160_1096748Not Available531Open in IMG/M
3300027174|Ga0207948_1029671All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium avium complex (MAC) → Mycobacterium colombiense653Open in IMG/M
3300027604|Ga0208324_1217813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii502Open in IMG/M
3300027855|Ga0209693_10022346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3054Open in IMG/M
3300027855|Ga0209693_10076423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1652Open in IMG/M
3300027855|Ga0209693_10386764All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia676Open in IMG/M
3300027908|Ga0209006_11160432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineosporia → Kineosporia babensis606Open in IMG/M
3300027908|Ga0209006_11207521Not Available591Open in IMG/M
3300028047|Ga0209526_10109686Not Available1941Open in IMG/M
3300028780|Ga0302225_10287873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria780Open in IMG/M
3300028781|Ga0302223_10198053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria663Open in IMG/M
3300028789|Ga0302232_10104955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1445Open in IMG/M
3300028789|Ga0302232_10280140All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300028789|Ga0302232_10485092All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii608Open in IMG/M
3300028801|Ga0302226_10314639Not Available659Open in IMG/M
3300028806|Ga0302221_10393698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria604Open in IMG/M
3300028877|Ga0302235_10193547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii898Open in IMG/M
3300028906|Ga0308309_11104919All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora globispora685Open in IMG/M
3300029943|Ga0311340_11086893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia651Open in IMG/M
3300029943|Ga0311340_11251189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia594Open in IMG/M
3300029951|Ga0311371_10894723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1075Open in IMG/M
3300029999|Ga0311339_10611419All Organisms → cellular organisms → Bacteria → Terrabacteria group1083Open in IMG/M
3300030007|Ga0311338_10804287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia936Open in IMG/M
3300030013|Ga0302178_10168033All Organisms → cellular organisms → Bacteria → Terrabacteria group1075Open in IMG/M
3300030057|Ga0302176_10232310Not Available737Open in IMG/M
3300030058|Ga0302179_10351663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium649Open in IMG/M
3300030503|Ga0311370_11978751All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Cytobacillus → Cytobacillus depressus583Open in IMG/M
3300030509|Ga0302183_10306815Not Available613Open in IMG/M
3300030524|Ga0311357_10444471All Organisms → cellular organisms → Bacteria → Terrabacteria group1216Open in IMG/M
3300030622|Ga0265391_10191682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii614Open in IMG/M
3300030739|Ga0302311_10860399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Phytoactinopolyspora584Open in IMG/M
3300030743|Ga0265461_13370697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii540Open in IMG/M
3300030763|Ga0265763_1032725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia597Open in IMG/M
3300031028|Ga0302180_10402515Not Available685Open in IMG/M
3300031231|Ga0170824_105415694Not Available627Open in IMG/M
3300031234|Ga0302325_13408261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii501Open in IMG/M
3300031525|Ga0302326_11411198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii940Open in IMG/M
3300031545|Ga0318541_10123385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1408Open in IMG/M
3300031546|Ga0318538_10035024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2373Open in IMG/M
3300031549|Ga0318571_10132517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia846Open in IMG/M
3300031564|Ga0318573_10155112Not Available1202Open in IMG/M
3300031572|Ga0318515_10307076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii851Open in IMG/M
3300031670|Ga0307374_10464988Not Available696Open in IMG/M
3300031679|Ga0318561_10266891All Organisms → cellular organisms → Bacteria934Open in IMG/M
3300031680|Ga0318574_10293144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria945Open in IMG/M
3300031708|Ga0310686_103161549Not Available830Open in IMG/M
3300031708|Ga0310686_103206004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii525Open in IMG/M
3300031708|Ga0310686_106308617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1766Open in IMG/M
3300031708|Ga0310686_106348100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora olivasterospora555Open in IMG/M
3300031708|Ga0310686_107738590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2769Open in IMG/M
3300031713|Ga0318496_10855653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia501Open in IMG/M
3300031718|Ga0307474_10435230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1024Open in IMG/M
3300031723|Ga0318493_10123852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1318Open in IMG/M
3300031747|Ga0318502_10287695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii965Open in IMG/M
3300031747|Ga0318502_10579896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria675Open in IMG/M
3300031754|Ga0307475_10891566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae703Open in IMG/M
3300031799|Ga0318565_10316513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium758Open in IMG/M
3300031823|Ga0307478_10908233All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria737Open in IMG/M
3300031846|Ga0318512_10268060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia845Open in IMG/M
3300031896|Ga0318551_10694614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia589Open in IMG/M
3300031959|Ga0318530_10029699All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1950Open in IMG/M
3300032039|Ga0318559_10263642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia798Open in IMG/M
3300032044|Ga0318558_10580465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia560Open in IMG/M
3300032059|Ga0318533_10372345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1041Open in IMG/M
3300032068|Ga0318553_10625992All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii563Open in IMG/M
3300032089|Ga0318525_10448063All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii661Open in IMG/M
3300032160|Ga0311301_10032388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria13367Open in IMG/M
3300032515|Ga0348332_11454394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria932Open in IMG/M
3300032895|Ga0335074_10017417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia10134Open in IMG/M
3300032895|Ga0335074_10507424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1248Open in IMG/M
3300032895|Ga0335074_10642460All Organisms → cellular organisms → Bacteria → Terrabacteria group1043Open in IMG/M
3300032895|Ga0335074_11293323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii603Open in IMG/M
3300032896|Ga0335075_10043515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii6323Open in IMG/M
3300032896|Ga0335075_10819813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria868Open in IMG/M
3300032955|Ga0335076_11725506Not Available515Open in IMG/M
3300033545|Ga0316214_1032402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia743Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil34.75%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa16.31%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.26%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.26%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.26%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland3.55%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.55%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.84%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.84%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.13%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.13%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil2.13%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.42%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.42%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.71%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.71%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.71%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.71%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.71%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.71%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.71%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.71%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.71%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.71%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.71%
RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Roots0.71%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573002Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml)EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009759Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010866Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025134Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025588Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026489Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-AEnvironmentalOpen in IMG/M
3300027174Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes)EnvironmentalOpen in IMG/M
3300027604Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028781Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300028801Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3EnvironmentalOpen in IMG/M
3300028806Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030013Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030622Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE044SO (Eukaryote Community Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300030739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3EnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030763Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031670Soil microbial communities from Risofladan, Vaasa, Finland - OX-3EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033545Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FE1_084917602189573002Grass SoilSVAEIFDAALESRAAIAIKGAPEHHAEGANVPGDEDG
JGI12635J15846_1047240413300001593Forest SoilLCQDEAAVGEEIRKSVAELFDAALESRAAIAIKGAPEQHAEGANLPADEDG*
Ga0062389_10155749113300004092Bog Forest SoilCEEIRKSVAELFDAALESRAMIAIKGAPEQHAEGANVPGDGDG*
Ga0062389_10351310113300004092Bog Forest SoilRDKATLREEIRKSVAELFDAALDPRTGIAIKGAPEQHAEGANLPGEEDG*
Ga0070710_1011156013300005437Corn, Switchgrass And Miscanthus RhizosphereDRATLREEIRKSVAELFDAALESRAAIAIKGAPEQHAEGANVPDEDDS*
Ga0070762_1060595313300005602SoilREEIRKSVAELFDAALESRAAIAIKGAPEQHAEGANLPEDENG*
Ga0070717_1077433113300006028Corn, Switchgrass And Miscanthus RhizosphereRATLREEIRKSVAELFDAALESRAAIAIKGAPEQHAEGANVPDEDDD*
Ga0075030_10146308213300006162WatershedsKSVAELFDAALESRAAIAIKGAPEQHAEGESIPGDEDG*
Ga0116215_151403713300009672Peatlands SoilRKSVAELYDAALEIHATIAIKGAPEQHAEGANVPGDEDG*
Ga0116224_1025935113300009683Peatlands SoilSVAELYDAALEIHATIAIKGAPEQHAEGANVPGDEDG*
Ga0116216_1008004753300009698Peatlands SoilVAELFDAALEPHAAVAIKGAPEQHAEAANIPGDEDGYGG*
Ga0116217_1025041623300009700Peatlands SoilVAELFDAALEPHAAVAIKGAPEQHAEAANVPGDEDGYGG*
Ga0116101_112748113300009759PeatlandRNIENLCQNKAALREEIRKSVAELFDAGLESHAAIAVKGAPEQHAEGANGPADSGGA*
Ga0126373_1179206413300010048Tropical Forest SoilVAELYDAALEARARIAIKGAPEQHAEAATVPGDEDG*
Ga0134125_1284741913300010371Terrestrial SoilSVAELFDAALESRAAIAIKGAPEQHAEGANVPDEDDS*
Ga0126381_10467176113300010376Tropical Forest SoilALREEIRKSVAELFDAALQSRAAIAIKGAPEQHAEGATVPGDDDR*
Ga0126381_10491709813300010376Tropical Forest SoilKSVAELYDAALEPHARVAIEGVPEQHAEGATIPADEDG*
Ga0126344_121258913300010866Boreal Forest SoilEEIRKSVAELFDAALESRAAIADKGAPEQHAEGADGPGDGDG*
Ga0126361_1097638313300010876Boreal Forest SoilELYDAALESRARIAIKGAPEQHAEGANVPEDEDR*
Ga0126350_1050964313300010880Boreal Forest SoilKTVAELFNAALDPRTGIAIKGAPEHHAEAENLPKSTS*
Ga0150983_1647577533300011120Forest SoilENLCQDRATLREEIEKSVAELYDAALGQNATIAIKGAPEQHAEGANVPGDENG*
Ga0137384_1078072013300012357Vadose Zone SoilKAALSEEIRKSVAELFDATLECHAAVAIKGAPEQHAEGANIPGDEDR*
Ga0182024_1196201523300014501PermafrostVAELFDAALDPRTGIAIKGAPEHHAEGATLPGDEDR*
Ga0182032_1012212533300016357SoilDRAALREEIRKSVAELFDAALESRAAIAIKGAPEQHAEEANVPGDEDG
Ga0187812_113764213300017821Freshwater SedimentEEIRKSVAELFDAALQSRAAIAIKGAPEQHAEGADIPGDEDR
Ga0187812_122869813300017821Freshwater SedimentNLCKDRATVCEEIRKSVAELFDAALESRATIAIKGAPEQHAEGANVPGDEDG
Ga0187847_1047249213300017948PeatlandQRNVENLCRDKATLREEIRKSVAELFDAALESRAAIAIKGAPEQHAEAANVPGDEDG
Ga0187847_1082056223300017948PeatlandVAELFNAALDPRTGIAIKGAPEHHAEAANLPEDDNG
Ga0187779_1002823613300017959Tropical PeatlandIENLCKDRAALGEEIRKSVAELYDAALEPNAAIAIEGAPEQHAEGATIPEDEDR
Ga0187767_1009761713300017999Tropical PeatlandLGEEIRKSVAELYDAALEPNAEIAIEGAPEQHAEGATIPEDEDR
Ga0187863_1013585213300018034PeatlandIRKSVAELFDAALEARAAIAIKGAPEQHAEGANVPGDEDG
Ga0187863_1037768213300018034PeatlandKSVAELFDAALESRAAIAIKGAPEQHAEGANIPEDEDG
Ga0187871_1030995013300018042PeatlandRNIENLCKDQGAVCEEIRKSVAELFDAALESRAAIAIKGAPEQHAEGANVPGDEDG
Ga0187772_1020846123300018085Tropical PeatlandVAELYDAALGLHAAIAIKGAPEQHAEGANVPEDDDS
Ga0187770_1158529823300018090Tropical PeatlandEEIRKSVAELFDAALEAHAAIAIKGAPEQHAEGTDIPGDEDGQR
Ga0210403_1091542513300020580SoilRDRATLREEIRKSVAELFDAALESRAAIAIKGAPEQHAEGATVPDDDDG
Ga0210399_1056248323300020581SoilAELFDAALESRAAIAIKGAPEQHAEGANVPGDADG
Ga0210395_1019947423300020582SoilVAELFDAALESRAAIAIKGAPDQHAEGATVPRDEDG
Ga0210401_1131252023300020583SoilNLCQDKATLREEIRKSVAELFDAALESRAAIAIKGAPEHHAEGANIPGDEDG
Ga0210405_1080739823300021171SoilSVAELFDAALESRAAIAIKGAPDQHAEGATVPRDEDG
Ga0210405_1113422913300021171SoilLGQEIRESVAELFDAALESRAAIAIKGAPDQHGEGATVPPDEDG
Ga0210408_1022335723300021178SoilCQDRATLREEIRKSVAELYDAALESRATIAIKGAPEQHAEAANVPGDEDG
Ga0210396_1017412133300021180SoilTLREEIRKSVAELFDAALDPRTGIAIKGAPEHHAEAANLPQDEDG
Ga0210396_1142132023300021180SoilIRKSVAELFDAALESRAAIAVKGAPEQHAEGANVPEDEDR
Ga0210388_1038366633300021181SoilNLCQDKATLRDEISKSVAELFDAALESRAAIAIKGAPEQHAEGANIPGDEDR
Ga0210388_1050517813300021181SoilMAGLFEAALESRAAIAIKGAPDQNAEGATVPRDEDG
Ga0210388_1082502413300021181SoilKATLREEIRKSVAEIFDAALESRAAIAIKGAPEHHAEGANIPGDEDG
Ga0210393_1011120753300021401SoilQRNIENLCKDRATACEEIRKSVAELYDAALEVHAAIAIKGAPEQHAEGANIPGDEDG
Ga0210393_1139181013300021401SoilRATLREEIRKSVAELYDAALESRATIAIKGAPEQHAEAANVPGDEDG
Ga0210385_1052435823300021402SoilIENLCKDRATACEEIRRSVAELYDAALEVHAAIAIKGAPEQHAEGANVPGDEDG
Ga0210385_1104443313300021402SoilNLCKDKATLREEIRKSVAELFDAALESRAAIAIKGASEQHAEAADVPGDEDD
Ga0210397_1160108723300021403SoilREEIRKSVAEIFDAALESRAAIAIKGAPEHHAEGANIPGDEDG
Ga0210386_1009451113300021406SoilEIRKSVDELFDAALQSRAAIAIKGAPEQHAEGANIPEDEDR
Ga0210386_1129914723300021406SoilQGKAALRDEIRKSVAELFDAALESRAAIAVKGAPEQHAEGANIPGDEDR
Ga0210383_1088112023300021407SoilQDKATLREEIRKSVAELFDAALESRAAIAIKGAPEHHAEAANIPGDEDG
Ga0210383_1091060023300021407SoilKSVAELFDAALESRAAIADKGAPEQHAEGADGPGDGDG
Ga0210394_1096630413300021420SoilCQDRATLREEIRKSVAELFDTALESRAAIAIKGAPEQHAEGANIPGDEDG
Ga0210384_1149779823300021432SoilENLCTDKAALSEEIRKSVAELFDAALESHAAIAIKGAPEQHAEGANIPGDEDR
Ga0210398_1116277823300021477SoilEIRKSVAELLEAALESGAAIAIKGAPEQHAEGANGPGDE
Ga0210410_1070185023300021479SoilSVAELYDAALESRAAIAIKGAPEQHAEAANVPGDEDG
Ga0210410_1172190313300021479SoilALREEIRKSVAELFDAALQSRAAIAIKGAPEQHAEGANIPEDEDR
Ga0126371_1116575313300021560Tropical Forest SoilSAVREEIRKSVAELFDAALQSRATIAIKGAPEQHAEGANVPGDEDR
Ga0207416_112161313300025134Iron-Sulfur Acid SpringRNIENLCRDKAALREEIRKSVAELFDAALESRAAIAIKGAPEQHAEGANVPGDEDR
Ga0208586_110393423300025588Arctic Peat SoilRKSVAELFDAALESRAAIAIKGAPEQHAEGATGPGDEDG
Ga0207685_1004333823300025905Corn, Switchgrass And Miscanthus RhizosphereNIENLCQDRATLREEIRKSVAELFDAALESRAAIAIKGAPEQHAEGANVPDEDDD
Ga0257160_109674813300026489SoilLSKDRAALGQQIRESVAELFDAALESRAAIAIKGAPEHHAEGANVPGDEDG
Ga0207948_102967113300027174Forest SoilTLREEIRKSVAELYDAALESRATIAIKGAPEQHAEGASIPGDEDG
Ga0208324_121781313300027604Peatlands SoilENLRKDRATVSEEIRKSVAELYDAALESRATIAIKGAPEQHAEGANIPGDEDG
Ga0209693_1002234643300027855SoilQRNIENLCKDRATLNEEIRKSVAELYDAALESRATIAIKGAPEQHAEGANVPADEDS
Ga0209693_1007642333300027855SoilQRNIENLCKDRATLNEEIRKSVAELYDAALESRARVAIKGAPEQHAEGANIPADEDR
Ga0209693_1038676413300027855SoilTLREEIRKSVAEIFDAALESRAAIAIKGAPEHHAEGANIPGDEDG
Ga0209006_1116043213300027908Forest SoilKSVAELFDAALESRAAIVIKGAPDQHAEGATVPRDEDG
Ga0209006_1120752113300027908Forest SoilKSVAELLEAALESGAAIAIKGAPEQHAEGANGPGDE
Ga0209526_1010968653300028047Forest SoilNIENLCRDRAALREEIRKSVAELFDAALESRAAIAIKGAPEQHAEGANVPEDEDR
Ga0302225_1028787323300028780PalsaAAVCEEIRRSVAELFDAALESRAAIAIKGAPEQHAEGANVPGDEDG
Ga0302223_1019805333300028781PalsaDGAAVCEEIRKSVAELFDTALESRAAIAIKGAPEQHAEGANVPGDEDG
Ga0302232_1010495543300028789PalsaREEIRKSVAELFDAALESRAAIAIKGAPEQHAEGANVPGDEDG
Ga0302232_1028014013300028789PalsaRAALGEEIRKSVAELFDAALESRAAIAIKGAPEQHAEGANIPGDEDG
Ga0302232_1048509233300028789PalsaLREEIRKSVAELFDAALQSRAAIAIKGAPEQHAEGATIPGDEDR
Ga0302226_1031463923300028801PalsaREEIRKSVAELYDTALQSRARIAIKGAPEEHAEAANVPGDEDGQP
Ga0302221_1039369823300028806PalsaVCEEIRRSVAELFDAALESRAAIAIKGAPEQHAEGANVPGDEDG
Ga0302235_1019354713300028877PalsaYQRNIENLCQDRATVREEIRKSVAELYDTALQSRARIAIKGAPEEHAEAANVPGDEDGQP
Ga0308309_1110491913300028906SoilQDRPTLREEIRKSVAELFDAALESRAAIAIKGAPEQHAEGANVPGDEDG
Ga0311340_1108689323300029943PalsaNIENLCRDKATLREEIRKSVAELFDAALDPRTGIAIKGAPEHHAEAANLPGDEDG
Ga0311340_1125118923300029943PalsaCKDKAALREEIRKSVAELFDAALESRAAIAIKGAPEQHAEGATIPGDEER
Ga0311371_1089472313300029951PalsaENLCQDRAAVREEIRKSVAELFDAALESRAAIAITGAPEQHAETANIPGDEVG
Ga0311339_1061141933300029999PalsaLCQDEAAVGEEIRKSVAELFDAALESRAAIAIKGAPERHAEGANVPGDEDG
Ga0311338_1080428733300030007PalsaAVREEIRKSVAELFDAALESRAAIAIKGAPEQHAEGANVPGDEDG
Ga0302178_1016803333300030013PalsaRKSVAELFDAALESRAAIAIKGAPERHAEGANVPGDEDG
Ga0302176_1023231013300030057PalsaSVAELYNTALQSRARIAIKGAPEEHAEGADVPRDEDG
Ga0302179_1035166323300030058PalsaENLCQDRAALREEIRKSVAELFDAALESRAAIAIKGASEQHAEAANVPGDEDG
Ga0311370_1197875123300030503PalsaENLCRDRATLREEIRKSVAELYDAALQSRAAIAVKGAPEQHAEGANGPADEDG
Ga0302183_1030681513300030509PalsaENLCQDRATVHEEIRKSVAELYNTALQSRARIAIKGAPEEHAEGADVPRDEDG
Ga0311357_1044447113300030524PalsaRDEAAVGEEIRKSVAELFDAALESRAAIAIKGAPERHAEGANVPGDEDG
Ga0265391_1019168213300030622SoilIRKSVAELFDAALESRAAIAIKGAPEQHAEGATIPGDEDG
Ga0302311_1086039933300030739PalsaRKSVAELFDAALQSRAAIAIKGAPEQHAEGANGPGDDDGQR
Ga0265461_1337069723300030743SoilAALCEEIRKSVAELFDAALESRAAIAIKGAPDQHAEGTTVPRDEDG
Ga0265763_103272523300030763SoilATLHEEIRKSVAEIFDAALESRAAIAIKGAPEHHAEGANIPGDEDG
Ga0302180_1040251513300031028PalsaLCQDRATVREEIRKSVAELYDTALQSRARIAIKGAPEEHAEGADVPRDEDG
Ga0170824_10541569423300031231Forest SoilEEIRKSVAELFDAALESRAAIAITGAPEQHAEGANVPEDEDRQRRATGIGG
Ga0302325_1340826113300031234PalsaGAVLCEEIRKSVAELFDTALEARAAIAIKGAPEQHAEGANVPGDADG
Ga0302326_1141119823300031525PalsaLREEIRKSVAELFGAALESRTAITIKGAPEQHAEGADVPGDEDR
Ga0318541_1012338513300031545SoilIENLCLDRAALHEEIRKSVAELFDAALESRAAIAIKGAPEQHAEEANVPGDEDG
Ga0318538_1003502413300031546SoilLCLDRAALREEIRKSVAELFDAALESRAAIAIKGAPEQHAEEANVPGDEDG
Ga0318571_1013251723300031549SoilCLDRAALREEIRKSVAELFDAALESRAAIAIKGAPEQHAEEANVPGDEDG
Ga0318573_1015511213300031564SoilVLFQRNIENLCKDRATLCVEIRKSVAELYDAALEPRATIAIKGAPEQHAEAATVPGNEDG
Ga0318515_1030707613300031572SoilCRDRAALREEIRKSVAELFDAALESRAAIAIKGAPEQHAEEATVPGDEDG
Ga0307374_1046498823300031670SoilNIENLCRDRAALGEEIRKSVAELYDAALESRAAIAIKGAPEQHAEGANVPGDEDG
Ga0318561_1026689113300031679SoilLCKDRAALDEEIRKSVAELYDAALESRAAIAIKGAPEEHAEGANVPGDEDR
Ga0318574_1029314423300031680SoilEIRKSVAELYDAALEARAAIAINGAPEEHAEVADIPGDEDR
Ga0310686_10316154913300031708SoilIRKSVAELFDAALESRTPVAITGAPEQHAEGANGPGDEDG
Ga0310686_10320600413300031708SoilDRAALREEIRKSVAELFDAALEPHAAIAIKGEPEQHAEGANIPGDEDG
Ga0310686_10630861733300031708SoilEIRKSVAELFDAALESRAAIADKGAPEQHAEGADGPEDGDR
Ga0310686_10634810023300031708SoilKSVAELFDAALEPHAAIAIKGAPEQHAEGASIPGDEDG
Ga0310686_10773859013300031708SoilNIENLCQDRATLGEEIRKSVAELYDAALEPHAAIAIKGAPEQHAEGANIPEDEDG
Ga0318496_1085565323300031713SoilDRAALHEEIRKSVAELFDAALESRAAIAIKGAPEQHAEEANVPGDEDG
Ga0307474_1043523013300031718Hardwood Forest SoilRDKAALHEEIRKSVAELFDAALESRASIAIKGAPEQHAEGANVPGDEDR
Ga0318493_1012385233300031723SoilCRDRAALREEIRKSVAELFDAALESRAAIAIKGAPEQHAEEANVPGDEDG
Ga0318502_1028769523300031747SoilIENLCQDRAALREEIRKSVAELFDAALESRAAIAIKGAPEQHAEEANVPGDEDG
Ga0318502_1057989633300031747SoilENLCQDRATVGEEIRKSVAELFDAALESRATIAIKGAPEQHAEGANIPSDEDG
Ga0307475_1089156613300031754Hardwood Forest SoilRAALREEIRKSVAELFDAALESRAAIAIKGAPEQHAEGANIPGDEDG
Ga0318565_1031651323300031799SoilGEEIRKSVAELYDAALESRATIAIKGAPEQHAEGANIPSDEDG
Ga0307478_1090823323300031823Hardwood Forest SoilRAALSEEIRKSVAELYDAALESRAAIAIKGAPEQHAEAATVPGDEDG
Ga0318512_1026806013300031846SoilLCQDRAALREEIRKSVAELFDAALESRAAIAIKGAPEQHAEEANVPGDEDG
Ga0318551_1069461423300031896SoilCLDRAALHEEIRKSVAELFDAALESRAAIAIKGAPEQHAEEANVPGDEDG
Ga0318530_1002969943300031959SoilENLCLDRAALHEEIRKSVAELFDAALESRAAIAIKGAPEQHAEEANVPGDEDG
Ga0318559_1026364223300032039SoilNIENLCRDKAAVREEIRKSVAELFDAALESRAAIAIKGAPEQHAEEANVPGDEDG
Ga0318558_1058046523300032044SoilCRDRAALHEEIRKSVAELFDAALESRAAIAIKGAPEQHAEAANVPGDENP
Ga0318533_1037234523300032059SoilCRDRAALHEEIRKSVAELFDAALESRAAIAIKGAPEQHAEEANVPGDEDG
Ga0318553_1062599223300032068SoilLCKDSAAVGEEIRKSVAELYDAALESRAAIAIKGAPEEHAEGASVPGDEDR
Ga0318525_1044806313300032089SoilDRAALREEIRKSVAELFDAALESRAAIAIKGAPEQHAEEATVPGDEDG
Ga0311301_1003238833300032160Peatlands SoilVAELFDAALEPHAAVAIKGAPEQHAEAANIPGDEDGYGG
Ga0348332_1145439433300032515Plant LitterRESVAELFEAALQSRAAIAIKGAPDEHAEGATVPRDEHG
Ga0335074_10017417103300032895SoilRNIENLCKDRTTLREEIRKSVAELFDAALESRAAVAIKGAPEEHAEGADLPGDEDG
Ga0335074_1050742413300032895SoilEIRKSVAELFDAALETNAAIAVEGVPEQHAEGANVPGDEDG
Ga0335074_1064246013300032895SoilEIRKSVAELFDAGLESGAAIAIKGAPEQHAEGANVPGDEDG
Ga0335074_1129332313300032895SoilCPDRAAVREEIRKSVAELFDAALESRAAIAIKGAPEQHAEGADIPGDEDG
Ga0335075_1004351513300032896SoilCPDRAAVREEIRKSVAELFDAALESRAAIAIKGTPEQHAEGADIPGDEDG
Ga0335075_1081981323300032896SoilATLRDEIRKSVAELYDAALDLRAPIPTKGAPEQHAERANIPGDEDG
Ga0335076_1172550613300032955SoilGLGGEIRKSVAELFDTALELHASIAIKGAPEQHAEGANVPEDENG
Ga0316214_103240223300033545RootsCQDRATLREEIRKSVAELFDAALESRAAVAIEGAPEQHAEGANVPGDEDS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.