| Basic Information | |
|---|---|
| Family ID | F053596 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 141 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MKTISSIAADRSFMAITMLSCFGLAVSFCLMAFGMDLNSVWL |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 141 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 70.00 % |
| % of genes near scaffold ends (potentially truncated) | 12.77 % |
| % of genes from short scaffolds (< 2000 bps) | 58.87 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.248 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.475 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.404 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.482 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.57% β-sheet: 0.00% Coil/Unstructured: 61.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 141 Family Scaffolds |
|---|---|---|
| PF13462 | Thioredoxin_4 | 47.52 |
| PF08484 | Methyltransf_14 | 2.13 |
| PF07238 | PilZ | 2.13 |
| PF13505 | OMP_b-brl | 1.42 |
| PF03330 | DPBB_1 | 1.42 |
| PF13844 | Glyco_transf_41 | 0.71 |
| PF01467 | CTP_transf_like | 0.71 |
| PF04060 | FeS | 0.71 |
| PF00903 | Glyoxalase | 0.71 |
| PF13424 | TPR_12 | 0.71 |
| PF01425 | Amidase | 0.71 |
| PF13489 | Methyltransf_23 | 0.71 |
| PF13379 | NMT1_2 | 0.71 |
| PF04321 | RmlD_sub_bind | 0.71 |
| PF00456 | Transketolase_N | 0.71 |
| PF07690 | MFS_1 | 0.71 |
| PF13356 | Arm-DNA-bind_3 | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 141 Family Scaffolds |
|---|---|---|---|
| COG0451 | Nucleoside-diphosphate-sugar epimerase | Cell wall/membrane/envelope biogenesis [M] | 1.42 |
| COG0702 | Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domains | General function prediction only [R] | 1.42 |
| COG1086 | NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsC | Cell wall/membrane/envelope biogenesis [M] | 1.42 |
| COG0021 | Transketolase | Carbohydrate transport and metabolism [G] | 0.71 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.71 |
| COG1087 | UDP-glucose 4-epimerase | Cell wall/membrane/envelope biogenesis [M] | 0.71 |
| COG1088 | dTDP-D-glucose 4,6-dehydratase | Cell wall/membrane/envelope biogenesis [M] | 0.71 |
| COG1089 | GDP-D-mannose dehydratase | Cell wall/membrane/envelope biogenesis [M] | 0.71 |
| COG1090 | NAD dependent epimerase/dehydratase family enzyme | General function prediction only [R] | 0.71 |
| COG1091 | dTDP-4-dehydrorhamnose reductase | Cell wall/membrane/envelope biogenesis [M] | 0.71 |
| COG3959 | Transketolase, N-terminal subunit | Carbohydrate transport and metabolism [G] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.25 % |
| Unclassified | root | N/A | 34.75 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003316|rootH1_10136570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1419 | Open in IMG/M |
| 3300003321|soilH1_10039683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2 | 3903 | Open in IMG/M |
| 3300003323|rootH1_10401619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1372 | Open in IMG/M |
| 3300003324|soilH2_10258881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2055 | Open in IMG/M |
| 3300004479|Ga0062595_101381527 | Not Available | 640 | Open in IMG/M |
| 3300004633|Ga0066395_10104041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1373 | Open in IMG/M |
| 3300005329|Ga0070683_100036502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2 | 4497 | Open in IMG/M |
| 3300005329|Ga0070683_100096032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2787 | Open in IMG/M |
| 3300005336|Ga0070680_100237687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1539 | Open in IMG/M |
| 3300005336|Ga0070680_100312173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1334 | Open in IMG/M |
| 3300005341|Ga0070691_10245024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 959 | Open in IMG/M |
| 3300005434|Ga0070709_10049641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2625 | Open in IMG/M |
| 3300005434|Ga0070709_10094167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1981 | Open in IMG/M |
| 3300005434|Ga0070709_10524276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 903 | Open in IMG/M |
| 3300005434|Ga0070709_10555755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 879 | Open in IMG/M |
| 3300005458|Ga0070681_10192201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1961 | Open in IMG/M |
| 3300005529|Ga0070741_10003073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 42497 | Open in IMG/M |
| 3300005529|Ga0070741_10661987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 925 | Open in IMG/M |
| 3300005529|Ga0070741_10866086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 784 | Open in IMG/M |
| 3300005529|Ga0070741_11432362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 572 | Open in IMG/M |
| 3300005533|Ga0070734_10126020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1494 | Open in IMG/M |
| 3300005533|Ga0070734_10614934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 618 | Open in IMG/M |
| 3300005535|Ga0070684_100001889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 15348 | Open in IMG/M |
| 3300005537|Ga0070730_10687422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 649 | Open in IMG/M |
| 3300005616|Ga0068852_101749483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 644 | Open in IMG/M |
| 3300005764|Ga0066903_100233887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2807 | Open in IMG/M |
| 3300005764|Ga0066903_101380589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1322 | Open in IMG/M |
| 3300005764|Ga0066903_105629816 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 659 | Open in IMG/M |
| 3300006028|Ga0070717_11204903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 689 | Open in IMG/M |
| 3300006163|Ga0070715_10339086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 817 | Open in IMG/M |
| 3300006172|Ga0075018_10681727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 554 | Open in IMG/M |
| 3300006175|Ga0070712_101922480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 518 | Open in IMG/M |
| 3300006755|Ga0079222_10684274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 807 | Open in IMG/M |
| 3300006755|Ga0079222_11413756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661 | 645 | Open in IMG/M |
| 3300006806|Ga0079220_10645454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 764 | Open in IMG/M |
| 3300006806|Ga0079220_12144001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 501 | Open in IMG/M |
| 3300006903|Ga0075426_10100010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2080 | Open in IMG/M |
| 3300006954|Ga0079219_10199900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1132 | Open in IMG/M |
| 3300006954|Ga0079219_10769313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 749 | Open in IMG/M |
| 3300009093|Ga0105240_10478695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1388 | Open in IMG/M |
| 3300010043|Ga0126380_11008899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 702 | Open in IMG/M |
| 3300010043|Ga0126380_12149436 | Not Available | 515 | Open in IMG/M |
| 3300010046|Ga0126384_11645808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 606 | Open in IMG/M |
| 3300010048|Ga0126373_11250330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 808 | Open in IMG/M |
| 3300010360|Ga0126372_11375788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 737 | Open in IMG/M |
| 3300010371|Ga0134125_12806163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 529 | Open in IMG/M |
| 3300010376|Ga0126381_101442125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 995 | Open in IMG/M |
| 3300010396|Ga0134126_12508845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 560 | Open in IMG/M |
| 3300012360|Ga0137375_10442996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1122 | Open in IMG/M |
| 3300012929|Ga0137404_12184715 | Not Available | 517 | Open in IMG/M |
| 3300012955|Ga0164298_10823154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 667 | Open in IMG/M |
| 3300012986|Ga0164304_11106298 | Not Available | 634 | Open in IMG/M |
| 3300012987|Ga0164307_10617537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 838 | Open in IMG/M |
| 3300014325|Ga0163163_13316541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 502 | Open in IMG/M |
| 3300014969|Ga0157376_12081292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 606 | Open in IMG/M |
| 3300015371|Ga0132258_10002264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 35344 | Open in IMG/M |
| 3300015371|Ga0132258_12805357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1213 | Open in IMG/M |
| 3300015374|Ga0132255_101984301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 886 | Open in IMG/M |
| 3300016294|Ga0182041_12173381 | Not Available | 518 | Open in IMG/M |
| 3300016387|Ga0182040_11632203 | Not Available | 549 | Open in IMG/M |
| 3300016422|Ga0182039_11781169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 564 | Open in IMG/M |
| 3300020070|Ga0206356_11871602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 791 | Open in IMG/M |
| 3300021168|Ga0210406_10399144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1102 | Open in IMG/M |
| 3300021178|Ga0210408_10362945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1155 | Open in IMG/M |
| 3300021384|Ga0213876_10070646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1844 | Open in IMG/M |
| 3300021384|Ga0213876_10239176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 965 | Open in IMG/M |
| 3300021401|Ga0210393_10330114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1241 | Open in IMG/M |
| 3300021403|Ga0210397_10013190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 4998 | Open in IMG/M |
| 3300021403|Ga0210397_10138188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1691 | Open in IMG/M |
| 3300021403|Ga0210397_10276623 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1226 | Open in IMG/M |
| 3300021403|Ga0210397_10478392 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 941 | Open in IMG/M |
| 3300021404|Ga0210389_10458619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1003 | Open in IMG/M |
| 3300021405|Ga0210387_10770086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 851 | Open in IMG/M |
| 3300021432|Ga0210384_10122355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2334 | Open in IMG/M |
| 3300021478|Ga0210402_10564794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1056 | Open in IMG/M |
| 3300021479|Ga0210410_10055389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 3458 | Open in IMG/M |
| 3300021560|Ga0126371_11154823 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 912 | Open in IMG/M |
| 3300025898|Ga0207692_10202678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1167 | Open in IMG/M |
| 3300025906|Ga0207699_10082752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1995 | Open in IMG/M |
| 3300025906|Ga0207699_10184836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1403 | Open in IMG/M |
| 3300025912|Ga0207707_10003175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 14586 | Open in IMG/M |
| 3300025912|Ga0207707_10060543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3294 | Open in IMG/M |
| 3300025912|Ga0207707_10143620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2086 | Open in IMG/M |
| 3300025913|Ga0207695_10328502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1418 | Open in IMG/M |
| 3300025928|Ga0207700_10590025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 988 | Open in IMG/M |
| 3300025944|Ga0207661_10110421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2324 | Open in IMG/M |
| 3300025944|Ga0207661_11944433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 534 | Open in IMG/M |
| 3300025949|Ga0207667_10444828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1317 | Open in IMG/M |
| 3300026142|Ga0207698_11022634 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 837 | Open in IMG/M |
| 3300027765|Ga0209073_10260239 | Not Available | 677 | Open in IMG/M |
| 3300027787|Ga0209074_10247995 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 690 | Open in IMG/M |
| 3300027826|Ga0209060_10408198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 618 | Open in IMG/M |
| 3300027874|Ga0209465_10180791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661 | 1051 | Open in IMG/M |
| 3300031231|Ga0170824_107030747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 989 | Open in IMG/M |
| 3300031231|Ga0170824_115825307 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 539 | Open in IMG/M |
| 3300031231|Ga0170824_126595658 | Not Available | 526 | Open in IMG/M |
| 3300031912|Ga0306921_11800044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 659 | Open in IMG/M |
| 3300031941|Ga0310912_10542222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 906 | Open in IMG/M |
| 3300032955|Ga0335076_10321683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1434 | Open in IMG/M |
| 3300033004|Ga0335084_10399537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1416 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.64% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 10.64% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 10.64% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 6.38% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.67% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.55% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 3.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.84% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.13% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.13% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.13% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.13% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.42% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.42% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.42% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.42% |
| Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 1.42% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.71% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.71% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.71% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.71% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003316 | Sugarcane root Sample L1 | Host-Associated | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300003323 | Sugarcane root Sample H1 | Host-Associated | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| rootH1_101365701 | 3300003316 | Sugarcane Root And Bulk Soil | MKTISAIATDNAFKTLAVMSCFGLALSFGLMAAGMDLSAVAL* |
| soilH1_100396835 | 3300003321 | Sugarcane Root And Bulk Soil | MKTISSIAAHRSFMAIAMLSCFGLAVSFCLMAYGMDLNSVWL* |
| rootH1_104016192 | 3300003323 | Sugarcane Root And Bulk Soil | MKTISSIAADHAFKAIATMSCFGLALSFGMVAFGMDLSSVWL* |
| soilH2_102588814 | 3300003324 | Sugarcane Root And Bulk Soil | MKTISAIATDSAFKTLAVMSCFGLALSFGLMAAGMDLSAVAL* |
| Ga0062595_1013815272 | 3300004479 | Soil | VKTISSIVNDRAFKAIAALSFFGLAVSFGMMAFGMDLSVLAL* |
| Ga0066395_101040413 | 3300004633 | Tropical Forest Soil | LKTISMLAADRAFKTISTISCLGLAVSFSMMAFGMDLSIGWL* |
| Ga0070683_1000365026 | 3300005329 | Corn Rhizosphere | MGAIMKTISSIAADRSFMAITMLSCFGLAVSFCLMAFGMDLNSVWL* |
| Ga0070683_1000960321 | 3300005329 | Corn Rhizosphere | MKTISSIAKDRSFKTITALSFFGLAASFCMMAFGMDLSVLAL* |
| Ga0070683_1003305323 | 3300005329 | Corn Rhizosphere | MQLISSITADRSFKAIAMLSCFGLVVSLGLMACGMDLNAVWL* |
| Ga0070683_1021415562 | 3300005329 | Corn Rhizosphere | MKLIASIAADRSFKTISMLSVLGLVLSFGFIAYGMDLNAVWL* |
| Ga0070680_1002376873 | 3300005336 | Corn Rhizosphere | VKTISSIANDRAFKAITALSFFGLAVSFGMMAFGIDLSVLAL* |
| Ga0070680_1003121733 | 3300005336 | Corn Rhizosphere | MKTISSIAADRSFMAITMLSCFGLAVSFCLMPFGMDLNNVWL* |
| Ga0070680_1015600302 | 3300005336 | Corn Rhizosphere | MQLISSITADRSFKAIAMLSCFGLVVSLGLMACGMDLNAVW |
| Ga0070691_102450241 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | QGANMKTISSIAKDRSFKTITALSFFGLAASFCMMAFGMDLSVLAL* |
| Ga0070659_1007914701 | 3300005366 | Corn Rhizosphere | GIMKLIASIAADRSFKTISMLSVLGLVLSFGFIAYGMDLNAVWL* |
| Ga0070709_100496412 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTISSIANDRTFKTITALSILGLAVSFCMMAFGMDLSVLAL* |
| Ga0070709_100941673 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTISSIVTDRAFKAITIMSCCGLALSFCMVAFGMDLNAVWL* |
| Ga0070709_103214982 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLIASIATDRSFRAISMLSWTGLMLSFGCVAYGMDLNSVWF* |
| Ga0070709_105242761 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTISAIATDSAFKTLALMSCFGLALSFGLMAAGMDLSAVAL* |
| Ga0070709_105557553 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTISMIAADRTFKAITALSCSGLALSFCLMAFGMDLSVAAI* |
| Ga0070711_1007992532 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLIASIATDRTFKAISMLSCFGLAVSLGFMAYGMDLNAVWF* |
| Ga0070681_101922011 | 3300005458 | Corn Rhizosphere | MKTISMMASDRAFKAITALSCSGLVLSFCLMAFGVDLTVAAI* |
| Ga0070741_1000307324 | 3300005529 | Surface Soil | MKTISMIVADRAFKAITALSCSGLALSFCLMAFGMDLTVGAI* |
| Ga0070741_106619872 | 3300005529 | Surface Soil | MKTISSIAADRSFKAMTTLSCFGLAVSFGLMAIGMDLNSVWL* |
| Ga0070741_108660861 | 3300005529 | Surface Soil | IRANKKGGTMKTISSIAADHSFKAMMMLSCFGLAVSFGLMAFGMDLNSVWL* |
| Ga0070741_114323621 | 3300005529 | Surface Soil | MKTISMMASDRAFKAITVLSCSGLALSFCLMALGMDLTVAAI* |
| Ga0070734_101260202 | 3300005533 | Surface Soil | MKAISAIATDSAFKTLAVMSCFGLALSFGLMAAGMDLSAVAL* |
| Ga0070734_106149341 | 3300005533 | Surface Soil | MWANKKLGRVMKTISSIAADRAFKAMTTMSCLGLAVSFCMVAFGMDLNSVWL* |
| Ga0070684_1000018892 | 3300005535 | Corn Rhizosphere | MKTISSIAADRSFMAITMLSCFGLAVSFCLMAFGMDLNSVWL* |
| Ga0070684_1018247582 | 3300005535 | Corn Rhizosphere | MQLIASITADRSFKAIAMLSCFGLVVSLGLMACGMDLNAVWL* |
| Ga0070730_106874222 | 3300005537 | Surface Soil | MKTIALIAADRSFKTMAMLSCFGLAMSFGLMALGMDLTNVWL* |
| Ga0070762_102826553 | 3300005602 | Soil | LIASIATDRSFKAISMLSCVGLAVSLGFMAYGMDLNTVWF* |
| Ga0068852_1017494832 | 3300005616 | Corn Rhizosphere | MGQQGGKMKMISSVAADRTFRAISMFSGFGLALSFCLMAAGADLTATWL* |
| Ga0066903_1002338874 | 3300005764 | Tropical Forest Soil | MLAADRAFKTISTISCLGLAVSFSMMAFGMDLSIGWL* |
| Ga0066903_1013805892 | 3300005764 | Tropical Forest Soil | MKMISSIAADYSFKAMTMLSCSGLVVSFCLMAFGMDLNSVWL* |
| Ga0066903_1056298161 | 3300005764 | Tropical Forest Soil | MKTISSIVTDRAFKAITAMSCFGLALSFCMVAFGM |
| Ga0070717_112049032 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTISMMASDRAFKAIMALSCSGLALSFCLMAFGMDLTVAAI* |
| Ga0070715_103390861 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | AKDRSFKTITALSFFGLAASFCMMAFGMDLSVLAL* |
| Ga0075018_106817271 | 3300006172 | Watersheds | KKGGTMKTISMMASDRAFKAISALSCGGLALSFCLMAFGMDLSVVAI* |
| Ga0070712_1019224801 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTISSIANDRTFKTITALSILGLAVSFCMMAFGMDLSVL |
| Ga0079222_106842742 | 3300006755 | Agricultural Soil | MKTISSIVADRAFKAITTMSCFGLIVSFCMVAFGMDLSSVWL* |
| Ga0079222_114137561 | 3300006755 | Agricultural Soil | AKKGGTMKTISFIASDRAFKAISAVSSCGLVLSFCLMAFGMDLSTGGF* |
| Ga0079221_101803741 | 3300006804 | Agricultural Soil | LIASITADRSFKAIAMLSCFGLVVSFSLTACGIDLN |
| Ga0079220_106454542 | 3300006806 | Agricultural Soil | MKTISSIAADHSFKAMMMLSCFGLAVSFGLMAFGMDLNSVWL* |
| Ga0079220_121440012 | 3300006806 | Agricultural Soil | GTMKTISFIASDRAFKAISAVSSCGLVLSFCLMAFGMDLSTGGF* |
| Ga0075426_101000104 | 3300006903 | Populus Rhizosphere | MKMISSVAADRTFRAISMFSGFGLALSFCLMAAGADLTATWL* |
| Ga0079219_101999003 | 3300006954 | Agricultural Soil | MKTISFIASDRAFKAISSVSSCGLVLSFCLMAFGMDLSAGGF* |
| Ga0079219_107693132 | 3300006954 | Agricultural Soil | MKTISSIVTDRAFKAITTMSGCGLALSFCMVAFGMDLNAVWL* |
| Ga0105240_104786951 | 3300009093 | Corn Rhizosphere | MKTISSIAADRSFMAITMLSCFGLALSFCLMAFGMDLNNVWL* |
| Ga0126380_110088993 | 3300010043 | Tropical Forest Soil | MKTISMIATDRAFKAISALSGSGLALSFCLMAFGMDLNMG |
| Ga0126380_119350182 | 3300010043 | Tropical Forest Soil | MKLIASIATDRSFKAISMLSSLGLAVSFGLMAYGMD |
| Ga0126380_121494361 | 3300010043 | Tropical Forest Soil | MKTISSIVADRAFKAITTMSCSGLALSFCMVAFGMDLNSVWL* |
| Ga0126384_116458082 | 3300010046 | Tropical Forest Soil | MKTISSIARDRAFKAITTLSCFGLAMSFGLMAAGMDLGAAWR* |
| Ga0126384_119806272 | 3300010046 | Tropical Forest Soil | MKLIASIATDRSFKAISMLSSLGLAVSFGLMAYGMDLNAVWL* |
| Ga0126373_111444161 | 3300010048 | Tropical Forest Soil | MKLIASIATDRSFKAISMLSWAGLMLSFGCVAYGMDLTTVWF* |
| Ga0126373_112503302 | 3300010048 | Tropical Forest Soil | MKMISSIAADHSVKAMIMLSCSGLVVSFCLMAFGMDLNSVWL* |
| Ga0126372_113757881 | 3300010360 | Tropical Forest Soil | MIAADRAFKTISTISCLGLAVSFSMMAFGMDLSIGWL* |
| Ga0134125_128061632 | 3300010371 | Terrestrial Soil | ANDRAFKAITALSFFGLAVSFGMMAFGIDLSVLAL* |
| Ga0134128_102206674 | 3300010373 | Terrestrial Soil | MKLIASIAADRSFKTISMLSVLGLVLSFGFIAYGMGLNAVWL* |
| Ga0126381_1014421252 | 3300010376 | Tropical Forest Soil | LKIISMIVADRAFKTISTISCLGLAVSFSMMAFGMDLSIGWL* |
| Ga0126381_1015683772 | 3300010376 | Tropical Forest Soil | TMKLIASIATDRTFKTISMLSCVGLAVSFACMAYGMDLNAVWL* |
| Ga0134126_100214051 | 3300010396 | Terrestrial Soil | MQLISSITADRSFKAIEMLFCFGLVVSLGLMACGMDLNAVWL* |
| Ga0134126_103993842 | 3300010396 | Terrestrial Soil | MKLIASIATDRSFKTISMLSCLGLAVSFAFMAYGMDLNAVWF* |
| Ga0134126_125088452 | 3300010396 | Terrestrial Soil | MKTISMMASDRAFKAITALSCSGLTLSFCLMAFGMDLTVAAI* |
| Ga0137375_104429962 | 3300012360 | Vadose Zone Soil | MKTISSIASDRAFTTITTLSFLGLAVSFGMMAFGMDLSVLAF* |
| Ga0137404_121847151 | 3300012929 | Vadose Zone Soil | MKTISAIATDRAFKAITMLSCFGLALSFGLMAAGMDLSAAGL* |
| Ga0164298_108231542 | 3300012955 | Soil | MKTISSMAKDRSFKTITALSFFGLAASFCMIAFGMDLSFLAL* |
| Ga0164304_111062982 | 3300012986 | Soil | MKTISSIAKDRSFKTITALSFFCLAASFCMMAFGMDLSVLAL* |
| Ga0164307_106175372 | 3300012987 | Soil | MKTISSMAKDRSFKTITALSFFGLAASFCMMAFGMDLSVLAL* |
| Ga0157372_115645541 | 3300013307 | Corn Rhizosphere | MQLIASITADRSFKAIAMLSCFGLVVSLGLMACGMDLN |
| Ga0163163_133165412 | 3300014325 | Switchgrass Rhizosphere | MKTISSIANDRTFKTITALSILGLAVSFCMMAFGMDL |
| Ga0157376_120812922 | 3300014969 | Miscanthus Rhizosphere | SIANARAVEAIRALSFFGLAVSFGMMAFGIDLSVLAL* |
| Ga0132258_1000226436 | 3300015371 | Arabidopsis Rhizosphere | MKTISSIVADRAFKAIMTMSCFGLALSFCMMAFGMDLNSVWL* |
| Ga0132258_128053573 | 3300015371 | Arabidopsis Rhizosphere | MKTISEIAKDRAFKAITTMSCLGLALSLGLMATGMNINAAWL* |
| Ga0132255_1019843011 | 3300015374 | Arabidopsis Rhizosphere | MRTISEIAKDRAFKAITTMSCLGLALSLGLMATGMNINAAWL* |
| Ga0182041_121733811 | 3300016294 | Soil | MKTISEIATDSAFKTITMLSCFGLIVSFGLVAAGMDLSAAWL |
| Ga0182040_116322031 | 3300016387 | Soil | LFYQLSLQDFKVRANKNGGTMKTISEIAADHSFKAMMLLSCFGLAVSFCLMAFGVDLNSVWL |
| Ga0182039_117811692 | 3300016422 | Soil | GTMKTISEIAADHSFKAMMLLSCFGLAVSFCLMAFGVDLNSVWL |
| Ga0206356_118716022 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTISSIAKDRSFKTITALSFFGLAASFCMMAFGMDLSVLAL |
| Ga0210407_101650473 | 3300020579 | Soil | MKLIASIATDRSFKAISMLSCFGLAVSFGFMAYGMDLNAVWF |
| Ga0210395_103055001 | 3300020582 | Soil | MKLIASIATDRTFRAISMLSCIGLAVSFGFMAYGMDLNAVWF |
| Ga0210401_100195574 | 3300020583 | Soil | MKLIASIATDRSFKSISMLSCFGLAVSFGFMAYGMDLNAVWF |
| Ga0210406_103991442 | 3300021168 | Soil | MKTISSIAADHSFKAMVFLSCAGLIVSFCFLAFGVDLNYVWL |
| Ga0210408_103629453 | 3300021178 | Soil | MKTISMMASDRAFKAIAALSCSGLALSFVLMAFGMDLTVAAI |
| Ga0210396_103273823 | 3300021180 | Soil | LIASIATDRSFKAISMLSCFGLAVSFGFMAYGMDLNAVWF |
| Ga0213881_100527203 | 3300021374 | Exposed Rock | MKLIASIATDRSFKTISMLSCFGLAVSFACMAYGMDLNTVWF |
| Ga0213876_100706463 | 3300021384 | Plant Roots | MKTISMMASDRAFKAISALSFSGLALSFVLMAFGMDLTIAAI |
| Ga0213876_102391762 | 3300021384 | Plant Roots | MKTISMLAADRAFKAISALSFSGLALSFVLMAFGMDLTIAAI |
| Ga0213876_102576081 | 3300021384 | Plant Roots | NGGIMKLIASIATDRSFKTISMLSCFGLAVSFACMAYGMDLNTVWF |
| Ga0213876_105084721 | 3300021384 | Plant Roots | MKLIASIATDRSFKTISMLSCFGLAVSFACMAYGMDLNAVWF |
| Ga0213875_103230712 | 3300021388 | Plant Roots | MKLIASIAADRSFKAISMLSCLGLAVSFGMVACGMDLNAVWL |
| Ga0210393_103301142 | 3300021401 | Soil | MLPHGPFGPTKKGGTMKLIASIATDRTFKAISMLSCFGLAVSLGFMAYGMDLNAVWF |
| Ga0210385_112282231 | 3300021402 | Soil | MKLIASIATDRSFKAISMLSCFGLAVSFVFMAYGMDLHAVWF |
| Ga0210397_100131906 | 3300021403 | Soil | MKTISMMTSDRTFRAIAALSCSGLALSFCLMAFGMDLTVAAI |
| Ga0210397_101381881 | 3300021403 | Soil | MKTISIIVSDRAFKAISVLACCGLALSFCLMAFGMDLNS |
| Ga0210397_102766232 | 3300021403 | Soil | MKTISMMASDRAFKAITALSCSGLALSFCLMAFGMDLTVAAI |
| Ga0210397_104783922 | 3300021403 | Soil | MKTISMMASDRAFKAISALSCSGLALSFALMAFGMDLTIAAI |
| Ga0210389_100643042 | 3300021404 | Soil | MKLIASIATDRTFKAISMLSCFGLAVSLGFMAYGMDLNAVWF |
| Ga0210389_104586191 | 3300021404 | Soil | MKTISMMASDRTFRAITALSCSGLALSFCLMAFGMDLTVAAI |
| Ga0210387_107700862 | 3300021405 | Soil | MKSISSIAADHSFRAMTILSCFGLAVSFCLMAFGMDLNSVWL |
| Ga0210384_101223552 | 3300021432 | Soil | MKTISSIAADHSFRAMTILSCFGLAVSFCLMAFGMDLNSVWL |
| Ga0210402_105647942 | 3300021478 | Soil | MKTISMMASDRAFKAITALSCSGLALSFCLMAFGVDLTVAAI |
| Ga0210410_100553894 | 3300021479 | Soil | MKTISIIVSDRAFKAISVLCCCGLALSFCLMAFGMDLNSGWF |
| Ga0126371_110369363 | 3300021560 | Tropical Forest Soil | MKLIASIATDRSFKTISMLSCFGLALSFAFMAYGMELNAVWF |
| Ga0126371_111548232 | 3300021560 | Tropical Forest Soil | MKMISSIAADHSVKAMIMLSCSGLVVSFCLMAFGMDLNSVWL |
| Ga0126371_115178162 | 3300021560 | Tropical Forest Soil | MKLIASIATDRSFKAISMLSCFGLAVSFVFMAYGMDLNAVWF |
| Ga0126371_124605262 | 3300021560 | Tropical Forest Soil | MKLVASIVADRSFKTISMVSCLGLVLSLGCMACGMDLNGVWL |
| Ga0126371_124756442 | 3300021560 | Tropical Forest Soil | MKLIVSIAADRSFKAISMLSSLGLAVSFGFMAYGMDLNDVWL |
| Ga0207692_101776062 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLIASIATDRSFKAISMLSCFGLAVSLGFMAYGMDLNAVWF |
| Ga0207692_102026782 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTISMIASDRTFKAITALSCSGMALSFCLMAFGMDLTVAAI |
| Ga0207699_100827524 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTISAIATDSAFKTLALMSCFGLALSFGLMAAGMDLSAVAL |
| Ga0207699_101848361 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTISSIVTDRAFKAITIMSCCGLALSFCMVAFGMDLNAVWLFRDG |
| Ga0207707_1000317517 | 3300025912 | Corn Rhizosphere | VKTISSIANDRAFKAITALSFFGLAVSFGMMAFGIDLSVLAL |
| Ga0207707_100605434 | 3300025912 | Corn Rhizosphere | MKTISSIAADRSFMAITMLSCFGLAVSFCLMPFGMDLNNVWL |
| Ga0207707_101436204 | 3300025912 | Corn Rhizosphere | MKTISMMASDRAFKAITALSCSGLVLSFCLMAFGVDLTVAAI |
| Ga0207695_103285023 | 3300025913 | Corn Rhizosphere | MKTISSIAADRSFMAITMLSCFGLAVSFCLMAFGMDLNSVWL |
| Ga0207695_104060672 | 3300025913 | Corn Rhizosphere | MKLIASIAADRSFKTISMLSVLGLVLSFGFIAYGMDLNAVWL |
| Ga0207649_105633742 | 3300025920 | Corn Rhizosphere | LISSITADRSFKAIAMLSCFGLVVSLGLMACGMDLNAVWL |
| Ga0207700_105900252 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTISSIANDRTFKTITALSILGLAVSFCMMAFGMDLSVLAL |
| Ga0207661_101104211 | 3300025944 | Corn Rhizosphere | MGAIMKTISSIAADRSFMAITMLSCFGLAVSFCLMAFGMDLNSVWL |
| Ga0207661_119444332 | 3300025944 | Corn Rhizosphere | MKTISAIATDSAFKTLAVMSCFGLALSFGLMAAGMDLSA |
| Ga0207667_104448281 | 3300025949 | Corn Rhizosphere | ASDRAFKAITALSCSGLVLSFCLMAFGVDLTVAAI |
| Ga0207678_117633482 | 3300026067 | Corn Rhizosphere | MQLISSITADRSFKAIAMLSCFGLVVSLGLMACGMDLNAVWL |
| Ga0207702_123888832 | 3300026078 | Corn Rhizosphere | MKLIASIATDRSFETISMLSVLGLVASFGFIAYGMDLNAVWL |
| Ga0207698_104948541 | 3300026142 | Corn Rhizosphere | VWANKKGGTMQLISSITADRSFKAIAMLSCFGLVVSLGLMACGMDLNAVWL |
| Ga0207698_110226342 | 3300026142 | Corn Rhizosphere | MKMISSVAADRTFRAISMFSGFGLALSFCLMAAGADLTATWL |
| Ga0209073_102602392 | 3300027765 | Agricultural Soil | MKTISSIAADHSFKAMMMLSCFGLAVSFGLMAFGMDLNSVWL |
| Ga0209074_102479952 | 3300027787 | Agricultural Soil | MKTISSIVADRAFKAITTMSCFGLAVSFCMVAFGM |
| Ga0209112_102043771 | 3300027817 | Forest Soil | MKLIASIATDRSFKAISMMSCLGLVLSFGFIASGMDLTVVWF |
| Ga0209060_104081982 | 3300027826 | Surface Soil | MWANKKLGRVMKTISSIAADRAFKAMTTMSCLGLAVSFCMVAFGMDLNSVWL |
| Ga0209465_101807911 | 3300027874 | Tropical Forest Soil | MLAADRAFKTISTISCLGLAVSFSMMAFGMDLSIGWL |
| Ga0170824_1070307471 | 3300031231 | Forest Soil | MKTISMMASDRAFRAITALSCSGLALSFCLMAFGMDLTIGAI |
| Ga0170824_1158253071 | 3300031231 | Forest Soil | MKTISMMASDRAFKAISAVSCGGLALSFCLMAFGMDLSVVAI |
| Ga0170824_1265956582 | 3300031231 | Forest Soil | MKTISSIAADHSFRAMTMLSCLGLVVSFCLMAFGMDLNSVWL |
| Ga0307474_105575622 | 3300031718 | Hardwood Forest Soil | MKLIASIATDRSFKAISMLSCFGLAVSFGLMAYGMDLNAVWF |
| Ga0306921_118000441 | 3300031912 | Soil | MKTISEIAADHSFKAMTMLSCFGLAVSFCLMAFGVDLNSVWL |
| Ga0310912_105422223 | 3300031941 | Soil | MKTISEIAADHSFKAMMLLSCFGLAVSFCLMAFGVDLNSVWL |
| Ga0307470_108083113 | 3300032174 | Hardwood Forest Soil | MKLIASIATDRSFKAISMLSCFGLAVSFGLMAYGMDLN |
| Ga0335076_103216833 | 3300032955 | Soil | MKTIASIAADHSFKAMFLLSFVGLVASFCLMASGMDLNSVWL |
| Ga0335084_103995373 | 3300033004 | Soil | MKTISAIAADRTFKAITVLSCFGLALSFGMMAAGIDLSAVAL |
| Ga0310811_100101211 | 3300033475 | Soil | MQLIASITADRSFKAIAMLSCFGLVVSLGLMACGMDLNAVWL |
| ⦗Top⦘ |