Metagenome / Metatranscriptome Family F053596

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F053596
Family Type	Metagenome / Metatranscriptome
Number of Sequences	141
Average Sequence Length	42 residues
Representative Sequence	MKTISSIAADRSFMAITMLSCFGLAVSFCLMAFGMDLNSVWL
Number of Associated Samples	94
Number of Associated Scaffolds	141

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	70.00 %
% of genes near scaffold ends (potentially truncated)	12.77 %
% of genes from short scaffolds (< 2000 bps)	58.87 %
Associated GOLD sequencing projects	84
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (65.248 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.475 % of family members)
Environment Ontology (ENVO)	Unclassified (23.404 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (52.482 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 38.57% β-sheet: 0.00% Coil/Unstructured: 61.43%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.46
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 141 Family Scaffolds
PF13462	Thioredoxin_4	47.52
PF08484	Methyltransf_14	2.13
PF07238	PilZ	2.13
PF13505	OMP_b-brl	1.42
PF03330	DPBB_1	1.42
PF13844	Glyco_transf_41	0.71
PF01467	CTP_transf_like	0.71
PF04060	FeS	0.71
PF00903	Glyoxalase	0.71
PF13424	TPR_12	0.71
PF01425	Amidase	0.71
PF13489	Methyltransf_23	0.71
PF13379	NMT1_2	0.71
PF04321	RmlD_sub_bind	0.71
PF00456	Transketolase_N	0.71
PF07690	MFS_1	0.71
PF13356	Arm-DNA-bind_3	0.71

COG ID	Name	Functional Category	% Frequency in 141 Family Scaffolds
COG0451	Nucleoside-diphosphate-sugar epimerase	Cell wall/membrane/envelope biogenesis [M]	1.42
COG0702	Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domains	General function prediction only [R]	1.42
COG1086	NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsC	Cell wall/membrane/envelope biogenesis [M]	1.42
COG0021	Transketolase	Carbohydrate transport and metabolism [G]	0.71
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	0.71
COG1087	UDP-glucose 4-epimerase	Cell wall/membrane/envelope biogenesis [M]	0.71
COG1088	dTDP-D-glucose 4,6-dehydratase	Cell wall/membrane/envelope biogenesis [M]	0.71
COG1089	GDP-D-mannose dehydratase	Cell wall/membrane/envelope biogenesis [M]	0.71
COG1090	NAD dependent epimerase/dehydratase family enzyme	General function prediction only [R]	0.71
COG1091	dTDP-4-dehydrorhamnose reductase	Cell wall/membrane/envelope biogenesis [M]	0.71
COG3959	Transketolase, N-terminal subunit	Carbohydrate transport and metabolism [G]	0.71

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	65.25 %
Unclassified	root	N/A	34.75 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	65.25 %
Unclassified	root	N/A	34.75 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	65.25 %
Unclassified	root	N/A	34.75 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	65.25 %
Unclassified	root	N/A	34.75 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	60.28 %
Unclassified	root	N/A	34.75 %

Name	Rank	Taxonomy	Distribution
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	56.03 %
Unclassified	root	N/A	34.75 %

Name	Rank	Taxonomy	Distribution
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	54.61 %
Unclassified	root	N/A	34.75 %
Phyllobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae	1.42 %

Name	Rank	Taxonomy	Distribution
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	49.65 %
Unclassified	root	N/A	34.75 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	1.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.75 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	4.96 %
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	2.13 %
unclassified Mesorhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium	1.42 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.75 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	4.96 %
Bradyrhizobium sp. Tv2a-2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2	1.42 %
Mesorhizobium sp. STM 4661	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661	1.42 %
Bradyrhizobium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.	0.71 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300003316\|rootH1_10136570	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1419	Open in IMG/M
3300003321\|soilH1_10039683	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2	3903	Open in IMG/M
3300003323\|rootH1_10401619	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1372	Open in IMG/M
3300003324\|soilH2_10258881	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2055	Open in IMG/M
3300004479\|Ga0062595_101381527	Not Available	640	Open in IMG/M
3300004633\|Ga0066395_10104041	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1373	Open in IMG/M
3300005329\|Ga0070683_100036502	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2	4497	Open in IMG/M
3300005329\|Ga0070683_100096032	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2787	Open in IMG/M
3300005336\|Ga0070680_100237687	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1539	Open in IMG/M
3300005336\|Ga0070680_100312173	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1334	Open in IMG/M
3300005341\|Ga0070691_10245024	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	959	Open in IMG/M
3300005434\|Ga0070709_10049641	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2625	Open in IMG/M
3300005434\|Ga0070709_10094167	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1981	Open in IMG/M
3300005434\|Ga0070709_10524276	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	903	Open in IMG/M
3300005434\|Ga0070709_10555755	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	879	Open in IMG/M
3300005458\|Ga0070681_10192201	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1961	Open in IMG/M
3300005529\|Ga0070741_10003073	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	42497	Open in IMG/M
3300005529\|Ga0070741_10661987	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	925	Open in IMG/M
3300005529\|Ga0070741_10866086	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	784	Open in IMG/M
3300005529\|Ga0070741_11432362	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	572	Open in IMG/M
3300005533\|Ga0070734_10126020	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1494	Open in IMG/M
3300005533\|Ga0070734_10614934	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	618	Open in IMG/M
3300005535\|Ga0070684_100001889	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	15348	Open in IMG/M
3300005537\|Ga0070730_10687422	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	649	Open in IMG/M
3300005616\|Ga0068852_101749483	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	644	Open in IMG/M
3300005764\|Ga0066903_100233887	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2807	Open in IMG/M
3300005764\|Ga0066903_101380589	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1322	Open in IMG/M
3300005764\|Ga0066903_105629816	All Organisms → cellular organisms → Bacteria → Proteobacteria	659	Open in IMG/M
3300006028\|Ga0070717_11204903	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	689	Open in IMG/M
3300006163\|Ga0070715_10339086	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	817	Open in IMG/M
3300006172\|Ga0075018_10681727	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	554	Open in IMG/M
3300006175\|Ga0070712_101922480	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	518	Open in IMG/M
3300006755\|Ga0079222_10684274	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	807	Open in IMG/M
3300006755\|Ga0079222_11413756	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661	645	Open in IMG/M
3300006806\|Ga0079220_10645454	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	764	Open in IMG/M
3300006806\|Ga0079220_12144001	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	501	Open in IMG/M
3300006903\|Ga0075426_10100010	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2080	Open in IMG/M
3300006954\|Ga0079219_10199900	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1132	Open in IMG/M
3300006954\|Ga0079219_10769313	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	749	Open in IMG/M
3300009093\|Ga0105240_10478695	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1388	Open in IMG/M
3300010043\|Ga0126380_11008899	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	702	Open in IMG/M
3300010043\|Ga0126380_12149436	Not Available	515	Open in IMG/M
3300010046\|Ga0126384_11645808	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.	606	Open in IMG/M
3300010048\|Ga0126373_11250330	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	808	Open in IMG/M
3300010360\|Ga0126372_11375788	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	737	Open in IMG/M
3300010371\|Ga0134125_12806163	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	529	Open in IMG/M
3300010376\|Ga0126381_101442125	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	995	Open in IMG/M
3300010396\|Ga0134126_12508845	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	560	Open in IMG/M
3300012360\|Ga0137375_10442996	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1122	Open in IMG/M
3300012929\|Ga0137404_12184715	Not Available	517	Open in IMG/M
3300012955\|Ga0164298_10823154	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	667	Open in IMG/M
3300012986\|Ga0164304_11106298	Not Available	634	Open in IMG/M
3300012987\|Ga0164307_10617537	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	838	Open in IMG/M
3300014325\|Ga0163163_13316541	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	502	Open in IMG/M
3300014969\|Ga0157376_12081292	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	606	Open in IMG/M
3300015371\|Ga0132258_10002264	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	35344	Open in IMG/M
3300015371\|Ga0132258_12805357	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1213	Open in IMG/M
3300015374\|Ga0132255_101984301	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	886	Open in IMG/M
3300016294\|Ga0182041_12173381	Not Available	518	Open in IMG/M
3300016387\|Ga0182040_11632203	Not Available	549	Open in IMG/M
3300016422\|Ga0182039_11781169	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	564	Open in IMG/M
3300020070\|Ga0206356_11871602	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	791	Open in IMG/M
3300021168\|Ga0210406_10399144	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1102	Open in IMG/M
3300021178\|Ga0210408_10362945	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1155	Open in IMG/M
3300021384\|Ga0213876_10070646	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1844	Open in IMG/M
3300021384\|Ga0213876_10239176	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	965	Open in IMG/M
3300021401\|Ga0210393_10330114	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1241	Open in IMG/M
3300021403\|Ga0210397_10013190	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	4998	Open in IMG/M
3300021403\|Ga0210397_10138188	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1691	Open in IMG/M
3300021403\|Ga0210397_10276623	All Organisms → cellular organisms → Bacteria → Proteobacteria	1226	Open in IMG/M
3300021403\|Ga0210397_10478392	All Organisms → cellular organisms → Bacteria → Proteobacteria	941	Open in IMG/M
3300021404\|Ga0210389_10458619	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1003	Open in IMG/M
3300021405\|Ga0210387_10770086	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	851	Open in IMG/M
3300021432\|Ga0210384_10122355	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2334	Open in IMG/M
3300021478\|Ga0210402_10564794	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1056	Open in IMG/M
3300021479\|Ga0210410_10055389	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	3458	Open in IMG/M
3300021560\|Ga0126371_11154823	All Organisms → cellular organisms → Bacteria → Proteobacteria	912	Open in IMG/M
3300025898\|Ga0207692_10202678	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1167	Open in IMG/M
3300025906\|Ga0207699_10082752	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1995	Open in IMG/M
3300025906\|Ga0207699_10184836	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1403	Open in IMG/M
3300025912\|Ga0207707_10003175	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	14586	Open in IMG/M
3300025912\|Ga0207707_10060543	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3294	Open in IMG/M
3300025912\|Ga0207707_10143620	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2086	Open in IMG/M
3300025913\|Ga0207695_10328502	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1418	Open in IMG/M
3300025928\|Ga0207700_10590025	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	988	Open in IMG/M
3300025944\|Ga0207661_10110421	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2324	Open in IMG/M
3300025944\|Ga0207661_11944433	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	534	Open in IMG/M
3300025949\|Ga0207667_10444828	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1317	Open in IMG/M
3300026142\|Ga0207698_11022634	All Organisms → cellular organisms → Bacteria → Proteobacteria	837	Open in IMG/M
3300027765\|Ga0209073_10260239	Not Available	677	Open in IMG/M
3300027787\|Ga0209074_10247995	All Organisms → cellular organisms → Bacteria → Proteobacteria	690	Open in IMG/M
3300027826\|Ga0209060_10408198	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	618	Open in IMG/M
3300027874\|Ga0209465_10180791	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661	1051	Open in IMG/M
3300031231\|Ga0170824_107030747	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	989	Open in IMG/M
3300031231\|Ga0170824_115825307	All Organisms → cellular organisms → Bacteria → Proteobacteria	539	Open in IMG/M
3300031231\|Ga0170824_126595658	Not Available	526	Open in IMG/M
3300031912\|Ga0306921_11800044	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	659	Open in IMG/M
3300031941\|Ga0310912_10542222	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	906	Open in IMG/M
3300032955\|Ga0335076_10321683	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1434	Open in IMG/M
3300033004\|Ga0335084_10399537	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1416	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	82.27%
Host-Associated	Host-Associated	17.73%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	81.56%
Plants	Host-Associated → Plants	17.73%
Aquatic	Environmental → Aquatic	0.71%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	80.85%
Rhizosphere	Host-Associated → Plants → Rhizosphere	6.38%
Rhizoplane	Host-Associated → Plants → Rhizoplane	5.67%
Roots	Host-Associated → Plants → Roots	4.26%
Rhizome	Host-Associated → Plants → Rhizome	1.42%
Sediment	Environmental → Aquatic → Sediment	0.71%
Rock-Dwelling (Subaerial Biofilms)	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms)	0.71%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	53.19%
Loam	Environmental → Terrestrial → Soil → Loam	26.24%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	4.26%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	3.55%
Unclassified	Host-Associated → Plants → Roots → Unclassified	3.55%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.13%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.13%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	1.42%
Unclassified	Host-Associated → Plants → Rhizome → Unclassified	1.42%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.71%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified	0.71%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.71%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	24.82%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	21.28%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	19.86%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	8.51%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	4.96%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	4.26%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	3.55%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	3.55%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.13%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.13%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	1.42%
Unclassified	Host-Associated → Plants → Rhizome → Unclassified → Unclassified	1.42%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.71%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified	0.71%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.71%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	13.48%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	10.64%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	10.64%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	10.64%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	6.38%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	5.67%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	3.55%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	3.55%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	3.55%
Plant Roots	Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots	3.55%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.84%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.84%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	2.13%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	2.13%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	2.13%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	2.13%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	1.42%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	1.42%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.42%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.42%
Sugarcane Root And Bulk Soil	Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil	1.42%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.71%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.71%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.71%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.71%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	0.71%
Exposed Rock	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock	0.71%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.71%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	0.71%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.71%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.71%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300003316	Sugarcane root Sample L1	Host-Associated	Open in IMG/M
3300003321	Sugarcane bulk soil Sample H1	Environmental	Open in IMG/M
3300003323	Sugarcane root Sample H1	Host-Associated	Open in IMG/M
3300003324	Sugarcane bulk soil Sample H2	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300004633	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio	Environmental	Open in IMG/M
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental	Open in IMG/M
3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Environmental	Open in IMG/M
3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Environmental	Open in IMG/M
3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Host-Associated	Open in IMG/M
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental	Open in IMG/M
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental	Open in IMG/M
3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Environmental	Open in IMG/M
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental	Open in IMG/M
3300005533	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1	Environmental	Open in IMG/M
3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Environmental	Open in IMG/M
3300005537	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1	Environmental	Open in IMG/M
3300005602	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2	Environmental	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental	Open in IMG/M
3300006172	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300012360	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016294	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178	Environmental	Open in IMG/M
3300016387	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176	Environmental	Open in IMG/M
3300016422	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111	Environmental	Open in IMG/M
3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300020579	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M	Environmental	Open in IMG/M
3300020582	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O	Environmental	Open in IMG/M
3300020583	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M	Environmental	Open in IMG/M
3300021168	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M	Environmental	Open in IMG/M
3300021178	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M	Environmental	Open in IMG/M
3300021180	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O	Environmental	Open in IMG/M
3300021374	Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08	Environmental	Open in IMG/M
3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Host-Associated	Open in IMG/M
3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Host-Associated	Open in IMG/M
3300021401	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O	Environmental	Open in IMG/M
3300021402	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O	Environmental	Open in IMG/M
3300021403	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O	Environmental	Open in IMG/M
3300021404	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O	Environmental	Open in IMG/M
3300021405	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O	Environmental	Open in IMG/M
3300021432	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M	Environmental	Open in IMG/M
3300021478	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M	Environmental	Open in IMG/M
3300021479	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027765	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)	Environmental	Open in IMG/M
3300027787	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)	Environmental	Open in IMG/M
3300027817	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes)	Environmental	Open in IMG/M
3300027826	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031718	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05	Environmental	Open in IMG/M
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental	Open in IMG/M
3300031941	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032955	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5	Environmental	Open in IMG/M
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental	Open in IMG/M
3300033475	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
rootH1_101365701	3300003316	Sugarcane Root And Bulk Soil	MKTISAIATDNAFKTLAVMSCFGLALSFGLMAAGMDLSAVAL*
soilH1_100396835	3300003321	Sugarcane Root And Bulk Soil	MKTISSIAAHRSFMAIAMLSCFGLAVSFCLMAYGMDLNSVWL*
rootH1_104016192	3300003323	Sugarcane Root And Bulk Soil	MKTISSIAADHAFKAIATMSCFGLALSFGMVAFGMDLSSVWL*
soilH2_102588814	3300003324	Sugarcane Root And Bulk Soil	MKTISAIATDSAFKTLAVMSCFGLALSFGLMAAGMDLSAVAL*
Ga0062595_1013815272	3300004479	Soil	VKTISSIVNDRAFKAIAALSFFGLAVSFGMMAFGMDLSVLAL*
Ga0066395_101040413	3300004633	Tropical Forest Soil	LKTISMLAADRAFKTISTISCLGLAVSFSMMAFGMDLSIGWL*
Ga0070683_1000365026	3300005329	Corn Rhizosphere	MGAIMKTISSIAADRSFMAITMLSCFGLAVSFCLMAFGMDLNSVWL*
Ga0070683_1000960321	3300005329	Corn Rhizosphere	MKTISSIAKDRSFKTITALSFFGLAASFCMMAFGMDLSVLAL*
Ga0070683_1003305323	3300005329	Corn Rhizosphere	MQLISSITADRSFKAIAMLSCFGLVVSLGLMACGMDLNAVWL*
Ga0070683_1021415562	3300005329	Corn Rhizosphere	MKLIASIAADRSFKTISMLSVLGLVLSFGFIAYGMDLNAVWL*
Ga0070680_1002376873	3300005336	Corn Rhizosphere	VKTISSIANDRAFKAITALSFFGLAVSFGMMAFGIDLSVLAL*
Ga0070680_1003121733	3300005336	Corn Rhizosphere	MKTISSIAADRSFMAITMLSCFGLAVSFCLMPFGMDLNNVWL*
Ga0070680_1015600302	3300005336	Corn Rhizosphere	MQLISSITADRSFKAIAMLSCFGLVVSLGLMACGMDLNAVW
Ga0070691_102450241	3300005341	Corn, Switchgrass And Miscanthus Rhizosphere	QGANMKTISSIAKDRSFKTITALSFFGLAASFCMMAFGMDLSVLAL*
Ga0070659_1007914701	3300005366	Corn Rhizosphere	GIMKLIASIAADRSFKTISMLSVLGLVLSFGFIAYGMDLNAVWL*
Ga0070709_100496412	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MKTISSIANDRTFKTITALSILGLAVSFCMMAFGMDLSVLAL*
Ga0070709_100941673	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MKTISSIVTDRAFKAITIMSCCGLALSFCMVAFGMDLNAVWL*
Ga0070709_103214982	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MKLIASIATDRSFRAISMLSWTGLMLSFGCVAYGMDLNSVWF*
Ga0070709_105242761	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MKTISAIATDSAFKTLALMSCFGLALSFGLMAAGMDLSAVAL*
Ga0070709_105557553	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MKTISMIAADRTFKAITALSCSGLALSFCLMAFGMDLSVAAI*
Ga0070711_1007992532	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	MKLIASIATDRTFKAISMLSCFGLAVSLGFMAYGMDLNAVWF*
Ga0070681_101922011	3300005458	Corn Rhizosphere	MKTISMMASDRAFKAITALSCSGLVLSFCLMAFGVDLTVAAI*
Ga0070741_1000307324	3300005529	Surface Soil	MKTISMIVADRAFKAITALSCSGLALSFCLMAFGMDLTVGAI*
Ga0070741_106619872	3300005529	Surface Soil	MKTISSIAADRSFKAMTTLSCFGLAVSFGLMAIGMDLNSVWL*
Ga0070741_108660861	3300005529	Surface Soil	IRANKKGGTMKTISSIAADHSFKAMMMLSCFGLAVSFGLMAFGMDLNSVWL*
Ga0070741_114323621	3300005529	Surface Soil	MKTISMMASDRAFKAITVLSCSGLALSFCLMALGMDLTVAAI*
Ga0070734_101260202	3300005533	Surface Soil	MKAISAIATDSAFKTLAVMSCFGLALSFGLMAAGMDLSAVAL*
Ga0070734_106149341	3300005533	Surface Soil	MWANKKLGRVMKTISSIAADRAFKAMTTMSCLGLAVSFCMVAFGMDLNSVWL*
Ga0070684_1000018892	3300005535	Corn Rhizosphere	MKTISSIAADRSFMAITMLSCFGLAVSFCLMAFGMDLNSVWL*
Ga0070684_1018247582	3300005535	Corn Rhizosphere	MQLIASITADRSFKAIAMLSCFGLVVSLGLMACGMDLNAVWL*
Ga0070730_106874222	3300005537	Surface Soil	MKTIALIAADRSFKTMAMLSCFGLAMSFGLMALGMDLTNVWL*
Ga0070762_102826553	3300005602	Soil	LIASIATDRSFKAISMLSCVGLAVSLGFMAYGMDLNTVWF*
Ga0068852_1017494832	3300005616	Corn Rhizosphere	MGQQGGKMKMISSVAADRTFRAISMFSGFGLALSFCLMAAGADLTATWL*
Ga0066903_1002338874	3300005764	Tropical Forest Soil	MLAADRAFKTISTISCLGLAVSFSMMAFGMDLSIGWL*
Ga0066903_1013805892	3300005764	Tropical Forest Soil	MKMISSIAADYSFKAMTMLSCSGLVVSFCLMAFGMDLNSVWL*
Ga0066903_1056298161	3300005764	Tropical Forest Soil	MKTISSIVTDRAFKAITAMSCFGLALSFCMVAFGM
Ga0070717_112049032	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MKTISMMASDRAFKAIMALSCSGLALSFCLMAFGMDLTVAAI*
Ga0070715_103390861	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	AKDRSFKTITALSFFGLAASFCMMAFGMDLSVLAL*
Ga0075018_106817271	3300006172	Watersheds	KKGGTMKTISMMASDRAFKAISALSCGGLALSFCLMAFGMDLSVVAI*
Ga0070712_1019224801	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MKTISSIANDRTFKTITALSILGLAVSFCMMAFGMDLSVL
Ga0079222_106842742	3300006755	Agricultural Soil	MKTISSIVADRAFKAITTMSCFGLIVSFCMVAFGMDLSSVWL*
Ga0079222_114137561	3300006755	Agricultural Soil	AKKGGTMKTISFIASDRAFKAISAVSSCGLVLSFCLMAFGMDLSTGGF*
Ga0079221_101803741	3300006804	Agricultural Soil	LIASITADRSFKAIAMLSCFGLVVSFSLTACGIDLN
Ga0079220_106454542	3300006806	Agricultural Soil	MKTISSIAADHSFKAMMMLSCFGLAVSFGLMAFGMDLNSVWL*
Ga0079220_121440012	3300006806	Agricultural Soil	GTMKTISFIASDRAFKAISAVSSCGLVLSFCLMAFGMDLSTGGF*
Ga0075426_101000104	3300006903	Populus Rhizosphere	MKMISSVAADRTFRAISMFSGFGLALSFCLMAAGADLTATWL*
Ga0079219_101999003	3300006954	Agricultural Soil	MKTISFIASDRAFKAISSVSSCGLVLSFCLMAFGMDLSAGGF*
Ga0079219_107693132	3300006954	Agricultural Soil	MKTISSIVTDRAFKAITTMSGCGLALSFCMVAFGMDLNAVWL*
Ga0105240_104786951	3300009093	Corn Rhizosphere	MKTISSIAADRSFMAITMLSCFGLALSFCLMAFGMDLNNVWL*
Ga0126380_110088993	3300010043	Tropical Forest Soil	MKTISMIATDRAFKAISALSGSGLALSFCLMAFGMDLNMG
Ga0126380_119350182	3300010043	Tropical Forest Soil	MKLIASIATDRSFKAISMLSSLGLAVSFGLMAYGMD
Ga0126380_121494361	3300010043	Tropical Forest Soil	MKTISSIVADRAFKAITTMSCSGLALSFCMVAFGMDLNSVWL*
Ga0126384_116458082	3300010046	Tropical Forest Soil	MKTISSIARDRAFKAITTLSCFGLAMSFGLMAAGMDLGAAWR*
Ga0126384_119806272	3300010046	Tropical Forest Soil	MKLIASIATDRSFKAISMLSSLGLAVSFGLMAYGMDLNAVWL*
Ga0126373_111444161	3300010048	Tropical Forest Soil	MKLIASIATDRSFKAISMLSWAGLMLSFGCVAYGMDLTTVWF*
Ga0126373_112503302	3300010048	Tropical Forest Soil	MKMISSIAADHSVKAMIMLSCSGLVVSFCLMAFGMDLNSVWL*
Ga0126372_113757881	3300010360	Tropical Forest Soil	MIAADRAFKTISTISCLGLAVSFSMMAFGMDLSIGWL*
Ga0134125_128061632	3300010371	Terrestrial Soil	ANDRAFKAITALSFFGLAVSFGMMAFGIDLSVLAL*
Ga0134128_102206674	3300010373	Terrestrial Soil	MKLIASIAADRSFKTISMLSVLGLVLSFGFIAYGMGLNAVWL*
Ga0126381_1014421252	3300010376	Tropical Forest Soil	LKIISMIVADRAFKTISTISCLGLAVSFSMMAFGMDLSIGWL*
Ga0126381_1015683772	3300010376	Tropical Forest Soil	TMKLIASIATDRTFKTISMLSCVGLAVSFACMAYGMDLNAVWL*
Ga0134126_100214051	3300010396	Terrestrial Soil	MQLISSITADRSFKAIEMLFCFGLVVSLGLMACGMDLNAVWL*
Ga0134126_103993842	3300010396	Terrestrial Soil	MKLIASIATDRSFKTISMLSCLGLAVSFAFMAYGMDLNAVWF*
Ga0134126_125088452	3300010396	Terrestrial Soil	MKTISMMASDRAFKAITALSCSGLTLSFCLMAFGMDLTVAAI*
Ga0137375_104429962	3300012360	Vadose Zone Soil	MKTISSIASDRAFTTITTLSFLGLAVSFGMMAFGMDLSVLAF*
Ga0137404_121847151	3300012929	Vadose Zone Soil	MKTISAIATDRAFKAITMLSCFGLALSFGLMAAGMDLSAAGL*
Ga0164298_108231542	3300012955	Soil	MKTISSMAKDRSFKTITALSFFGLAASFCMIAFGMDLSFLAL*
Ga0164304_111062982	3300012986	Soil	MKTISSIAKDRSFKTITALSFFCLAASFCMMAFGMDLSVLAL*
Ga0164307_106175372	3300012987	Soil	MKTISSMAKDRSFKTITALSFFGLAASFCMMAFGMDLSVLAL*
Ga0157372_115645541	3300013307	Corn Rhizosphere	MQLIASITADRSFKAIAMLSCFGLVVSLGLMACGMDLN
Ga0163163_133165412	3300014325	Switchgrass Rhizosphere	MKTISSIANDRTFKTITALSILGLAVSFCMMAFGMDL
Ga0157376_120812922	3300014969	Miscanthus Rhizosphere	SIANARAVEAIRALSFFGLAVSFGMMAFGIDLSVLAL*
Ga0132258_1000226436	3300015371	Arabidopsis Rhizosphere	MKTISSIVADRAFKAIMTMSCFGLALSFCMMAFGMDLNSVWL*
Ga0132258_128053573	3300015371	Arabidopsis Rhizosphere	MKTISEIAKDRAFKAITTMSCLGLALSLGLMATGMNINAAWL*
Ga0132255_1019843011	3300015374	Arabidopsis Rhizosphere	MRTISEIAKDRAFKAITTMSCLGLALSLGLMATGMNINAAWL*
Ga0182041_121733811	3300016294	Soil	MKTISEIATDSAFKTITMLSCFGLIVSFGLVAAGMDLSAAWL
Ga0182040_116322031	3300016387	Soil	LFYQLSLQDFKVRANKNGGTMKTISEIAADHSFKAMMLLSCFGLAVSFCLMAFGVDLNSVWL
Ga0182039_117811692	3300016422	Soil	GTMKTISEIAADHSFKAMMLLSCFGLAVSFCLMAFGVDLNSVWL
Ga0206356_118716022	3300020070	Corn, Switchgrass And Miscanthus Rhizosphere	MKTISSIAKDRSFKTITALSFFGLAASFCMMAFGMDLSVLAL
Ga0210407_101650473	3300020579	Soil	MKLIASIATDRSFKAISMLSCFGLAVSFGFMAYGMDLNAVWF
Ga0210395_103055001	3300020582	Soil	MKLIASIATDRTFRAISMLSCIGLAVSFGFMAYGMDLNAVWF
Ga0210401_100195574	3300020583	Soil	MKLIASIATDRSFKSISMLSCFGLAVSFGFMAYGMDLNAVWF
Ga0210406_103991442	3300021168	Soil	MKTISSIAADHSFKAMVFLSCAGLIVSFCFLAFGVDLNYVWL
Ga0210408_103629453	3300021178	Soil	MKTISMMASDRAFKAIAALSCSGLALSFVLMAFGMDLTVAAI
Ga0210396_103273823	3300021180	Soil	LIASIATDRSFKAISMLSCFGLAVSFGFMAYGMDLNAVWF
Ga0213881_100527203	3300021374	Exposed Rock	MKLIASIATDRSFKTISMLSCFGLAVSFACMAYGMDLNTVWF
Ga0213876_100706463	3300021384	Plant Roots	MKTISMMASDRAFKAISALSFSGLALSFVLMAFGMDLTIAAI
Ga0213876_102391762	3300021384	Plant Roots	MKTISMLAADRAFKAISALSFSGLALSFVLMAFGMDLTIAAI
Ga0213876_102576081	3300021384	Plant Roots	NGGIMKLIASIATDRSFKTISMLSCFGLAVSFACMAYGMDLNTVWF
Ga0213876_105084721	3300021384	Plant Roots	MKLIASIATDRSFKTISMLSCFGLAVSFACMAYGMDLNAVWF
Ga0213875_103230712	3300021388	Plant Roots	MKLIASIAADRSFKAISMLSCLGLAVSFGMVACGMDLNAVWL
Ga0210393_103301142	3300021401	Soil	MLPHGPFGPTKKGGTMKLIASIATDRTFKAISMLSCFGLAVSLGFMAYGMDLNAVWF
Ga0210385_112282231	3300021402	Soil	MKLIASIATDRSFKAISMLSCFGLAVSFVFMAYGMDLHAVWF
Ga0210397_100131906	3300021403	Soil	MKTISMMTSDRTFRAIAALSCSGLALSFCLMAFGMDLTVAAI
Ga0210397_101381881	3300021403	Soil	MKTISIIVSDRAFKAISVLACCGLALSFCLMAFGMDLNS
Ga0210397_102766232	3300021403	Soil	MKTISMMASDRAFKAITALSCSGLALSFCLMAFGMDLTVAAI
Ga0210397_104783922	3300021403	Soil	MKTISMMASDRAFKAISALSCSGLALSFALMAFGMDLTIAAI
Ga0210389_100643042	3300021404	Soil	MKLIASIATDRTFKAISMLSCFGLAVSLGFMAYGMDLNAVWF
Ga0210389_104586191	3300021404	Soil	MKTISMMASDRTFRAITALSCSGLALSFCLMAFGMDLTVAAI
Ga0210387_107700862	3300021405	Soil	MKSISSIAADHSFRAMTILSCFGLAVSFCLMAFGMDLNSVWL
Ga0210384_101223552	3300021432	Soil	MKTISSIAADHSFRAMTILSCFGLAVSFCLMAFGMDLNSVWL
Ga0210402_105647942	3300021478	Soil	MKTISMMASDRAFKAITALSCSGLALSFCLMAFGVDLTVAAI
Ga0210410_100553894	3300021479	Soil	MKTISIIVSDRAFKAISVLCCCGLALSFCLMAFGMDLNSGWF
Ga0126371_110369363	3300021560	Tropical Forest Soil	MKLIASIATDRSFKTISMLSCFGLALSFAFMAYGMELNAVWF
Ga0126371_111548232	3300021560	Tropical Forest Soil	MKMISSIAADHSVKAMIMLSCSGLVVSFCLMAFGMDLNSVWL
Ga0126371_115178162	3300021560	Tropical Forest Soil	MKLIASIATDRSFKAISMLSCFGLAVSFVFMAYGMDLNAVWF
Ga0126371_124605262	3300021560	Tropical Forest Soil	MKLVASIVADRSFKTISMVSCLGLVLSLGCMACGMDLNGVWL
Ga0126371_124756442	3300021560	Tropical Forest Soil	MKLIVSIAADRSFKAISMLSSLGLAVSFGFMAYGMDLNDVWL
Ga0207692_101776062	3300025898	Corn, Switchgrass And Miscanthus Rhizosphere	MKLIASIATDRSFKAISMLSCFGLAVSLGFMAYGMDLNAVWF
Ga0207692_102026782	3300025898	Corn, Switchgrass And Miscanthus Rhizosphere	MKTISMIASDRTFKAITALSCSGMALSFCLMAFGMDLTVAAI
Ga0207699_100827524	3300025906	Corn, Switchgrass And Miscanthus Rhizosphere	MKTISAIATDSAFKTLALMSCFGLALSFGLMAAGMDLSAVAL
Ga0207699_101848361	3300025906	Corn, Switchgrass And Miscanthus Rhizosphere	MKTISSIVTDRAFKAITIMSCCGLALSFCMVAFGMDLNAVWLFRDG
Ga0207707_1000317517	3300025912	Corn Rhizosphere	VKTISSIANDRAFKAITALSFFGLAVSFGMMAFGIDLSVLAL
Ga0207707_100605434	3300025912	Corn Rhizosphere	MKTISSIAADRSFMAITMLSCFGLAVSFCLMPFGMDLNNVWL
Ga0207707_101436204	3300025912	Corn Rhizosphere	MKTISMMASDRAFKAITALSCSGLVLSFCLMAFGVDLTVAAI
Ga0207695_103285023	3300025913	Corn Rhizosphere	MKTISSIAADRSFMAITMLSCFGLAVSFCLMAFGMDLNSVWL
Ga0207695_104060672	3300025913	Corn Rhizosphere	MKLIASIAADRSFKTISMLSVLGLVLSFGFIAYGMDLNAVWL
Ga0207649_105633742	3300025920	Corn Rhizosphere	LISSITADRSFKAIAMLSCFGLVVSLGLMACGMDLNAVWL
Ga0207700_105900252	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	MKTISSIANDRTFKTITALSILGLAVSFCMMAFGMDLSVLAL
Ga0207661_101104211	3300025944	Corn Rhizosphere	MGAIMKTISSIAADRSFMAITMLSCFGLAVSFCLMAFGMDLNSVWL
Ga0207661_119444332	3300025944	Corn Rhizosphere	MKTISAIATDSAFKTLAVMSCFGLALSFGLMAAGMDLSA
Ga0207667_104448281	3300025949	Corn Rhizosphere	ASDRAFKAITALSCSGLVLSFCLMAFGVDLTVAAI
Ga0207678_117633482	3300026067	Corn Rhizosphere	MQLISSITADRSFKAIAMLSCFGLVVSLGLMACGMDLNAVWL
Ga0207702_123888832	3300026078	Corn Rhizosphere	MKLIASIATDRSFETISMLSVLGLVASFGFIAYGMDLNAVWL
Ga0207698_104948541	3300026142	Corn Rhizosphere	VWANKKGGTMQLISSITADRSFKAIAMLSCFGLVVSLGLMACGMDLNAVWL
Ga0207698_110226342	3300026142	Corn Rhizosphere	MKMISSVAADRTFRAISMFSGFGLALSFCLMAAGADLTATWL
Ga0209073_102602392	3300027765	Agricultural Soil	MKTISSIAADHSFKAMMMLSCFGLAVSFGLMAFGMDLNSVWL
Ga0209074_102479952	3300027787	Agricultural Soil	MKTISSIVADRAFKAITTMSCFGLAVSFCMVAFGM
Ga0209112_102043771	3300027817	Forest Soil	MKLIASIATDRSFKAISMMSCLGLVLSFGFIASGMDLTVVWF
Ga0209060_104081982	3300027826	Surface Soil	MWANKKLGRVMKTISSIAADRAFKAMTTMSCLGLAVSFCMVAFGMDLNSVWL
Ga0209465_101807911	3300027874	Tropical Forest Soil	MLAADRAFKTISTISCLGLAVSFSMMAFGMDLSIGWL
Ga0170824_1070307471	3300031231	Forest Soil	MKTISMMASDRAFRAITALSCSGLALSFCLMAFGMDLTIGAI
Ga0170824_1158253071	3300031231	Forest Soil	MKTISMMASDRAFKAISAVSCGGLALSFCLMAFGMDLSVVAI
Ga0170824_1265956582	3300031231	Forest Soil	MKTISSIAADHSFRAMTMLSCLGLVVSFCLMAFGMDLNSVWL
Ga0307474_105575622	3300031718	Hardwood Forest Soil	MKLIASIATDRSFKAISMLSCFGLAVSFGLMAYGMDLNAVWF
Ga0306921_118000441	3300031912	Soil	MKTISEIAADHSFKAMTMLSCFGLAVSFCLMAFGVDLNSVWL
Ga0310912_105422223	3300031941	Soil	MKTISEIAADHSFKAMMLLSCFGLAVSFCLMAFGVDLNSVWL
Ga0307470_108083113	3300032174	Hardwood Forest Soil	MKLIASIATDRSFKAISMLSCFGLAVSFGLMAYGMDLN
Ga0335076_103216833	3300032955	Soil	MKTIASIAADHSFKAMFLLSFVGLVASFCLMASGMDLNSVWL
Ga0335084_103995373	3300033004	Soil	MKTISAIAADRTFKAITVLSCFGLALSFGMMAAGIDLSAVAL
Ga0310811_100101211	3300033475	Soil	MQLIASITADRSFKAIAMLSCFGLVVSLGLMACGMDLNAVWL

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F053596

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences