| Basic Information | |
|---|---|
| Family ID | F053575 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 141 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MLIRDIVARMRHDGCGGRAGKVELLTGIEGASSRPVRRILLIGG |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 141 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 25.40 % |
| % of genes near scaffold ends (potentially truncated) | 53.90 % |
| % of genes from short scaffolds (< 2000 bps) | 86.52 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (81.560 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (19.149 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.950 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.227 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 9.72% β-sheet: 0.00% Coil/Unstructured: 90.28% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 141 Family Scaffolds |
|---|---|---|
| PF01544 | CorA | 2.13 |
| PF11300 | DUF3102 | 2.13 |
| PF07568 | HisKA_2 | 1.42 |
| PF00239 | Resolvase | 1.42 |
| PF14361 | RsbRD_N | 1.42 |
| PF00216 | Bac_DNA_binding | 1.42 |
| PF07885 | Ion_trans_2 | 0.71 |
| PF01464 | SLT | 0.71 |
| PF00782 | DSPc | 0.71 |
| PF07883 | Cupin_2 | 0.71 |
| PF08241 | Methyltransf_11 | 0.71 |
| PF00999 | Na_H_Exchanger | 0.71 |
| PF14020 | DUF4236 | 0.71 |
| PF13358 | DDE_3 | 0.71 |
| PF03704 | BTAD | 0.71 |
| PF01526 | DDE_Tnp_Tn3 | 0.71 |
| PF13751 | DDE_Tnp_1_6 | 0.71 |
| PF07589 | PEP-CTERM | 0.71 |
| PF03992 | ABM | 0.71 |
| PF07750 | GcrA | 0.71 |
| PF02371 | Transposase_20 | 0.71 |
| PF04986 | Y2_Tnp | 0.71 |
| PF07681 | DoxX | 0.71 |
| PF05443 | ROS_MUCR | 0.71 |
| PF12680 | SnoaL_2 | 0.71 |
| PF13592 | HTH_33 | 0.71 |
| PF03976 | PPK2 | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 141 Family Scaffolds |
|---|---|---|---|
| COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 2.13 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 1.42 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 1.42 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 1.42 |
| COG3920 | Two-component sensor histidine kinase, HisKA and HATPase domains | Signal transduction mechanisms [T] | 1.42 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.71 |
| COG5352 | Uncharacterized conserved protein | Function unknown [S] | 0.71 |
| COG4957 | Predicted transcriptional regulator | Transcription [K] | 0.71 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.71 |
| COG4644 | Transposase and inactivated derivatives, TnpA family | Mobilome: prophages, transposons [X] | 0.71 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.71 |
| COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.71 |
| COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.71 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.71 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.71 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.71 |
| COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 0.71 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.71 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 81.56 % |
| All Organisms | root | All Organisms | 18.44 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 19.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.44% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.26% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.55% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.84% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.13% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.13% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.13% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.13% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.13% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.13% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.13% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.13% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.42% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.71% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.71% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.71% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.71% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.71% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.71% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.71% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.71% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.71% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.71% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.71% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.71% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908009 | Soil microbial communities from sample at FACE Site Metagenome WIR_Amb2 | Environmental | Open in IMG/M |
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
| 3300024249 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17 | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FWIRA_02163680 | 2124908009 | Soil | MRIRDIIARMRHDGCGGRAGKVELLTGVEGASSRPVRRIY |
| F62_06378270 | 2170459010 | Grass Soil | APRSDLPIREILKRMRHDGCGGQPGRVELLTGIKGASSRPVRRIVLVDG |
| JGI1027J12803_1040652101 | 3300000955 | Soil | MAGRTLRQILSRMRHDGCGGRPGKAELLTGIEGVSCRPVRRIVLL |
| Ga0062386_1015792281 | 3300004152 | Bog Forest Soil | MLIRDTTTRMRHDGCGGLAGKAELLTGIEGASSRPVRKIVLIDS* |
| Ga0062589_1009422002 | 3300004156 | Soil | TLFDILRRMRHDGCGGLAGKAELLTGIAGVSSRPVRKIALLSRDS* |
| Ga0062388_1007739751 | 3300004635 | Bog Forest Soil | SAQRSMLIRDIIAKMRHDGCGGRAGKAELLSGIEGVSSRPVRRIVLREG* |
| Ga0070689_1021998621 | 3300005340 | Switchgrass Rhizosphere | ALPIRDILDRMRHDGCGGRAGKAVLLTGIEGVTARPVRQIVLREG* |
| Ga0070709_103321051 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | APHRDMPIREIIKRARHDGCGGRAGKVELMTGIDGSSRPVRRIVLLDG* |
| Ga0070714_1006025643 | 3300005435 | Agricultural Soil | MPLRALLAKMRHDGCGGRPGRAELLPGIDGASSRPVRKIVVLEG* |
| Ga0070714_1018584491 | 3300005435 | Agricultural Soil | DMPIRVLLARARHEGCGGRAGRAELLTGIEGVSSRPVRRILLCEG* |
| Ga0070714_1018595451 | 3300005435 | Agricultural Soil | QRALPLRDFLARMRHDGCGGRAGKVELITGIDGASSRPVRKIVLRAE* |
| Ga0070713_1008900521 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MPIRAIIKRARHDGCGGRAGKVELMTGIEGSSRSARKIVVIDG* |
| Ga0070713_1020242852 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LPIRDFLARMRHDGCGGLAAKAELLTGIEGANSRPVRKIVLRSD* |
| Ga0070713_1023949021 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | AQRDRTLRDLIAWMRHDGCGGRAGKVELMTGIDGASSRPVRKIVLRAE* |
| Ga0070711_1001418182 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MRWDNMRIRDIIAKMRHDGCGGGADRAELIASIEGMSSRPVRQQF* |
| Ga0070711_1005813373 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MRCDNLPIRDIVAKMRHDGCGGRAGRVELLTGIEGASSRPVRKIVLQ* |
| Ga0070711_1013232441 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MPIRDFISKMRHDGCVGRAGRVELLTGIEAASSRPVRKIVLIGG* |
| Ga0070711_1014277582 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MPIREIIKRARHDGCGGRAGKVELMTGIDGSSRPVRRIVLLDG* |
| Ga0070731_102661113 | 3300005538 | Surface Soil | MLIRDILDRMRHGGCGGRAGRAELLTGIEGVSSRPVRRILLQEG* |
| Ga0070732_109865581 | 3300005542 | Surface Soil | RGILAKMRHDGCGGRPGRAELITGIEAPSSRPVRKIVLING* |
| Ga0070693_1012692412 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | QRAMPIREIIAKMRHDGCDGRAGWVELLTGIEGASSRPVRRIVLRDG* |
| Ga0070664_1023529021 | 3300005564 | Corn Rhizosphere | MRTILAHMRHGGCGGQPAKAELLTGIDGVSSRPVRRVVLLG* |
| Ga0066903_1048591632 | 3300005764 | Tropical Forest Soil | MLRDILDRMRHDGCGGLAGKAELMTGIEAVSLRPVRRIVLRDER* |
| Ga0068860_1017046522 | 3300005843 | Switchgrass Rhizosphere | VHTPERQRAMPIRDFISKMRHDGCVGRAGQVELLTGIEAASSRPVRKIVLIGG* |
| Ga0070717_105661192 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | PHRDMPIREIIKRARHDGCGGRAGKVELLTGIDGASSRPVRKIVLRAGVTG* |
| Ga0070717_120037282 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | HMPIRDILDRMRHDGCGGRAGKAELVTGIEGASSRPVRRIVLRES* |
| Ga0075028_1009028933 | 3300006050 | Watersheds | MPLRVLLARMRHDGCAGISGKAQLLTGIEGLSSCPGRRIVLLG* |
| Ga0075028_1010037861 | 3300006050 | Watersheds | PQRDMLIREIIKLMRHAGCGGRASKVELITGIEGVSSRPVRKIVLRPG* |
| Ga0075030_1012936631 | 3300006162 | Watersheds | RDIIAKMRHDGCGGRPGRAELLTGIEGVSSRPVRRIVVLDG* |
| Ga0070715_109448412 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | PIREIIKRARHDGCGGRAGKVELMTGIDGSSRPVRRIVLLDG* |
| Ga0070716_1007284372 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LLPIREIIKRARHDGCGGRAGKVELMTGIDGSSRPVRRIVLLDG* |
| Ga0070712_1001349495 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | DILAKMRHDGCGGLAGKAELLTGIEGVSSRPVRRILLCEG* |
| Ga0070712_1007036362 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | DNLPIRDIIAKMRHDGCGGRAGRVELLTGIEGASSRPVRKIVLQ* |
| Ga0070712_1011295811 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RTMRIRDIIEKMRHDGCGGRAEKVELLSGIEGVSSQPVRKIVLREG* |
| Ga0070712_1013416881 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | DMPIREIIKRARHDGCGGRAGKVELLTGIDGASSRPVRKIVLRVE* |
| Ga0079222_110120631 | 3300006755 | Agricultural Soil | DMPIREIIKRARHDGCGGRAGKVELMTGIDGSSRPLRRIVVRAD* |
| Ga0075424_1026447281 | 3300006904 | Populus Rhizosphere | YLPLREILKRARHDGCGGRPGRAELLTGLTGASSRPVRKIVLVQ* |
| Ga0105245_113809261 | 3300009098 | Miscanthus Rhizosphere | PIRDIIARMPHDGCGGKAGKAELLTGIEGVSSLPVRKIVLLA* |
| Ga0105247_103020322 | 3300009101 | Switchgrass Rhizosphere | MRSLRPIRDILARMRHDGCGGPPGKAELLTGIEGVSGRPVWKIMLRER* |
| Ga0105247_108976641 | 3300009101 | Switchgrass Rhizosphere | MPLRVVIAWMRHDGCGGRAGKVELMTGIDGASSRPVRKIVLRVE* |
| Ga0105241_103282941 | 3300009174 | Corn Rhizosphere | KVHTPERQRAMPIRDFISKMRHDGCVGRAGQVELLTGIEAASSRPVRKIVLIGG* |
| Ga0105242_106942443 | 3300009176 | Miscanthus Rhizosphere | MPIRDFISKMRHDGCVGRAGQVELLTGIEAASSRPVRKIVLIGG* |
| Ga0105242_112934121 | 3300009176 | Miscanthus Rhizosphere | LLQRAVTLRNLLDHMRHDGCGGRPGRVELLTGIEGVSSRPVRRIVLREG* |
| Ga0105248_106049051 | 3300009177 | Switchgrass Rhizosphere | PIREIIAKMRHDGCDGRTEWVELLTDIEGASSRPVRRIVLRDR* |
| Ga0105237_104616403 | 3300009545 | Corn Rhizosphere | ILGKMRHDGCGGLAGEAELLTGIEGASSRPVRRIVLLG* |
| Ga0105238_105969351 | 3300009551 | Corn Rhizosphere | ARQRAMPIRDIIAKMRHDGGGGRAGRRVELLTGIEAARSRPVRRIVLRAG* |
| Ga0126373_107894972 | 3300010048 | Tropical Forest Soil | LLSDILKRMRHDGCGGHALKADLLTGIEGASSRPVRRIVLRVR* |
| Ga0126376_112864921 | 3300010359 | Tropical Forest Soil | LRDLLARVRVHHEGCGGRMKVELLTGIESVSSRPVRRIVLRGG* |
| Ga0126378_109057852 | 3300010361 | Tropical Forest Soil | MSDILKRMCHDGCGGRPARAELMTGIEASSSRPVRRIVLKDDR* |
| Ga0126378_121712852 | 3300010361 | Tropical Forest Soil | MPIRFLLARVRHDGCGGRAMRAELLTGIDGVSSRPVRKIVVLSDT* |
| Ga0134128_131859541 | 3300010373 | Terrestrial Soil | PLRDLLAKLRHDGCGGRAGRAELLTGIEGASSRPVRKIVLRDR* |
| Ga0105239_112374771 | 3300010375 | Corn Rhizosphere | MSIREIIKRMRHDGCGGLASKAELLTGIDDASSRPVRKIVLRAE* |
| Ga0126381_1002776404 | 3300010376 | Tropical Forest Soil | MRIHDIIAKMRHNGCGGRPGRVELLTGVEGASSRPVRKIVVLDG* |
| Ga0126381_1006925852 | 3300010376 | Tropical Forest Soil | MPIRVLLACVRHDGCGGRAMRAELLTGIDGVSSRPVRKIVVLSDT* |
| Ga0126381_1008930771 | 3300010376 | Tropical Forest Soil | MTRGDMPIRTILARMRHDGCGGRAGKAELLSGIEGVSRRPVRKIVLRQ* |
| Ga0126381_1012014831 | 3300010376 | Tropical Forest Soil | TKLRGRPLSEVLARMRHDGCGGLPGKAELLSGIDGVSSQPVRRIALLR* |
| Ga0126381_1020523252 | 3300010376 | Tropical Forest Soil | MFNVLARMRHDGCGGHAEAELPTGIEAASSRPVRRIVLMGEKRT* |
| Ga0126381_1021122462 | 3300010376 | Tropical Forest Soil | MPIREILDRMRHDGCGGRAGKAELLTSIEGASSRPVQKIRLRDG* |
| Ga0126381_1027723532 | 3300010376 | Tropical Forest Soil | MPLRALLARMRHDSCGGRPARVELLTGIDGVSSEPVRRIVLREG* |
| Ga0126381_1037395762 | 3300010376 | Tropical Forest Soil | MLIRDILAKMRHDGCGGRPGRVELLTGIKGASSRPVRKIVVLGG* |
| Ga0134126_129904281 | 3300010396 | Terrestrial Soil | MRIRDIITRMRHDGCGGRAGRAELLTGIEAASSRPVRKIVLFG* |
| Ga0134127_129922871 | 3300010399 | Terrestrial Soil | MKRGAMPIRDIIARMPHNGCGGRAGKAELLTGIEGVSIRPVRKITLVGG* |
| Ga0126350_109536214 | 3300010880 | Boreal Forest Soil | SFLQYQRSMRIRDIIEKKRHDGCGGRAEKVELLSGIEGVSNRPVRRIVLLG* |
| Ga0150983_161291984 | 3300011120 | Forest Soil | TAHRNLPIRTILAKMHHDGCGGRAGRVELLTGIEGASSRPVRKIVLLG* |
| Ga0150985_1069518852 | 3300012212 | Avena Fatua Rhizosphere | MRTRDIIARMRHDGCGGRAGKVELLTGIEGASSWR |
| Ga0164303_100273785 | 3300012957 | Soil | MLIRDILAKMRHDGCGGRAGKVELLTGIEAASSRVRKILLLHG* |
| Ga0164301_106409632 | 3300012960 | Soil | RAILAKMRHDGCGGLAAKAELLTGVEGVNSRPVRKIVLRAD* |
| Ga0164304_114761762 | 3300012986 | Soil | PLRALLAKMRHDGCGGRPGRAELLPGIDGASSRPVRKIVVLEG* |
| Ga0157375_100909481 | 3300013308 | Miscanthus Rhizosphere | IIARMRHDGCGGRVGEAELLTGIESASSRPVRKIVLLSVS* |
| Ga0163163_120513581 | 3300014325 | Switchgrass Rhizosphere | RSDMPLRVVIAWMRHDGCGGRAGKVELMTGIDGASSRPVRKIVLRAD* |
| Ga0132256_1016401693 | 3300015372 | Arabidopsis Rhizosphere | LREIIARMRHDGCGGRAGTVGLVTGVDVTSSRPVRKIVLRSD* |
| Ga0132255_1003808853 | 3300015374 | Arabidopsis Rhizosphere | AMPIRDIIARIPHNGCGGRAGRAELLTGIEGVSIRPVRRIVLLG* |
| Ga0182036_111280061 | 3300016270 | Soil | LADILHRMRHDGCGGQAARAELLTGIEAASSRPVRRIVLRAGER |
| Ga0182035_115859771 | 3300016341 | Soil | ILARMRHDGCGGRAGKAEELLTGLEGVSSRSVRRIVLLADWRGR |
| Ga0182040_114902912 | 3300016387 | Soil | VSLVAHPGDLLACMRHDGCGGLPGRAELLTGVEGASSRPVRRIVLRAG |
| Ga0210407_103616662 | 3300020579 | Soil | MLIRDILDRMRHDGCGGRAGRVELLTGIDGSSRPLRRVVLRDGGSDRGSL |
| Ga0210407_104081861 | 3300020579 | Soil | WPSRRKCPRQLLARMRHDGCGGRAGQVELLTGIDEVSSRPVRRIVLLAG |
| Ga0210395_104768871 | 3300020582 | Soil | MRWDNLPIRTILDRMLHDGCGGRAGRVELLAGIEGASSRPVRKIALPAAGR |
| Ga0210401_111393332 | 3300020583 | Soil | MLIRDIIELMRRAGCGGRASKVELISGIEGASSRPVRRILLLG |
| Ga0210405_105802701 | 3300021171 | Soil | RDLPIRDIIAKIRHDGCGGRAGKVELVTGLAGASSRPVRKITLIQG |
| Ga0210408_111901981 | 3300021178 | Soil | IAKMRYDACGGRAGRVELLTGIEGASSQPIRKITLIEG |
| Ga0210397_101081908 | 3300021403 | Soil | MLIRDILDRMRHGGCGGRAGRAELLTGIEGVSSRPVRRI |
| Ga0210389_114381851 | 3300021404 | Soil | MFNEAHSSQRSMLIRDIIAKMRHDGCGGMAEKVELLSGIEGVSSRPVRKIVLIDR |
| Ga0210387_104576881 | 3300021405 | Soil | IRDIIEKMRHDGCGGMAEKVELLSGIEGVSSRPVRKIVLRDG |
| Ga0210387_109699681 | 3300021405 | Soil | VPIRAILAKMRHDGCGGLAGKAELLTGIEGVSSRPVRKIVLQEG |
| Ga0210383_117011471 | 3300021407 | Soil | MTAQRSMLIRDILDKMRHDGCGGRAGKAELLTGIEGVSGRPVRRI |
| Ga0210392_101724511 | 3300021475 | Soil | MTADQTTLRLIAKMRHDGCSGRAGQVELLTGIEGASSRSVRRIVLREG |
| Ga0210392_104828422 | 3300021475 | Soil | ALPVRDILDKMRHDGCGGRAGKAELLTGIEGVSSRPVRRIVLREG |
| Ga0210392_105076281 | 3300021475 | Soil | LRGRDAERGAHRDLPIRTILDRMRHDGGGRAGEVELLTGIEGASSRPVRKITVREG |
| Ga0210392_105353323 | 3300021475 | Soil | AHLWCDDMPIRDILDKMRHDECGGKSGRAELLTGIDGAASRPVRRIVLPAAP |
| Ga0210392_114453203 | 3300021475 | Soil | REMSIRGIIAKMSHDGCGGMAARVELLTGIEGASSRPVWKIALIDG |
| Ga0210398_105157351 | 3300021477 | Soil | HAAQRDMLIRNIIAKIRHDGYGGRAGKAELLTGIEGASSRPVPKIVLRDG |
| Ga0210410_110125921 | 3300021479 | Soil | EPARGDMLIRDIIARMRHDGCGGRPGRVELVTSVDGASSLPVRRIAILQG |
| Ga0126371_122501691 | 3300021560 | Tropical Forest Soil | HMALRVILNRMRHDGCGGRAGKAELLTGIEGVSSRPVRKIVVRVD |
| Ga0212123_107127142 | 3300022557 | Iron-Sulfur Acid Spring | PQRDMLIRDIIKRMRHDGCGGRPGKVELLTGIEGASSRPVRRIVLLGG |
| Ga0222622_107955671 | 3300022756 | Groundwater Sediment | MLIRDIVARMRHDGCGGRAGKVELLTGIEGASSRPVRRILLIGG |
| Ga0247664_10746291 | 3300024232 | Soil | MLIRDIIAKMRHDGCGGRAGKVELLSGIEGVSSRPVRRIV |
| Ga0247676_10308511 | 3300024249 | Soil | IRDIIEKMRHDGCGGRAEKVELLSGIEGVSSRPVRTIVLREG |
| Ga0247668_10479222 | 3300024331 | Soil | AKSDLPLRDILAKMRHDGCGGLAGKAELLTGIEGVSSRPVRRIVLREG |
| Ga0208219_11093193 | 3300025625 | Arctic Peat Soil | MLIRNILDKMRHDGCGGRAGRAELLTGIEGVSSRPVRNI |
| Ga0207692_102273112 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLRALLAKMRHDGCGGRPGRAELLPGIDGASSRPVRKIVVLEG |
| Ga0207680_111183421 | 3300025903 | Switchgrass Rhizosphere | MPIRDFISKMRHDGCVGRAGQVELLTGIEAASSRP |
| Ga0207685_101556762 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | LLPIREIIKRARHDGCGGRAGKVELMTGIDGSSRPVRRIVLLDG |
| Ga0207699_102063791 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MNEVHAPHRDMPIREIIKRARHDGCGGRAGKVELMTGIDGSSRPVRRIVLLDG |
| Ga0207699_104876442 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | AAQRALPLRDFLARMRHDGCGGRAGKVELITGIDGASSRPVRKIVLRAE |
| Ga0207699_107259291 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | LPIRDFLARMRHDGCGGLAAKAELLTGIEGANSRPVRKIVLRAE |
| Ga0207671_109000551 | 3300025914 | Corn Rhizosphere | MPIRDFISKMRHDGCVGRAGQVELLTGIEAASSRPVRKIVLIGG |
| Ga0207693_104015701 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | EAHTAHRDLPIRTILDRMRHDGRGGRAARVELLTGIEGASSRPVRKIVLQ |
| Ga0207693_104411761 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | AMTLRDLLSHMRHDGCGGRARRRSFTDIEAASSRPVRRILLREE |
| Ga0207693_107575851 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | IRTILARMRHDGCGGRAGRVELLTGIEGASSRPVRKITLIEG |
| Ga0207700_114267251 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | RAMSLLPIREIIKRARHDGCGGRAGKVELMTGIDGSSRPVRRIVLLDG |
| Ga0207700_116980532 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MPIRAIIKRARHDGCGGRAGKVELMTGIEGSSRSARKIVVIDG |
| Ga0207664_115297162 | 3300025929 | Agricultural Soil | QRALPLRDFLARMRHDGCGGRAGKVELITGIDGASSRPVRKIVLRAE |
| Ga0207704_111779361 | 3300025938 | Miscanthus Rhizosphere | MPIRDFISKMRHDGCVGRAGQVELLTGIEAASSRPVRKIVLIG |
| Ga0207703_108714821 | 3300026035 | Switchgrass Rhizosphere | MPIREIIAKMRHDGCGGRVGRVELLTGIEAASSRLVRKIVLRDG |
| Ga0207702_116041121 | 3300026078 | Corn Rhizosphere | MPIRYIIARMRHDGCGGRAGRAELLTGIEAASSRPVRKILLLDG |
| Ga0209579_103026222 | 3300027869 | Surface Soil | MLIRDILDRMRHGGCGGRAGRAELLTGIEGVSSRPVRRILLQEG |
| Ga0209275_107856871 | 3300027884 | Soil | RGTMLLRVLIGRMRHDGCGGRAGRVELLTGIDGVSSRPVRRIVLIAG |
| Ga0268264_117082002 | 3300028381 | Switchgrass Rhizosphere | MPIRDFIPKMRHDGCVGRAGQVELLTGIEAASSRPVRKIVLIGG |
| Ga0307291_11394732 | 3300028707 | Soil | MLIRDIIPRMRHDGCGGRAGKVELLTGIEGVSSRPVRRIVLVGQ |
| Ga0307315_101437782 | 3300028721 | Soil | MLIRDIIARMRHDGCGGLPGRAELLTGIEGASSRPVRRIMLLLGE |
| Ga0307280_102697421 | 3300028768 | Soil | IRDILYRMRHDGCGGRPGRVELLTGIEGASSRPVRRIVLIGG |
| Ga0307280_102857833 | 3300028768 | Soil | MLIRDIIKRMRHDGCGGLPGRAELLTGIEGASSRPVR |
| Ga0308309_113136111 | 3300028906 | Soil | LADILGRMRHDGCGGIAGKAELLTGIEGASSRPVRRIVLRA |
| Ga0308309_115776102 | 3300028906 | Soil | MPIRDIIAKMRHDGCGGGAGKVELITGIEGASNRPVRRIVLCAGGQGSVAEE |
| Ga0170834_1113121813 | 3300031057 | Forest Soil | EISLRALLARMRHDGCGGLPGKAELLTGAEGVSSRPVRKIVLMG |
| Ga0308201_103398081 | 3300031091 | Soil | RSDVPIRDIIARMRHDGCGGRAGKAELLTGIEGASSRPVRRIAVVDTQF |
| Ga0170823_156667972 | 3300031128 | Forest Soil | MLIRDIIARMRHDGCGGREGKVELLIGIEGARSRPVRTILLIEG |
| Ga0170824_1134295511 | 3300031231 | Forest Soil | MTADQTTLRLIAKMRHDGCSGRAGQVELLTGIEGGSSRSVRRIVLREG |
| Ga0310686_1182804782 | 3300031708 | Soil | LRDILDRARHEGCGGRAGRVELVIGIAATSSRPVRRIVLRDQ |
| Ga0310917_107601992 | 3300031833 | Soil | MLIGAIIAKMRHDGCGGLPGRAELLTGIEGASSRPVRRIVLRETWFM |
| Ga0318520_110333421 | 3300031897 | Soil | LLSDILKRMRHDGCGGRALKAELLTGIEGASSRPVRRIVLWEG |
| Ga0306926_112855161 | 3300031954 | Soil | RAMPIRYIIATMRHDGCGGRPGRVELITGIEGASSRPC |
| Ga0306922_114403803 | 3300032001 | Soil | GSLTLRVLIARMRHEGCGGGAGRVELTGIDGVSSRPVRRIVLRAG |
| Ga0318562_101666932 | 3300032008 | Soil | DMLIRAIIAKMRHDGCGGLLGRVEPLTGIEGASSRPVRRIVLRG |
| Ga0318563_105946511 | 3300032009 | Soil | MILRVLISGMRHEGCGGRAGKVELLTGIEGVYSRPVRRIVLRDG |
| Ga0310911_101074852 | 3300032035 | Soil | EGHAVCDMLIRAIIAKMRNDGCGGLPGRAELLTGVEGVSSRPVRRIVLRAG |
| Ga0307470_108932913 | 3300032174 | Hardwood Forest Soil | IRDIVAKMRHDGCGGRAGRVELLTGIEGASSRPVRKIVLQ |
| Ga0306920_1029119141 | 3300032261 | Soil | MTVERAMPIRDIIAKMRHDGCGGRPGRVELITGIEGASSRPC |
| Ga0335084_113243822 | 3300033004 | Soil | MVRRLARMRHDGCGGLPGKAELPTGIEGASSQPVRRIVLIGA |
| Ga0310811_109232583 | 3300033475 | Soil | VIRDITAKMRHDGCGGSSGKVELITGIEGTSSRPVRRIVLING |
| ⦗Top⦘ |