| Basic Information | |
|---|---|
| Family ID | F053531 |
| Family Type | Metagenome |
| Number of Sequences | 141 |
| Average Sequence Length | 48 residues |
| Representative Sequence | VFRQTSRGTAVILTTGICDRATATLSLDDLAKVRAMIQEAKSRLDEIR |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 141 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.71 % |
| % of genes near scaffold ends (potentially truncated) | 97.87 % |
| % of genes from short scaffolds (< 2000 bps) | 88.65 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.63 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.489 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (14.184 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.355 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (63.830 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.63% β-sheet: 13.16% Coil/Unstructured: 59.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.63 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 141 Family Scaffolds |
|---|---|---|
| PF10569 | Obsolete Pfam Family | 9.93 |
| PF07678 | TED_complement | 7.09 |
| PF01476 | LysM | 1.42 |
| PF13365 | Trypsin_2 | 1.42 |
| PF13614 | AAA_31 | 0.71 |
| PF02119 | FlgI | 0.71 |
| PF10707 | YrbL-PhoP_reg | 0.71 |
| PF04909 | Amidohydro_2 | 0.71 |
| PF07687 | M20_dimer | 0.71 |
| PF01230 | HIT | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 141 Family Scaffolds |
|---|---|---|---|
| COG1706 | Flagellar basal body P-ring protein FlgI | Cell motility [N] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.49 % |
| Unclassified | root | N/A | 8.51 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000891|JGI10214J12806_12748561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300000956|JGI10216J12902_124432060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300003999|Ga0055469_10266151 | Not Available | 549 | Open in IMG/M |
| 3300004114|Ga0062593_101139535 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300004114|Ga0062593_102411141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300004157|Ga0062590_102599164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300004643|Ga0062591_100830244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
| 3300005290|Ga0065712_10502746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300005331|Ga0070670_100121990 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2248 | Open in IMG/M |
| 3300005331|Ga0070670_100763529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 872 | Open in IMG/M |
| 3300005332|Ga0066388_106653209 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300005343|Ga0070687_100102948 | All Organisms → cellular organisms → Bacteria | 1602 | Open in IMG/M |
| 3300005365|Ga0070688_101328323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300005434|Ga0070709_10753999 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300005441|Ga0070700_100029670 | Not Available | 3263 | Open in IMG/M |
| 3300005518|Ga0070699_100510087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1093 | Open in IMG/M |
| 3300005546|Ga0070696_100673406 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 841 | Open in IMG/M |
| 3300005546|Ga0070696_100801668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300005546|Ga0070696_101180440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300005546|Ga0070696_101607107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300005547|Ga0070693_101162315 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300005560|Ga0066670_10167524 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1298 | Open in IMG/M |
| 3300005564|Ga0070664_100643893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 985 | Open in IMG/M |
| 3300005577|Ga0068857_100672703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 982 | Open in IMG/M |
| 3300005577|Ga0068857_100688059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 971 | Open in IMG/M |
| 3300005577|Ga0068857_101060474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
| 3300005577|Ga0068857_101304405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300005577|Ga0068857_102033043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300005578|Ga0068854_101802658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300005615|Ga0070702_100902422 | Not Available | 692 | Open in IMG/M |
| 3300005617|Ga0068859_100597789 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1196 | Open in IMG/M |
| 3300005617|Ga0068859_100898433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 970 | Open in IMG/M |
| 3300005617|Ga0068859_101093440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 877 | Open in IMG/M |
| 3300005617|Ga0068859_101486897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
| 3300005618|Ga0068864_100781907 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300005618|Ga0068864_101480861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300005618|Ga0068864_101602431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300005618|Ga0068864_101792998 | Not Available | 619 | Open in IMG/M |
| 3300005719|Ga0068861_102303804 | Not Available | 540 | Open in IMG/M |
| 3300005841|Ga0068863_100683113 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1020 | Open in IMG/M |
| 3300005842|Ga0068858_101779746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300005843|Ga0068860_101672056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
| 3300005844|Ga0068862_100350431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1370 | Open in IMG/M |
| 3300005844|Ga0068862_101499688 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300005844|Ga0068862_101879262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300006169|Ga0082029_1742038 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300006755|Ga0079222_12428355 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300006794|Ga0066658_10453765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300006806|Ga0079220_10903615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300006852|Ga0075433_10218793 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1692 | Open in IMG/M |
| 3300006853|Ga0075420_101005207 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300006871|Ga0075434_100390954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1412 | Open in IMG/M |
| 3300006904|Ga0075424_101172227 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 818 | Open in IMG/M |
| 3300006954|Ga0079219_10862905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300006969|Ga0075419_10243882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1199 | Open in IMG/M |
| 3300007004|Ga0079218_10424405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1143 | Open in IMG/M |
| 3300009093|Ga0105240_12718872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300009094|Ga0111539_11311864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
| 3300009098|Ga0105245_11271390 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
| 3300009101|Ga0105247_10062844 | All Organisms → cellular organisms → Bacteria | 2304 | Open in IMG/M |
| 3300009101|Ga0105247_11710169 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300009147|Ga0114129_11589376 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
| 3300009147|Ga0114129_11627405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300009148|Ga0105243_12222855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300009156|Ga0111538_10651347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1335 | Open in IMG/M |
| 3300009162|Ga0075423_11224859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
| 3300009162|Ga0075423_11340356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
| 3300009174|Ga0105241_10959174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
| 3300009174|Ga0105241_11247944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
| 3300009176|Ga0105242_10146782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2053 | Open in IMG/M |
| 3300009176|Ga0105242_11938383 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300009176|Ga0105242_12763715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300009551|Ga0105238_10811153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 952 | Open in IMG/M |
| 3300010038|Ga0126315_10665465 | Not Available | 677 | Open in IMG/M |
| 3300010039|Ga0126309_11016273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300010043|Ga0126380_10635033 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300010044|Ga0126310_10847338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300010044|Ga0126310_11414930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300010045|Ga0126311_10105726 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1940 | Open in IMG/M |
| 3300010047|Ga0126382_10711797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
| 3300010373|Ga0134128_12252613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300010397|Ga0134124_10257907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1607 | Open in IMG/M |
| 3300010397|Ga0134124_10580897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1095 | Open in IMG/M |
| 3300010397|Ga0134124_10923131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
| 3300010397|Ga0134124_11454818 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300010397|Ga0134124_12715392 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300010399|Ga0134127_10374883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1398 | Open in IMG/M |
| 3300010400|Ga0134122_10099923 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2296 | Open in IMG/M |
| 3300010401|Ga0134121_11545510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
| 3300010403|Ga0134123_10108865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2222 | Open in IMG/M |
| 3300010403|Ga0134123_10500562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1143 | Open in IMG/M |
| 3300010403|Ga0134123_12830308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300011119|Ga0105246_11103372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300012469|Ga0150984_102536330 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300012899|Ga0157299_10295384 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300012918|Ga0137396_10154485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1673 | Open in IMG/M |
| 3300012948|Ga0126375_10036997 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2484 | Open in IMG/M |
| 3300012948|Ga0126375_12020761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300013100|Ga0157373_10012870 | Not Available | 6144 | Open in IMG/M |
| 3300013306|Ga0163162_11479002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
| 3300013308|Ga0157375_11579627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300014326|Ga0157380_11741360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
| 3300014745|Ga0157377_10473236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
| 3300014968|Ga0157379_10033289 | All Organisms → cellular organisms → Bacteria | 4597 | Open in IMG/M |
| 3300014968|Ga0157379_10621861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1009 | Open in IMG/M |
| 3300015372|Ga0132256_100426525 | Not Available | 1430 | Open in IMG/M |
| 3300018081|Ga0184625_10116887 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1384 | Open in IMG/M |
| 3300025735|Ga0207713_1188747 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300025918|Ga0207662_11314583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300025923|Ga0207681_11165574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300025925|Ga0207650_10035828 | All Organisms → cellular organisms → Bacteria | 3606 | Open in IMG/M |
| 3300025925|Ga0207650_10490067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1026 | Open in IMG/M |
| 3300025926|Ga0207659_11066757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300025931|Ga0207644_10900177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300025934|Ga0207686_10373046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1080 | Open in IMG/M |
| 3300025934|Ga0207686_11075992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300025938|Ga0207704_10269917 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
| 3300025941|Ga0207711_11260034 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300025960|Ga0207651_10065245 | All Organisms → cellular organisms → Bacteria | 2553 | Open in IMG/M |
| 3300025961|Ga0207712_10003711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 9637 | Open in IMG/M |
| 3300026035|Ga0207703_11663174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300026075|Ga0207708_10080175 | All Organisms → cellular organisms → Bacteria | 2508 | Open in IMG/M |
| 3300026095|Ga0207676_11293015 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300026095|Ga0207676_11590446 | Not Available | 651 | Open in IMG/M |
| 3300027775|Ga0209177_10245529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300027787|Ga0209074_10252621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300027886|Ga0209486_10970497 | Not Available | 569 | Open in IMG/M |
| 3300027909|Ga0209382_10911928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 924 | Open in IMG/M |
| 3300028380|Ga0268265_10217552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1669 | Open in IMG/M |
| 3300028381|Ga0268264_11927521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300030510|Ga0268243_1185284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300031548|Ga0307408_102481968 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300031716|Ga0310813_11159206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300031731|Ga0307405_10531668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 948 | Open in IMG/M |
| 3300031852|Ga0307410_11352232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300031908|Ga0310900_10020334 | All Organisms → cellular organisms → Bacteria | 3492 | Open in IMG/M |
| 3300032000|Ga0310903_10630764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300032004|Ga0307414_12149244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300032075|Ga0310890_10032484 | Not Available | 2828 | Open in IMG/M |
| 3300033412|Ga0310810_10338179 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1592 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 14.18% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 8.51% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.51% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.09% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.67% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.96% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.84% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.13% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.13% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.13% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.42% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.71% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.71% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.71% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.71% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.71% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030510 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10214J12806_127485612 | 3300000891 | Soil | MSTGICNRATTSLSLDDLAKVRAMIQEAKARLDEIR* |
| JGI10216J12902_1244320602 | 3300000956 | Soil | FRQTRSGNAVIMSTGICNRATTAMTLDDLAKVKAMIQEAKARLDELR* |
| Ga0055469_102661511 | 3300003999 | Natural And Restored Wetlands | LELGVFRQTRRGTAAMMTTGICDRASQLLTLDELAKVKAMIQEAKMRLDELR* |
| Ga0062593_1011395352 | 3300004114 | Soil | TGTAVIMSTGICDRATATLSLDDLGKVRAMIQEAKSRLDEIR* |
| Ga0062593_1024111412 | 3300004114 | Soil | AVILTTGICDRATATLSLDDLAKVRALIQEAKARLDEIR* |
| Ga0062590_1025991641 | 3300004157 | Soil | IGVFRQTRSGTAVVIQTGICDRTTQTLSLDDLAKVKAIIQEAKSRLDDIK* |
| Ga0062591_1008302442 | 3300004643 | Soil | TRSGTAVMIRSGICDRTTQTLSLDDLAKVKAMIQEAKSRLDDIK* |
| Ga0065712_105027462 | 3300005290 | Miscanthus Rhizosphere | RSGTAVSIQTGICEPAIQGISLDDLAKVKAMIQEAKTRLDDLR* |
| Ga0070670_1001219901 | 3300005331 | Switchgrass Rhizosphere | YKTQGDLEIGVFRQTRSGTAVIMQTGICDRATGTLTLDDLAKVKAMIQEAKARLDEIR* |
| Ga0070670_1007635292 | 3300005331 | Switchgrass Rhizosphere | QTSRGTAVVLSTGICDRATTSLSLDDLAKVRAMIQEAKARLDEIR* |
| Ga0066388_1066532091 | 3300005332 | Tropical Forest Soil | AVTLSTGICDRVTGTLTLDDLAKVRAMIQEAKSRLDELGR* |
| Ga0070687_1001029482 | 3300005343 | Switchgrass Rhizosphere | LGDLELNVFKQTRSGTAVIVTTGICDHAKANLSLDDLAKIKAMIQEAKQRLDEIR* |
| Ga0070688_1013283232 | 3300005365 | Switchgrass Rhizosphere | IGVFRQTRRGAAALMTTGICDRASQLLTLDELAKVKAMIQEAKMRLDELR* |
| Ga0070709_107539992 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | KTLGDLEIGIFRQTRSGTAVALTTGICERPTQAMTLDDLAKVKAMIQEAKSRLDEIR* |
| Ga0070700_1000296701 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | VAVFRQTRSGNAVIISTGICDRATQTLSLDDLAKVKAMIQEAKSRLDEIR* |
| Ga0070699_1005100871 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | KTLGDLEIGVFRQTRSGTAVILTTGICERATQTMSLDDLAKVKAMLQEAKSRLDELK* |
| Ga0070696_1006734062 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VFRQTRSGTAVILTTGICDRATQTMTLDDLAKVKAMIQEAKTRLDELK* |
| Ga0070696_1008016681 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | FEAKYRTLGDLEITVFRQTRSGNAAILTTGACEQARTSLTLDELAKMRAMIQEAKTRLDEIR* |
| Ga0070696_1011804402 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | TQGDLEIGVFRQTSRGTAVVLTTGICDRATTSLSLDDLAKVRAMIQEAKARLDDIR* |
| Ga0070696_1016071071 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | FEATYKTSGDLEIGVFRQTRSGTAVIISTGICDRARQTLTLDDLAKVKAMIQEAKARLDEAK* |
| Ga0070693_1011623151 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | TRSGTAVIISTGICDRATQTLSLDDLAKFKAMVQEAKARLDEIR* |
| Ga0066670_101675241 | 3300005560 | Soil | MTTGICDHVTATLSLDEFAKVKAMIQEAKARLDEIR* |
| Ga0070664_1006438931 | 3300005564 | Corn Rhizosphere | TGICDRATATLSLDDLAKVRAMIQEAKSRLDEIR* |
| Ga0068857_1006727031 | 3300005577 | Corn Rhizosphere | ARYRTSGDLEIAVFRQTRSGNAVMMSTGICDRVTGTFSLDEFAKIRAMIQEAKTRLDEIR |
| Ga0068857_1006880592 | 3300005577 | Corn Rhizosphere | YRTLGDLEITVFRQTRSGNAAILTTGACEQARTSLTLDELAKIRAMIQEAKTRLDEIR* |
| Ga0068857_1010604741 | 3300005577 | Corn Rhizosphere | DLEISVFRQTRSGRAVIMRTGICDRATTTLSLDDFAKVKAMIQEAKARLDEIR* |
| Ga0068857_1013044051 | 3300005577 | Corn Rhizosphere | RQTRSGTAVTMRTGLCNQATVSMSLDDLAKIKAMIQEAKERLDQIR* |
| Ga0068857_1020330432 | 3300005577 | Corn Rhizosphere | GDLEISVFRQTRSGRAVIMRTGICDRATITLSLDDFAKVKAMIQEAKARLDEIR* |
| Ga0068854_1018026582 | 3300005578 | Corn Rhizosphere | FEAKYRTLGDLEITVFRQTRSGNAAILTTGACEQARTSLTLDELAKVRAMIQEAKTRLDEIR* |
| Ga0070702_1009024222 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | TLGDFEITVFRQTRTGTAVSLTTGVCNQARVTMSLDDLARVRAMLVDAKTKLDEARQH* |
| Ga0068859_1005977891 | 3300005617 | Switchgrass Rhizosphere | IQTGICDRTTQTLSLDDLAKVKAIIQEAKSRLDEIR* |
| Ga0068859_1008984331 | 3300005617 | Switchgrass Rhizosphere | VFRQTRSGTAVIISTGICDRAMQTLTLDDLAKVKAQIQEAKMRLDEIR* |
| Ga0068859_1010934401 | 3300005617 | Switchgrass Rhizosphere | GVFRQTRSGNAVILSTGICDRATTTITLDELAKVKAMIQEAKARLDEIR* |
| Ga0068859_1014868971 | 3300005617 | Switchgrass Rhizosphere | AVTIQTGICTRATESLSLDELAKVRAMILEAKTRLDELR* |
| Ga0068864_1007819071 | 3300005618 | Switchgrass Rhizosphere | LGDLEIQVFKQTRSGTAVIVTTGICENARATLSLDDLAKIKAMIQEAKTRLDEIR* |
| Ga0068864_1014808611 | 3300005618 | Switchgrass Rhizosphere | VFRQTSRGTAVILTTGICDRATATLSLDDLAKVRAMIQEAKSRLDEIR* |
| Ga0068864_1016024312 | 3300005618 | Switchgrass Rhizosphere | GVFRQTRSGTAVSIQTGICDPAIQGISLDDLAKVKAMIQEAKTRLDDLR* |
| Ga0068864_1017929981 | 3300005618 | Switchgrass Rhizosphere | VFRQTRSGTAVIILTGICDRARVTLTLDDLAKLRAMIHEAKTRLDELR* |
| Ga0068861_1023038041 | 3300005719 | Switchgrass Rhizosphere | VILTTGICDRATATLSLDDLAKVRALIQEAKARLDEIR* |
| Ga0068863_1006831132 | 3300005841 | Switchgrass Rhizosphere | TRSGRAVIMRTGICDRATTTLSLDDFAKVKAMIQEAKARLDEIR* |
| Ga0068858_1017797461 | 3300005842 | Switchgrass Rhizosphere | RGTAVVLTTGICDRATASLSLDDLAKVRAMVQEAKSRLDEIK* |
| Ga0068860_1016720561 | 3300005843 | Switchgrass Rhizosphere | TQRLTAVTIQTGICTRATESLSLDELAKVRAMILEAKTRLDELR* |
| Ga0068862_1003504312 | 3300005844 | Switchgrass Rhizosphere | VTMTTGICDLATVSMSLDDLAKVRAMIQEAKERLDQIR* |
| Ga0068862_1014996882 | 3300005844 | Switchgrass Rhizosphere | RSGAAVVLTTGICDRATATLSLDDLAKVRALIQEAKARLDEIR* |
| Ga0068862_1018792621 | 3300005844 | Switchgrass Rhizosphere | AVILTTGICDRATQTLTLDDLAKVRALILEAKTRLDEIR* |
| Ga0082029_17420381 | 3300006169 | Termite Nest | ISVFRQTRSGTAVIISTGICDRATTTLSLDDLAKVKAMIQEAKARLEEIR* |
| Ga0079222_124283552 | 3300006755 | Agricultural Soil | RQTRTGTAVIMSTGICDRATQTLTLDDLAKVKAQIQEAKTRLDEIR* |
| Ga0066658_104537652 | 3300006794 | Soil | EIGVFRQTRSGNAVVMTTGICDHATTTFSLDEFGKVKTMIQEAKARLDDLR* |
| Ga0079220_109036152 | 3300006806 | Agricultural Soil | GTAVILTTGICDRATTTVSLDDLAKIRAMIQEAKSRLDEIR* |
| Ga0075433_102187932 | 3300006852 | Populus Rhizosphere | TGFEGRYKTKGDLEITVFRQTRSGNAVIISTGICDRATTSITLDELAKVKAMIQEAKARLDETR* |
| Ga0075420_1010052072 | 3300006853 | Populus Rhizosphere | RTLGDLEITVFRQTRSGNAALMTTGVCEQGRTALTLDELAKVRAMIQEAKTRLDEIR* |
| Ga0075434_1003909541 | 3300006871 | Populus Rhizosphere | ILTTGICDNTRVTLSLDDLAKIKAMIQEAKARLDETR* |
| Ga0075424_1011722271 | 3300006904 | Populus Rhizosphere | DLEITVFRQTRSGTAVTMTTGLCDGPTATLTLDELAKVKAMIQEAKTRLDEIR* |
| Ga0079219_108629051 | 3300006954 | Agricultural Soil | EIGVFRQTSRGTAVILTTGICDRATATLSLDDLAKVRAMIQEAKSRLDEIR* |
| Ga0075419_102438821 | 3300006969 | Populus Rhizosphere | AHYRTQGDLELRVFRQTRSGTAITIQTGICNRATETLTLDELAKVRAMIQEAKGRLEELR |
| Ga0079218_104244052 | 3300007004 | Agricultural Soil | AVTMSTGICDRVTSALTLDEFAKVKAMIQEAKGRLDEIR* |
| Ga0105240_127188722 | 3300009093 | Corn Rhizosphere | VLTTGICDRATATLSLDDLAKVRALIQEAKARLDEIR* |
| Ga0111539_113118642 | 3300009094 | Populus Rhizosphere | FRQTRSGRAVLIHTGICERATGTLTLDDLAKLRAMIQEAKMRLDEVK* |
| Ga0105245_112713902 | 3300009098 | Miscanthus Rhizosphere | ILTTGICDRATATLSLDDLAKVRALIQEAKARLDEIR* |
| Ga0105247_100628441 | 3300009101 | Switchgrass Rhizosphere | SVFRQTRSGRAVIIRTGLCDRATATLSLDDFAKVKAMIQEAKARLDEIR* |
| Ga0105247_117101692 | 3300009101 | Switchgrass Rhizosphere | LTTGICDRATATLSLDDLAKIRAMIQEAKSRLDEIR* |
| Ga0114129_115893761 | 3300009147 | Populus Rhizosphere | TRSGTAVIITTGICENSRATLSLDDLAKIRAMIQEAKQRLDEIR* |
| Ga0114129_116274051 | 3300009147 | Populus Rhizosphere | RQTRSGTAVTLTTGICDLATVSMSLDELAKIRAMIHEAKQRLDEIR* |
| Ga0105243_122228552 | 3300009148 | Miscanthus Rhizosphere | FEIQVFRQTRSGNAVVLQTGICEFATTSLSLDELAKVKALLQEAKTRLDEIR* |
| Ga0111538_106513472 | 3300009156 | Populus Rhizosphere | GDLEIAVFRQTRSGRAVILQTGICDRAAATLTLDDLAKVRAMIQEAKARLDEIR* |
| Ga0075423_112248592 | 3300009162 | Populus Rhizosphere | AFRTNGDLELSVFRQTRRGTAALISTGICERTSVPLSLDDLAKVKAMIQEAKARLDEIR* |
| Ga0075423_113403562 | 3300009162 | Populus Rhizosphere | GDLEIAVFRQTRGGNAVIMRTGICDHATTAMSLDDLAKVRAMIQEAKTRLDELR* |
| Ga0105241_109591741 | 3300009174 | Corn Rhizosphere | VIISTGICDRATATLTLDDLAKVKALIQEAKARLDEIR* |
| Ga0105241_112479442 | 3300009174 | Corn Rhizosphere | EIAVFRQTRSGNAVMMSTGICDRVTGTFSLDEFAKIRAMIQEAKARLDELR* |
| Ga0105242_101467822 | 3300009176 | Miscanthus Rhizosphere | LTAVTIQTGICTRATESLSLDELAKVRAMILEAKTRLDELR* |
| Ga0105242_119383831 | 3300009176 | Miscanthus Rhizosphere | TGICDRATATLSLDDLAKVRALIQEAKARLDEIR* |
| Ga0105242_127637152 | 3300009176 | Miscanthus Rhizosphere | LEVAVFRQTRSGNAVIISTGICDRATQTLSLDDLAKVKAMIQEAKSRLDEIR* |
| Ga0105238_108111531 | 3300009551 | Corn Rhizosphere | LTTGICDRATATLSLDDLAKIRAMIQEAKTRLDEIR* |
| Ga0126315_106654651 | 3300010038 | Serpentine Soil | AVNMRTGICDRATQTLTLDDLAKVRVMIAEAKTRLDEIR* |
| Ga0126309_110162731 | 3300010039 | Serpentine Soil | TGICDRATATLSLDELAKVRAMIQEAKARLDEIR* |
| Ga0126380_106350331 | 3300010043 | Tropical Forest Soil | DLEIKVFRQTRSGTAVTLSSGVCEQTLVTLSLDDLARVKAMILEAKGRLDESK* |
| Ga0126310_108473382 | 3300010044 | Serpentine Soil | VILTTGICDRATQTLSLDDLGKVKALIQEAKSRLDELR* |
| Ga0126310_114149302 | 3300010044 | Serpentine Soil | AVIMSTGICDRATQTLSLDDLAKVKAMIQEAKARLDEIR* |
| Ga0126311_101057261 | 3300010045 | Serpentine Soil | GDFEISVFRQTRSGAAVTLRTGICDDATVTMTLDDLAKVKAMIQEGKTRLDDK* |
| Ga0126382_107117971 | 3300010047 | Tropical Forest Soil | TAAFIRTGICNRATGTLTLDELAKVRAMIQEAKTRLDEIR* |
| Ga0134128_122526132 | 3300010373 | Terrestrial Soil | TQGDLEIGVFRQTSRGTAVILTTGFCDRATATLSLDDLAKVRAMIQEAKSRLDEIR* |
| Ga0134124_102579071 | 3300010397 | Terrestrial Soil | TLGDLEIGVFRQTRSGTAVILTTGICDQATQTLTLDDLAKVRALIQEAKTRLDEIR* |
| Ga0134124_105808972 | 3300010397 | Terrestrial Soil | GVFRQTRSGAAVVLTTGICDRATATLSLDDLAKVRALIQEAKARLDEIR* |
| Ga0134124_109231312 | 3300010397 | Terrestrial Soil | VFRQTRSGAAVILTTGICDRATATLSLDDLAKVRALIQEAKARLDEIR* |
| Ga0134124_114548181 | 3300010397 | Terrestrial Soil | GFEARYKSMGDLEISVFRQTRSGRAVIIRTGLCDRATTTLSLDDFAKVKALIQEAKARLDEIR* |
| Ga0134124_127153922 | 3300010397 | Terrestrial Soil | FEARYKTLGDLEISVFRQTRSGNAVIVSTGICDRATTTISLDDLAKVKAMIQEAKARLDEIR* |
| Ga0134127_103748831 | 3300010399 | Terrestrial Soil | RSGTAVIISTGICDRATQTLTLDDLAKFKAMVQEAKARLDEIR* |
| Ga0134122_100999232 | 3300010400 | Terrestrial Soil | DFEIQVFRQTRSGNAVVLQTGICESATTSLSLDELAKVKALLLEAKARLDEIK* |
| Ga0134121_115455101 | 3300010401 | Terrestrial Soil | IGVFRQTRSGTAVILTTGICDRATQTMTLDDLAKVKAMIQEAKTRLDENR* |
| Ga0134123_101088652 | 3300010403 | Terrestrial Soil | RLTAVTIQTGICTRATESLSLDELAKVRAMILEAKTRLDELR* |
| Ga0134123_105005622 | 3300010403 | Terrestrial Soil | FRQTRSGNAVILSTGICDRATTTITLDELAKVKAMIQEAKARLDEIR* |
| Ga0134123_128303081 | 3300010403 | Terrestrial Soil | RQTRSGNAVRISIGICEPATVYWTLDDLAKLRAMIKEAKARLDELG* |
| Ga0105246_111033721 | 3300011119 | Miscanthus Rhizosphere | SGAAVTLRTGICDDATVTLTLDDLAKVKAMIQEAKTRLDDK* |
| Ga0150984_1025363301 | 3300012469 | Avena Fatua Rhizosphere | LEIGVFRQTSRGTAVVLTTGICDRATASLSLDDLAKVRAMIQEAKARLDEIK* |
| Ga0157299_102953842 | 3300012899 | Soil | GDFEISVFRQTRSGTAVLLATGLCDRATQTMSLDDLGKVKAMIQEAKTRLDEIR* |
| Ga0137396_101544851 | 3300012918 | Vadose Zone Soil | LGDLEIAVFRQTRSGMAASLSTGICNRAIAYLTLDELAKVRAMILEAKEKLDQSR* |
| Ga0126375_100369973 | 3300012948 | Tropical Forest Soil | GDLELRVFRQTRSGTAVTLSSGVCEQVLVTLSLDDLARVKAMILEAKGRLDESK* |
| Ga0126375_120207611 | 3300012948 | Tropical Forest Soil | MTTGICDHATVTMSLDDLAKIKAMIQEAKARLEEIR* |
| Ga0157373_100128702 | 3300013100 | Corn Rhizosphere | AILTTGACEQARTSLTLDELAKIRAMIQEAKTRLDEIR* |
| Ga0163162_114790021 | 3300013306 | Switchgrass Rhizosphere | LELKVFRQTQRLTAVTIQTGICTRATESLSLDELAKVRAMILEAKTRLDELR* |
| Ga0157375_115796271 | 3300013308 | Miscanthus Rhizosphere | EIDVFRQTRSGTAVVIQTGICDRTTQTLSLDDLAKVKAIIQEAKSRLDDIK* |
| Ga0157380_117413602 | 3300014326 | Switchgrass Rhizosphere | EISVFRQTRSGRAVIMHTGICDRATITLSLDDFAKVKAMIQEAKARLDEIR* |
| Ga0157377_104732361 | 3300014745 | Miscanthus Rhizosphere | TRSGRAVIMRTGICDRATTTLSLDDFAKVKAMIQEAKARLDEAR* |
| Ga0157379_100332892 | 3300014968 | Switchgrass Rhizosphere | NVFKQTRSGTAVIVTTGICDHAKANLSLDDLAKIKAMIQEAKQRLDEIR* |
| Ga0157379_106218612 | 3300014968 | Switchgrass Rhizosphere | TRSGNAVILSTGICDRATTTITLDELAKVKAMIQEAKARLDEIR* |
| Ga0132256_1004265251 | 3300015372 | Arabidopsis Rhizosphere | TAVILQTGICDRAAQTLSLDDLSKVKAMIQEAKSRLDDIR* |
| Ga0184625_101168871 | 3300018081 | Groundwater Sediment | TLGDLEIRVFRQTSRGTAVQLQTGICELATTALTLDDLARFRAMILEAKTRVEDLR |
| Ga0207713_11887471 | 3300025735 | Switchgrass Rhizosphere | TQGDLEIGVFRQTRSGAAVIVTTGICDRATATLSLDDLGKVRALIQEAKARLDEIR |
| Ga0207662_113145832 | 3300025918 | Switchgrass Rhizosphere | MRTGICDRATTTLSLDDFAKVKAMIQEAKARLDEIR |
| Ga0207681_111655742 | 3300025923 | Switchgrass Rhizosphere | RTLGDLEVAVFRQTRSGNAVIISTGICDRATQTLSLDDLAKVKAMIQEAKSRLDEIR |
| Ga0207650_100358281 | 3300025925 | Switchgrass Rhizosphere | VIMQTGICDRATGTLTLDDLAKVKAMIQEAKARLDEIR |
| Ga0207650_104900671 | 3300025925 | Switchgrass Rhizosphere | TAGLCDLVTISMSLDDLGKVRAMFQEAKTRLDEIR |
| Ga0207659_110667572 | 3300025926 | Miscanthus Rhizosphere | LTAVTIQTGICTRATESLSLDELAKVRAMILEAKTRLDELR |
| Ga0207644_109001771 | 3300025931 | Switchgrass Rhizosphere | VGDLEISVFRQTRSGRAVIMRTGICDRATTTLSLDDFAKVKAMIQEAKARLDEIR |
| Ga0207686_103730462 | 3300025934 | Miscanthus Rhizosphere | VFRQTQRLTAVTIQTGICTRATESLSLDELAKVRAMILEAKTRLDELR |
| Ga0207686_110759921 | 3300025934 | Miscanthus Rhizosphere | DFEIGVFRQTSRGTAVVLTTGICDRAIATLSLDDLAKIRAMIQEAKSRLDDIK |
| Ga0207704_102699172 | 3300025938 | Miscanthus Rhizosphere | GVFRQTRSGTAVTMTTGICDLATVSMSLDDLAKVRAMIQEAKQRLDEIR |
| Ga0207711_112600343 | 3300025941 | Switchgrass Rhizosphere | EISVFRQTRSGRAVIIRTGLCDRATTTLSLDDFAKVKAMIQEAKARLDEIR |
| Ga0207651_100652451 | 3300025960 | Switchgrass Rhizosphere | ITTGICDHAKANLSLDDLAKIKAMIQEAKQRLDEIR |
| Ga0207712_100037116 | 3300025961 | Switchgrass Rhizosphere | AAVILTTGICDRATATLSLDDLAKVRALIQEAKARLDEIR |
| Ga0207640_104290491 | 3300025981 | Corn Rhizosphere | FEARYKTQGDLEIGVFRQTSRGTAVILTTGICDRATATLSLDDLAKVRAMIQEAKSRLDEIR |
| Ga0207703_116631741 | 3300026035 | Switchgrass Rhizosphere | QTRSGRAVIMRTGICDRATTTLSLDDFAKVKAMIQEAKARLDEIR |
| Ga0207708_100801751 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | QTQRLTAVTIQTGICTRATESLSLDELAKVRAMILEAKTRLDELR |
| Ga0207676_112930151 | 3300026095 | Switchgrass Rhizosphere | GVFRQTRSGTAVSIQTGICDPAIQGISLDDLAKVKAMIQEAKTRLDDLR |
| Ga0207676_115904462 | 3300026095 | Switchgrass Rhizosphere | GDFEVGVFRQTRSGTAVIILTGICDRARVTLTLDDLAKLRAMIHEAKTRLDELR |
| Ga0209177_102455292 | 3300027775 | Agricultural Soil | GVFRQTSRGTAVVLTTGICDRATTSLSLDDLAKVRAMIQEAKSRLDEIR |
| Ga0209074_102526212 | 3300027787 | Agricultural Soil | SRGTAVVLTTGICDRATTSLSLDDLAKVRAMIQEAKARLDDIR |
| Ga0209486_109704971 | 3300027886 | Agricultural Soil | IGVFRQTRRGNAATMATGICDRTSQLLTLDELAKVKAMVQEAKARLDELR |
| Ga0209382_109119281 | 3300027909 | Populus Rhizosphere | ALMTTGVCEQGRTALTLDELAKVRAMIQEAKTRLDEIR |
| Ga0268265_102175521 | 3300028380 | Switchgrass Rhizosphere | RSGNAAILTTGACEQARTSLTLDELAKIRAMIQEAKTRLDEIR |
| Ga0268264_119275211 | 3300028381 | Switchgrass Rhizosphere | YKTQGDLEIGVFRQTSRGTAVVISTGICDRATAPLSLDDLAKVRAMIQEAKARLDEIR |
| Ga0268243_11852841 | 3300030510 | Soil | LISTGICDRPQQALSLDDLAKVKAQIQEAKARLDEIR |
| Ga0307408_1024819682 | 3300031548 | Rhizosphere | FEARYRTLGDFEVGVFRQTRSGTAVILLTGICERGRSTLSLDELAKLKAMIQEAKTRLDELR |
| Ga0310813_111592062 | 3300031716 | Soil | AVNMHAGICNRPTINLSLDDLAKVRAMIQEAKTRLDEIR |
| Ga0307405_105316681 | 3300031731 | Rhizosphere | DLEIGVFRQTRSGTAVTMTTGICDLATVNMSLDDLGKIRAMIQEAKQRLDEIR |
| Ga0307410_113522321 | 3300031852 | Rhizosphere | DLEITVFRQTRSGNAAILTTGACEQARTSLTLDELAKIRAMIQEAKTRLDEIR |
| Ga0310900_100203341 | 3300031908 | Soil | NAVIISTGICDRATQTLSLDDLAKVKAMIQEAKSRLDEIR |
| Ga0310903_106307642 | 3300032000 | Soil | VAVFRQTRSGNAVIISTGICDRATQTLSLDDLAKVKAMIQEAKSRLDEIR |
| Ga0307414_121492441 | 3300032004 | Rhizosphere | QTQRGTAVTLTTGICDRATQGITFDELAKVKAMIHEAKTRLDEIR |
| Ga0310890_100324841 | 3300032075 | Soil | EVAVFRQTRSGNAVIISTGICDRATQTLSLDDLAKVKAMIQEAKSRLDEIR |
| Ga0310810_103381791 | 3300033412 | Soil | SGTAVTLTTGLCERATQTMTLDDLGKVKAMIQEAKTRLDELR |
| ⦗Top⦘ |