| Basic Information | |
|---|---|
| Family ID | F053530 |
| Family Type | Metagenome |
| Number of Sequences | 141 |
| Average Sequence Length | 44 residues |
| Representative Sequence | GVWAQDTALHSVRFVTHCDVDRAGIERALVVLKDVVAKPQKAGA |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 141 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 91.49 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.745 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (38.298 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.589 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (43.972 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.22% β-sheet: 18.06% Coil/Unstructured: 59.72% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 141 Family Scaffolds |
|---|---|---|
| PF01401 | Peptidase_M2 | 63.83 |
| PF02771 | Acyl-CoA_dh_N | 24.82 |
| PF05199 | GMC_oxred_C | 2.13 |
| PF03308 | MeaB | 1.42 |
| PF01048 | PNP_UDP_1 | 0.71 |
| PF01553 | Acyltransferase | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 141 Family Scaffolds |
|---|---|---|---|
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 24.82 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 2.13 |
| COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.71 |
| COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.71 |
| COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.74 % |
| Unclassified | root | N/A | 4.26 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001545|JGI12630J15595_10022805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1316 | Open in IMG/M |
| 3300002914|JGI25617J43924_10058910 | All Organisms → cellular organisms → Bacteria | 1402 | Open in IMG/M |
| 3300002914|JGI25617J43924_10165185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 749 | Open in IMG/M |
| 3300002914|JGI25617J43924_10187199 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300004080|Ga0062385_10770342 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 627 | Open in IMG/M |
| 3300004091|Ga0062387_101497731 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300005167|Ga0066672_10000031 | All Organisms → cellular organisms → Bacteria | 25676 | Open in IMG/M |
| 3300005174|Ga0066680_10765139 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300005175|Ga0066673_10902253 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300005332|Ga0066388_101226953 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
| 3300005332|Ga0066388_105433468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 646 | Open in IMG/M |
| 3300005338|Ga0068868_101148048 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300005524|Ga0070737_10429007 | Not Available | 507 | Open in IMG/M |
| 3300005537|Ga0070730_10237902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1205 | Open in IMG/M |
| 3300005552|Ga0066701_10755948 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300005553|Ga0066695_10453339 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300005556|Ga0066707_10338343 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300005556|Ga0066707_10746576 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300005559|Ga0066700_10166916 | All Organisms → cellular organisms → Bacteria | 1503 | Open in IMG/M |
| 3300005561|Ga0066699_10825992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 651 | Open in IMG/M |
| 3300005568|Ga0066703_10453434 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300005575|Ga0066702_10722542 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300005617|Ga0068859_100415123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1442 | Open in IMG/M |
| 3300005841|Ga0068863_101158455 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300006031|Ga0066651_10315265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 838 | Open in IMG/M |
| 3300006032|Ga0066696_10095871 | All Organisms → cellular organisms → Bacteria | 1773 | Open in IMG/M |
| 3300006050|Ga0075028_100063967 | All Organisms → cellular organisms → Bacteria | 1801 | Open in IMG/M |
| 3300006172|Ga0075018_10037782 | All Organisms → cellular organisms → Bacteria | 1960 | Open in IMG/M |
| 3300006172|Ga0075018_10796693 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300006173|Ga0070716_100074200 | All Organisms → cellular organisms → Bacteria | 2009 | Open in IMG/M |
| 3300006173|Ga0070716_100164940 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
| 3300006174|Ga0075014_100450938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 711 | Open in IMG/M |
| 3300006796|Ga0066665_10519118 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300006800|Ga0066660_10153919 | All Organisms → cellular organisms → Bacteria | 1707 | Open in IMG/M |
| 3300006804|Ga0079221_10297168 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300006871|Ga0075434_100899328 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300007255|Ga0099791_10090947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1398 | Open in IMG/M |
| 3300007265|Ga0099794_10014451 | All Organisms → cellular organisms → Bacteria | 3459 | Open in IMG/M |
| 3300007265|Ga0099794_10249106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 916 | Open in IMG/M |
| 3300007788|Ga0099795_10395748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300009038|Ga0099829_10302666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1311 | Open in IMG/M |
| 3300009088|Ga0099830_10929695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 719 | Open in IMG/M |
| 3300009088|Ga0099830_11009652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
| 3300009088|Ga0099830_11383820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300009143|Ga0099792_10751268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300010043|Ga0126380_11953252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300010322|Ga0134084_10027610 | Not Available | 1570 | Open in IMG/M |
| 3300010343|Ga0074044_11131369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300010358|Ga0126370_12382534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300010360|Ga0126372_11673689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
| 3300011269|Ga0137392_10749551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 807 | Open in IMG/M |
| 3300012096|Ga0137389_11281056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300012189|Ga0137388_11761636 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300012202|Ga0137363_10051204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2962 | Open in IMG/M |
| 3300012203|Ga0137399_10508448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1011 | Open in IMG/M |
| 3300012205|Ga0137362_10125745 | All Organisms → cellular organisms → Bacteria | 2177 | Open in IMG/M |
| 3300012205|Ga0137362_11796296 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300012206|Ga0137380_10416610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1191 | Open in IMG/M |
| 3300012206|Ga0137380_11697771 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300012207|Ga0137381_10370612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1248 | Open in IMG/M |
| 3300012207|Ga0137381_11777171 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300012208|Ga0137376_10370769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1243 | Open in IMG/M |
| 3300012210|Ga0137378_10101877 | All Organisms → cellular organisms → Bacteria | 2637 | Open in IMG/M |
| 3300012351|Ga0137386_10687595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
| 3300012357|Ga0137384_11427201 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300012361|Ga0137360_10507344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1027 | Open in IMG/M |
| 3300012362|Ga0137361_10392519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1274 | Open in IMG/M |
| 3300012362|Ga0137361_10802241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 857 | Open in IMG/M |
| 3300012362|Ga0137361_11133133 | Not Available | 704 | Open in IMG/M |
| 3300012362|Ga0137361_11805592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300012363|Ga0137390_11093463 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300012582|Ga0137358_10878141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300012918|Ga0137396_11150371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300012924|Ga0137413_11168177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300012925|Ga0137419_10022176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3733 | Open in IMG/M |
| 3300012925|Ga0137419_11883555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300012927|Ga0137416_10534169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1014 | Open in IMG/M |
| 3300012927|Ga0137416_10912150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 782 | Open in IMG/M |
| 3300012927|Ga0137416_11982172 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300012930|Ga0137407_10406709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1261 | Open in IMG/M |
| 3300012930|Ga0137407_11765893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300012944|Ga0137410_10050488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2962 | Open in IMG/M |
| 3300012944|Ga0137410_10838167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
| 3300012944|Ga0137410_11093101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
| 3300013296|Ga0157374_11182302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 786 | Open in IMG/M |
| 3300014157|Ga0134078_10199952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 815 | Open in IMG/M |
| 3300015264|Ga0137403_10231963 | All Organisms → cellular organisms → Bacteria | 1764 | Open in IMG/M |
| 3300017933|Ga0187801_10061900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1375 | Open in IMG/M |
| 3300017943|Ga0187819_10647224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300017994|Ga0187822_10119168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 823 | Open in IMG/M |
| 3300018482|Ga0066669_10145907 | All Organisms → cellular organisms → Bacteria | 1733 | Open in IMG/M |
| 3300019789|Ga0137408_1347525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 829 | Open in IMG/M |
| 3300020199|Ga0179592_10005073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5587 | Open in IMG/M |
| 3300020580|Ga0210403_10704649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 809 | Open in IMG/M |
| 3300020580|Ga0210403_11180103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300020581|Ga0210399_10539356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 968 | Open in IMG/M |
| 3300021086|Ga0179596_10126836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1191 | Open in IMG/M |
| 3300021088|Ga0210404_10556867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300021170|Ga0210400_10220609 | All Organisms → cellular organisms → Bacteria | 1545 | Open in IMG/M |
| 3300021178|Ga0210408_10635680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 843 | Open in IMG/M |
| 3300021178|Ga0210408_10979761 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300021404|Ga0210389_11028375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300021406|Ga0210386_10597121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 953 | Open in IMG/M |
| 3300021432|Ga0210384_10704973 | Not Available | 903 | Open in IMG/M |
| 3300021559|Ga0210409_10024787 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5806 | Open in IMG/M |
| 3300021560|Ga0126371_11159600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 910 | Open in IMG/M |
| 3300022557|Ga0212123_10937737 | Not Available | 506 | Open in IMG/M |
| 3300025911|Ga0207654_11103654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 578 | Open in IMG/M |
| 3300026313|Ga0209761_1304729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300026323|Ga0209472_1213252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300026335|Ga0209804_1239797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 699 | Open in IMG/M |
| 3300026359|Ga0257163_1053741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300026499|Ga0257181_1056311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300026523|Ga0209808_1109494 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1153 | Open in IMG/M |
| 3300026538|Ga0209056_10289449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1137 | Open in IMG/M |
| 3300026547|Ga0209156_10247606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 829 | Open in IMG/M |
| 3300026557|Ga0179587_10049752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2406 | Open in IMG/M |
| 3300026557|Ga0179587_10249353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1136 | Open in IMG/M |
| 3300026557|Ga0179587_10443618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 849 | Open in IMG/M |
| 3300027297|Ga0208241_1033032 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300027381|Ga0208983_1029757 | Not Available | 1068 | Open in IMG/M |
| 3300027663|Ga0208990_1169465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300027671|Ga0209588_1130526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 802 | Open in IMG/M |
| 3300027671|Ga0209588_1231794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300027674|Ga0209118_1136601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300027846|Ga0209180_10759064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300027884|Ga0209275_10155119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1216 | Open in IMG/M |
| 3300028536|Ga0137415_10522996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 995 | Open in IMG/M |
| 3300028906|Ga0308309_10459120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1098 | Open in IMG/M |
| 3300030617|Ga0311356_10243447 | All Organisms → cellular organisms → Bacteria | 1821 | Open in IMG/M |
| 3300031543|Ga0318516_10356998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 843 | Open in IMG/M |
| 3300031708|Ga0310686_113525435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300031715|Ga0307476_10352910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1083 | Open in IMG/M |
| 3300031820|Ga0307473_10514661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 810 | Open in IMG/M |
| 3300031823|Ga0307478_10527917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 985 | Open in IMG/M |
| 3300031962|Ga0307479_11139303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 745 | Open in IMG/M |
| 3300031962|Ga0307479_11433753 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300031962|Ga0307479_11717170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300032180|Ga0307471_101034666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 988 | Open in IMG/M |
| 3300032180|Ga0307471_102415564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300032205|Ga0307472_100096797 | All Organisms → cellular organisms → Bacteria | 2017 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 38.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.93% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.38% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.55% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.84% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.13% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.42% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.42% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.42% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.71% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.71% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.71% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005524 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12630J15595_100228051 | 3300001545 | Forest Soil | YSVRLVTHVDVNREGIERALVVLQDVAAQTQKAGA* |
| JGI25617J43924_100589101 | 3300002914 | Grasslands Soil | DAVHPHGVWAQDTALYSVRVVTHCDVDRAGVERALVVLKEVVAKTQKVGAQ* |
| JGI25617J43924_101651852 | 3300002914 | Grasslands Soil | PHEVWAQDTGLYSVRFVTHCDVNRAGIERALVVLKEVVSRTQKAGA* |
| JGI25617J43924_101871992 | 3300002914 | Grasslands Soil | HGVWAQDTALYSVRLVTHCDVDRAGIERALGVLKEVVAKTQKVSA* |
| Ga0062385_107703422 | 3300004080 | Bog Forest Soil | LAANGVLAQDTALHSVRFVTHCDVDRAGIDRAISVLRDVVAKTVSVGA* |
| Ga0062387_1014977312 | 3300004091 | Bog Forest Soil | GAQDTALHSVRLVTHCDVDETDIERALTVLQDAAMQVQKVGA* |
| Ga0066672_1000003121 | 3300005167 | Soil | QDTALYLVRVVTHSDVDRAGCERALTVLKEVVTRKRKAGA* |
| Ga0066680_107651391 | 3300005174 | Soil | IWAQDTAPFLVRLVTHCDVDRAGIERALAVLKEVVTKTQKAGA* |
| Ga0066673_109022532 | 3300005175 | Soil | VWAQDTALYSVRVVTHCDVYRAGIERALVVLKEVVARTQRAGAS* |
| Ga0066388_1012269532 | 3300005332 | Tropical Forest Soil | KPQGIWALDTAPHSVRFVTHCDVYAEGIERALRVLREVVVKARTKTA* |
| Ga0066388_1054334681 | 3300005332 | Tropical Forest Soil | LCAELERQGLWAQDTALHLVRFVTHCDVDRAGCERALKILGETLAKSHRRSA* |
| Ga0068868_1011480482 | 3300005338 | Miscanthus Rhizosphere | FYRHGLWAQDTSLHSVRFVTHCDVDDAGIDRALAVLQEVAAQPQKASA* |
| Ga0070737_104290071 | 3300005524 | Surface Soil | SIRMVTHCDVDREDCARALEVMSEVVGIARKAYSV* |
| Ga0070730_102379022 | 3300005537 | Surface Soil | TYSVRMVTHIDVDRARIERALTALQEVAAHVQKVGA* |
| Ga0066701_107559481 | 3300005552 | Soil | LHPHGVWAQDTALYSVRVVTHCDVYRAGIERALVVLKEVVARTQRAGAS* |
| Ga0066695_104533392 | 3300005553 | Soil | AHGVWAQDTALYSVRVVTHCDVHRAGCERALEVLREVVTKTRKAGA* |
| Ga0066707_103383432 | 3300005556 | Soil | WAQDTALHSVRVVTHCDVDKAGIERALVVLKEVVARTQKVGA* |
| Ga0066707_107465761 | 3300005556 | Soil | GVWAQDTALHSVRFVTHCDVDRAGIERALVVLQDVVGKTQKVEA* |
| Ga0066700_101669162 | 3300005559 | Soil | LHPHGVWAQDTALYSVRVVTHCDVDRAGIERALVVLKEVVARTQRAGAS* |
| Ga0066699_108259921 | 3300005561 | Soil | QDTAPYLVRVVTHCDVDRAGCERALAVLKEVVTKKRNAGA* |
| Ga0066703_104534342 | 3300005568 | Soil | VRVVTHCDVDRAGIERALVVLKEVVARTQRAGAS* |
| Ga0066702_107225421 | 3300005575 | Soil | WAQDTALHSVRFVTHCDVDRTGIERALVVLQDVVGKTQKVGA* |
| Ga0068859_1004151232 | 3300005617 | Switchgrass Rhizosphere | YRHGLWAQDTSLHSVRFVTHCDVDDAGIDRALAVLQEVAAQPQKASA* |
| Ga0068863_1011584552 | 3300005841 | Switchgrass Rhizosphere | WCDIFYKHGLWAQDTSLHSVRFVTHCDVDDAGIDRALAVLQEVAAQPQKASA* |
| Ga0066651_103152651 | 3300006031 | Soil | TAPYSVRFVTHCDVDRAGCERAIHVLRDVVAKSRPARA* |
| Ga0066696_100958712 | 3300006032 | Soil | ELCDVLHPYGVWAQDTGLHSVRLVTHCDVDRGGIERALVVLQDVVAKTQGAGA* |
| Ga0075028_1000639671 | 3300006050 | Watersheds | GVWAQDTAVHSVRVVTHCDVDRVGVERALVVLKEVVAKTQKAGA* |
| Ga0075018_100377822 | 3300006172 | Watersheds | SKTGKTAVELCDALHPHGVWAQDTAVHSVRVVTHCDVDRVGVERALVVLKEVVAKTQKAGA* |
| Ga0075018_107966931 | 3300006172 | Watersheds | TALYSVRVVTHCDVDRAGVERALVVMKEVVAKTQKAGA* |
| Ga0070716_1000742001 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VTHCDVDRAGVERALAVLKEVVSKSEKKSASGRES* |
| Ga0070716_1001649402 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GIWALDTAPYSVRFVTHCDVDRPGCERAIHVLRDVVAKSRPARA* |
| Ga0075014_1004509382 | 3300006174 | Watersheds | TYSVRFVTHCDVDRAGCERALEILQEVVTPTQKAKA* |
| Ga0066665_105191182 | 3300006796 | Soil | HPHGVWAQDTALHSVRVVTHCDVDKAGIERALVVLKEVVARTQKAGA* |
| Ga0066660_101539192 | 3300006800 | Soil | YGVWAQDTGLHSVRLVTHCDVHRGGIERALVVLQDVVAKTQGAGA* |
| Ga0079221_102971682 | 3300006804 | Agricultural Soil | LYSVRVVTHCDVDRAGCERALAVLKEVVTKKRKAGA* |
| Ga0075434_1008993281 | 3300006871 | Populus Rhizosphere | TSLHSVRFVTHCDVDDAGIDRALAVLQEVAAQPQKASA* |
| Ga0099791_100909472 | 3300007255 | Vadose Zone Soil | LYGRGILAQDTATYSVRMVTHVDVDREGIERTLVALQDVAAQTQRAGA* |
| Ga0099794_100144514 | 3300007265 | Vadose Zone Soil | HPHDVWAQDTALYSVRVVTHCDVDRAGVERALVVLNDVVARSQRKGA* |
| Ga0099794_102491061 | 3300007265 | Vadose Zone Soil | DALHPHGVWAQDTALYSIRFVTHCDVDRAGIERALVVLQDVVAKTQKAGA* |
| Ga0099795_103957482 | 3300007788 | Vadose Zone Soil | YSVRMVTHVDVDREGIERALVALQDVAAQTQRAGA* |
| Ga0099829_103026662 | 3300009038 | Vadose Zone Soil | ALHPHGVCAQDTALYSVRVVTHCDVDRAGVERALVVLKDVVAKSQRKGA* |
| Ga0099830_109296952 | 3300009088 | Vadose Zone Soil | ALYSIRFVTHCDVDRAGIERALVVLQDVVAKTQKAGA* |
| Ga0099830_110096522 | 3300009088 | Vadose Zone Soil | AQDTGLHSVRVVTHCDVDRAGIERALVVLQDVVARTQKAGA* |
| Ga0099830_113838201 | 3300009088 | Vadose Zone Soil | DTALYSVRVVTHCDVDREGCERALEVLKDVVTKARKAGA* |
| Ga0099792_107512681 | 3300009143 | Vadose Zone Soil | LCDALHPYGVWAQDTALHSVRFVTHCDVDRARIERALVVLQDVVAQPQKAGA* |
| Ga0126380_119532522 | 3300010043 | Tropical Forest Soil | WCDIFNKHGLWAQDTALHSVRFVTHCDVDDAGIDRALAVLEEVAAQPQRASA* |
| Ga0134084_100276102 | 3300010322 | Grasslands Soil | GVWAQDTALYSVRVVTHCDVYRAGIERALVVLKEVVARTQRAGAS* |
| Ga0074044_111313691 | 3300010343 | Bog Forest Soil | VLAQDTALHLVRFVTHCDVDRAGIDRAIAVLREVVAKTMSAGA* |
| Ga0126370_123825342 | 3300010358 | Tropical Forest Soil | GVWAQDTALYSVRVVTHCDVDRAGCERALEVLKEVVGKVRKAGA* |
| Ga0126372_116736891 | 3300010360 | Tropical Forest Soil | GVWAQDTALHLVRFVTHCDVDEAGCERALTILRDTIAKSHRRSA* |
| Ga0137392_107495511 | 3300011269 | Vadose Zone Soil | PYAVRLVTHIDVDRTGIERALAVLQEVAGQAQKAGA* |
| Ga0137389_112810562 | 3300012096 | Vadose Zone Soil | LYSVRLVTHCDVDRAGCEKALDVLKEVVIRAQKAGAGRGKA* |
| Ga0137388_117616362 | 3300012189 | Vadose Zone Soil | AQDTALYSVRVVTHCDVDRAGVERALVVLKEVVAKTQKVGAQ* |
| Ga0137363_100512041 | 3300012202 | Vadose Zone Soil | VRVVTHCDVDRAGIERTLVVLKEVVAKTQKAGAQGSAE* |
| Ga0137399_105084482 | 3300012203 | Vadose Zone Soil | WAQDTGLHSVRFVTHCDVDRAGIERAIVLLQDVVAKTQKAGA* |
| Ga0137362_101257451 | 3300012205 | Vadose Zone Soil | HPHGVWAQDTALYSVRVVTHCDVDRAGVERALVVLKDVAAKSQRKGA* |
| Ga0137362_117962961 | 3300012205 | Vadose Zone Soil | GIWAQDTALYSVRLVTHVDVNREGIERTLAVLQDVAAQAQKAGA* |
| Ga0137380_104166102 | 3300012206 | Vadose Zone Soil | TAVELCDVLHPYGVWAQDTGLHSVRLVTHCDVDRGGIESALVVLQDVVAKTQGAGA* |
| Ga0137380_116977712 | 3300012206 | Vadose Zone Soil | ALHPHGVWAQDTALYSVRLVTHCDVDRTGIERALGVLKEVVAKTQKVSA* |
| Ga0137381_103706122 | 3300012207 | Vadose Zone Soil | GDALHSHGVLAEDTALHSVRVVTHCDVDRAGIERALVVLTEVVARTQKAGT* |
| Ga0137381_117771711 | 3300012207 | Vadose Zone Soil | DTALYSVRLVTHCDVDRTGIERALVVLKDIVAKTQKVSA* |
| Ga0137376_103707692 | 3300012208 | Vadose Zone Soil | GVWAQDTALHSVRFVTHCDVDRAGIERALVVLQDVVGKTQKMGA* |
| Ga0137378_101018774 | 3300012210 | Vadose Zone Soil | HGVWAQDTALYSVRLVTHCDVDGAGIERALVVLKDIVAKTQKVSA* |
| Ga0137386_106875952 | 3300012351 | Vadose Zone Soil | GLHSVRLVTHCDVDRGGIERALVVLQDVVAKTQGAGA* |
| Ga0137384_114272011 | 3300012357 | Vadose Zone Soil | DALHPHGVWAQDTALYSVRLVTHCDVDRTGIERALVVLKDIVAKTQKVSA* |
| Ga0137360_105073441 | 3300012361 | Vadose Zone Soil | SVRMVTHCDVDRAGIERALVVLKEVVAKTQKAGA* |
| Ga0137361_103925191 | 3300012362 | Vadose Zone Soil | LHSVRFVTHCDVDRAGIERAIVLLQDVVAKTQKAGA* |
| Ga0137361_108022411 | 3300012362 | Vadose Zone Soil | GVWAQDTSLYSVRLVTHCDVDRAGIERALVVLKEVVAKTQKVGA* |
| Ga0137361_111331331 | 3300012362 | Vadose Zone Soil | QDTALYSVRLVTHVDVNREGIERALAVLRDVAAQAQKAGA* |
| Ga0137361_118055921 | 3300012362 | Vadose Zone Soil | TGKTAVELCDVLHPYGVWAQDTGLHSVRLVTHCDVDRGGIERALVVLQDVVAKTQGAGA* |
| Ga0137390_110934631 | 3300012363 | Vadose Zone Soil | SVRLVTHIDVDRTGIERALAVLQEVAGQAQKAGA* |
| Ga0137358_108781412 | 3300012582 | Vadose Zone Soil | CDALYPHGVWAQDTALHSVRFVTHCDVDRAGIERALVVLKDVVAKPQKAGA* |
| Ga0137396_111503711 | 3300012918 | Vadose Zone Soil | HPHGVWAQDTALHSVRFVTHCDVDRAGIERALVVLQDVVGKTQKVGA* |
| Ga0137413_111681772 | 3300012924 | Vadose Zone Soil | LYKRGVWVQGTALHSVRLVTHCDVDEAGVERALTGLQEAASTV* |
| Ga0137419_100221761 | 3300012925 | Vadose Zone Soil | ELCDALHAQGVWAQDTALHSVRFVTHCDVDRARIERALVVLKEVVARTQKAGA* |
| Ga0137419_118835552 | 3300012925 | Vadose Zone Soil | DALYPHGVWAQDTALHSVRFVTHCDVDRAGIERALVVLKDVVAKPQKAGA* |
| Ga0137416_105341691 | 3300012927 | Vadose Zone Soil | GKTAVELCDVLHPYGVWAQDTGLHSVRLVTHCDVDRGGIERALVVLQDVVAKTQGAGA* |
| Ga0137416_109121502 | 3300012927 | Vadose Zone Soil | GVWAQDTALHSVRFVTHCDVDRAGIERALVVLKDVVAKPQKAGA* |
| Ga0137416_119821722 | 3300012927 | Vadose Zone Soil | WAQDTALYSVRVVTHCDVDRAGIERALVVLQEIVAKTQKVGAQ* |
| Ga0137407_104067091 | 3300012930 | Vadose Zone Soil | DTALHSVRLVTHCDVDQAGIERALTALQDAASTVQGVGA* |
| Ga0137407_117658932 | 3300012930 | Vadose Zone Soil | VWAQDTAQYSVRMVTHCDVDRAGVERALVVLKDVVAKSQRKGA* |
| Ga0137410_100504883 | 3300012944 | Vadose Zone Soil | ALHPHGVWAQDTALYSVRVVTHCDVDRAGVERALVVLKDVVAKSQRKGA* |
| Ga0137410_108381672 | 3300012944 | Vadose Zone Soil | YSVRVVTHCDVDGAGVERALAVLKDVVAKSQRKGA* |
| Ga0137410_110931012 | 3300012944 | Vadose Zone Soil | GKTAVEICDALHPHGVWAQDTALYSVRVVTHCDVHRAGVERALVVLKDVAAKSQRKGA* |
| Ga0157374_111823021 | 3300013296 | Miscanthus Rhizosphere | GLWAQDTSLHSVRFVTHCDVDDAGIDRALAVLQEVAAQPQKASA* |
| Ga0134078_101999522 | 3300014157 | Grasslands Soil | CDALHPYGVWAQDTALHSVRFVTHCDVDRVGIERALVVLQDVVGVTEKAGA* |
| Ga0137403_102319632 | 3300015264 | Vadose Zone Soil | HPHGVWAQDTALHSVRVVTHCDVDRAGVERALVVLKDVVAKSQRKGA* |
| Ga0187801_100619001 | 3300017933 | Freshwater Sediment | VWAQDTAVYSVRLVTHCDVDEAGIERALKVLHEVATKPQGVGA |
| Ga0187819_106472242 | 3300017943 | Freshwater Sediment | LYPHGVWAQDTALYSVRMVTHCDVDRAGIERAIGVLKEVIGKTQKVGA |
| Ga0187822_101191681 | 3300017994 | Freshwater Sediment | HGIWALDTAPYSVRFVTHCDVDAAGIERALVVLREVVSKTRGTTA |
| Ga0066669_101459071 | 3300018482 | Grasslands Soil | HGIWALDTAPYSVRFVTHCDVDRAGCERAIHVLRDVVAKSRPARA |
| Ga0137408_13475251 | 3300019789 | Vadose Zone Soil | IRCGVVTHCDVDGAGVERALAVLKDVVAKSQRKGA |
| Ga0179592_100050731 | 3300020199 | Vadose Zone Soil | TGLHSVRLVTHCDVDRGGIERALVVLQDVVAKTQGAGA |
| Ga0210403_107046491 | 3300020580 | Soil | LLYKRGVWAQDTALHSVRLVTHCDVDEAGIERALTVLQEVAATAQGVGA |
| Ga0210403_111801031 | 3300020580 | Soil | VQRNGVWAQDTALHSVRFVTHCDVDRAGCERALAVLRETAPKAQRRSA |
| Ga0210399_105393561 | 3300020581 | Soil | QDTAVHSVRMVTHCDVDRAGVERALVVLRDVVAKTQGKGA |
| Ga0179596_101268361 | 3300021086 | Vadose Zone Soil | HGVWGQDTALHSVRFVTHCDVDRAGIERALVVLQDVVARPQKAGA |
| Ga0210404_105568672 | 3300021088 | Soil | ALHSVRFVTHCDVDRAGIERALVVLQDVVGKTQKAGA |
| Ga0210400_102206091 | 3300021170 | Soil | GVWAQDTALHSVRLVTHCDVDEAGIERALTVLQEVAATAQGVGA |
| Ga0210408_106356802 | 3300021178 | Soil | TAVHSVRVVTHCDVDQVGVERALVVLKEVVARTQKAGA |
| Ga0210408_109797612 | 3300021178 | Soil | ALYSVRVVTHCDVDRTGIERALVVLKEVVAKTQKAGA |
| Ga0210389_110283752 | 3300021404 | Soil | ALAPHGILAQDTALHSVRFVTHCDVDRAGIDRAISVLREVVAKTVSAKA |
| Ga0210386_105971211 | 3300021406 | Soil | QRGLWAQDTALHSVRLVTHCDVDETDIERALTVLQDAAMQVQKVGA |
| Ga0210384_107049731 | 3300021432 | Soil | VWAQDTALHSVRLVTHYDVDEAGIERALEVLQEVAASAQRVGA |
| Ga0210409_100247875 | 3300021559 | Soil | TAVHSVRVVTHCDVDRAGVERALVVLKEVVAKTQKAGA |
| Ga0126371_111596002 | 3300021560 | Tropical Forest Soil | WAQDTALYSVRMVTHCDVDRAGCERALIVLSEVVTKKRKAGA |
| Ga0212123_109377371 | 3300022557 | Iron-Sulfur Acid Spring | AHGVLAQDTALFSVRFVTHCDVDRAGIERAIKVLPQVVARAASA |
| Ga0207654_111036542 | 3300025911 | Corn Rhizosphere | MIFPYWCDIFYRHGLWAQDTSLHSVRFVTHCDVDDAGIDRALAVLQE |
| Ga0209761_13047292 | 3300026313 | Grasslands Soil | GVWAQDTALYSVRLVTHCDVDRAGCEKALAVLKEVVTKAQKAGA |
| Ga0209472_12132522 | 3300026323 | Soil | CDVLHPYGVWAQDTGLHSVRLVTHCDVDRGGIERALVVLQDVVAKTQGAGA |
| Ga0209804_12397971 | 3300026335 | Soil | DTALHSVRFVTHCDVDRAGIERALVVLQDVVGKTQKMGA |
| Ga0257163_10537412 | 3300026359 | Soil | PHGVWAQDTALHSVRFVTHCDVDRAGIERALVVLQDVVAKPQKAGA |
| Ga0257181_10563112 | 3300026499 | Soil | ALYSIRFVTHCDVDRAGIERALVVLQDVVAKTWKAGA |
| Ga0209808_11094941 | 3300026523 | Soil | YSVRVVTHCDVDRPGCERALAVLKEVVTKKRKAGA |
| Ga0209056_102894492 | 3300026538 | Soil | GKTAVELCDALHPHGVWAQDTALHSVRVVTHCDVDKAGIERALVVLKEVVARTQKAGA |
| Ga0209156_102476062 | 3300026547 | Soil | VWAQDTALHSVRVVTHCDVDKAGIERALVVLKEVVARTQKAGA |
| Ga0179587_100497521 | 3300026557 | Vadose Zone Soil | AQGVWAQDTALHSVRFVTHCDVDRARIERALVVLKEVVARTQKAGA |
| Ga0179587_102493531 | 3300026557 | Vadose Zone Soil | PHGVWAQDTALHSVRAVTHCDVDRAGVERALVVLKEVVAKTQKVGA |
| Ga0179587_104436181 | 3300026557 | Vadose Zone Soil | ATYSVRMVTHVDVDREGIERALVALQDVATQTQRAGA |
| Ga0208241_10330321 | 3300027297 | Forest Soil | DTAVYSVRMVTHCDVDRAGCERALSVVKEVAGKTQKAGA |
| Ga0208983_10297571 | 3300027381 | Forest Soil | HGVWAQDTAPYSVRVVTHCDVDRSGVERALLVLKDVVAKSQRKGA |
| Ga0208990_11694652 | 3300027663 | Forest Soil | TYSVRMVTHVDVDREGIERALVALQDVAAQTQRAGA |
| Ga0209588_11305261 | 3300027671 | Vadose Zone Soil | DTASYSVRLVTHVDVDREGIERALVVLGDVAAQTQKAGA |
| Ga0209588_12317942 | 3300027671 | Vadose Zone Soil | ALYSVRLVTHIDVDRAGIERALTILQEVAGQTQKAGA |
| Ga0209118_11366011 | 3300027674 | Forest Soil | AQDTARYSVRVVTHCDVDRAGVELALEVLKDVVAKSQRKGA |
| Ga0209180_107590641 | 3300027846 | Vadose Zone Soil | VWAQDTALYSIRFVTHCDVDRAGIERALVVLQDVVAKTRKAGA |
| Ga0209275_101551191 | 3300027884 | Soil | YERGLWVQDTALHSVRLVTHCDVNEADIERALTVLQDAAMQVQKVGA |
| Ga0137415_105229961 | 3300028536 | Vadose Zone Soil | AQDTGLHSVRLVTHCDVDRGGIERALVVLQDVVAKTQGAGA |
| Ga0308309_104591202 | 3300028906 | Soil | EILYERGLWAQDTALHSVSLVTHCDVNEADIERALTVLQDAAMQVQKVGA |
| Ga0311356_102434472 | 3300030617 | Palsa | FCDELYRRGVWALDTALHSVRLVTHCDVHSADVERALAALQEAAATPQSVSA |
| Ga0318516_103569982 | 3300031543 | Soil | AQGVWAQDTALYLVRLVTHCDVDRAGCERALTVLKEVVTRKRKAGA |
| Ga0310686_1135254351 | 3300031708 | Soil | EMLYKRGVWAQDTAVYSVRLVTHCDVDEAGIERALTVLQELAAKPQRVGA |
| Ga0307476_103529101 | 3300031715 | Hardwood Forest Soil | DTALHSVRLVTHCDVNEADIERALTVLQDAAMQVQKVGA |
| Ga0307473_105146612 | 3300031820 | Hardwood Forest Soil | LHPYGVWAQDTGLHSVRLVTHCDVDRGGIEKALVVLQDVVAKTQGPGA |
| Ga0307478_105279172 | 3300031823 | Hardwood Forest Soil | DILYHRGLWAQDTALHSLRLVTHCDVNEAHIERALTVLQDAAMQVQKVGA |
| Ga0307479_111393032 | 3300031962 | Hardwood Forest Soil | PHGVWAQDTALHSVRFVTHCDISRAGIEQALPIIRQVAANTRKAKA |
| Ga0307479_114337531 | 3300031962 | Hardwood Forest Soil | GKTAVELCDALHPHGVWAQDTALYSVRVVTHCDVDRTGIERALEVLKEVVAKTQKAGA |
| Ga0307479_117171701 | 3300031962 | Hardwood Forest Soil | DTAPYSVRLVTHVDVSREGIERALVILREVAAQAQKAGA |
| Ga0307471_1010346662 | 3300032180 | Hardwood Forest Soil | VWAQDTALYSVRVVTHCDVDRAGVERALVVLKEVVAKTQRKGA |
| Ga0307471_1024155642 | 3300032180 | Hardwood Forest Soil | CEILYQRGVWAQDTALHSVRLVTHCDVDEAGIERALTVLQDAAMQTQKVGA |
| Ga0307472_1000967971 | 3300032205 | Hardwood Forest Soil | DAVHAQGVWVQDTALYLVRVVTHCDVDRAGCERALTVLKEVVTRKRKAGA |
| ⦗Top⦘ |