NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F053462

Metagenome / Metatranscriptome Family F053462

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F053462
Family Type Metagenome / Metatranscriptome
Number of Sequences 141
Average Sequence Length 48 residues
Representative Sequence MTAATSVAPARDVQLRIRGLRIHAQVRGEGEPLLLYSGIWGEVRLW
Number of Associated Samples 113
Number of Associated Scaffolds 141

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 98.58 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 90.78 %
Associated GOLD sequencing projects 108
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (87.943 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(24.113 % of family members)
Environment Ontology (ENVO) Unclassified
(24.823 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.972 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 18.92%    Coil/Unstructured: 81.08%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 141 Family Scaffolds
PF00501AMP-binding 53.90
PF13193AMP-binding_C 6.38
PF13561adh_short_C2 2.84
PF00365PFK 1.42
PF08240ADH_N 0.71
PF00108Thiolase_N 0.71
PF02559CarD_CdnL_TRCF 0.71
PF00107ADH_zinc_N 0.71
PF00561Abhydrolase_1 0.71

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 141 Family Scaffolds
COG02056-phosphofructokinaseCarbohydrate transport and metabolism [G] 1.42
COG0183Acetyl-CoA acetyltransferaseLipid transport and metabolism [I] 0.71


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms87.94 %
UnclassifiedrootN/A12.06 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001356|JGI12269J14319_10310498Not Available566Open in IMG/M
3300004091|Ga0062387_100365209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia959Open in IMG/M
3300005344|Ga0070661_101371495All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300005435|Ga0070714_100127338All Organisms → cellular organisms → Bacteria2272Open in IMG/M
3300005435|Ga0070714_101445069All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300005437|Ga0070710_11066979All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300005439|Ga0070711_101477527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia592Open in IMG/M
3300005467|Ga0070706_100425313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1236Open in IMG/M
3300005534|Ga0070735_10269596All Organisms → cellular organisms → Bacteria1030Open in IMG/M
3300005549|Ga0070704_100359919All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1231Open in IMG/M
3300005614|Ga0068856_101708813All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300006102|Ga0075015_100977909All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300006102|Ga0075015_101040075Not Available503Open in IMG/M
3300006162|Ga0075030_100683308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria813Open in IMG/M
3300006174|Ga0075014_100475544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia695Open in IMG/M
3300006175|Ga0070712_100026257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae3878Open in IMG/M
3300006176|Ga0070765_100874501All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300006176|Ga0070765_101120386All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300006577|Ga0074050_10910178All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300006755|Ga0079222_10031201All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2277Open in IMG/M
3300006755|Ga0079222_10408711All Organisms → cellular organisms → Bacteria949Open in IMG/M
3300006755|Ga0079222_11656033All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300006804|Ga0079221_10352827All Organisms → cellular organisms → Bacteria889Open in IMG/M
3300009521|Ga0116222_1266798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium739Open in IMG/M
3300009521|Ga0116222_1267521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium738Open in IMG/M
3300009521|Ga0116222_1338436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia652Open in IMG/M
3300009525|Ga0116220_10307792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia698Open in IMG/M
3300009525|Ga0116220_10523097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia540Open in IMG/M
3300009698|Ga0116216_10065517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium2235Open in IMG/M
3300009698|Ga0116216_10511347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium726Open in IMG/M
3300009698|Ga0116216_10669939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia624Open in IMG/M
3300009700|Ga0116217_10488606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia774Open in IMG/M
3300009700|Ga0116217_10797113All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia582Open in IMG/M
3300009700|Ga0116217_10838250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia565Open in IMG/M
3300009824|Ga0116219_10064956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2147Open in IMG/M
3300010371|Ga0134125_10274745All Organisms → cellular organisms → Bacteria1872Open in IMG/M
3300010373|Ga0134128_10198853All Organisms → cellular organisms → Bacteria2257Open in IMG/M
3300010379|Ga0136449_103263627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia625Open in IMG/M
3300010876|Ga0126361_10403908Not Available852Open in IMG/M
3300012209|Ga0137379_11311373Not Available629Open in IMG/M
3300012349|Ga0137387_10046183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2886Open in IMG/M
3300012356|Ga0137371_10879654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium681Open in IMG/M
3300012507|Ga0157342_1051730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia580Open in IMG/M
3300012984|Ga0164309_10901420All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia721Open in IMG/M
3300014969|Ga0157376_11111648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia816Open in IMG/M
3300016294|Ga0182041_10574303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium987Open in IMG/M
3300016371|Ga0182034_11700444Not Available555Open in IMG/M
3300017821|Ga0187812_1044372Not Available1506Open in IMG/M
3300017924|Ga0187820_1197274Not Available627Open in IMG/M
3300017928|Ga0187806_1065985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium1119Open in IMG/M
3300017942|Ga0187808_10478268Not Available575Open in IMG/M
3300017943|Ga0187819_10259817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium1015Open in IMG/M
3300017947|Ga0187785_10276961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium762Open in IMG/M
3300017973|Ga0187780_11185059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia560Open in IMG/M
3300017974|Ga0187777_10558727All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium804Open in IMG/M
3300017974|Ga0187777_11117220Not Available574Open in IMG/M
3300017993|Ga0187823_10273342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia579Open in IMG/M
3300018001|Ga0187815_10489004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia527Open in IMG/M
3300018007|Ga0187805_10167915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium1000Open in IMG/M
3300018034|Ga0187863_10684362Not Available579Open in IMG/M
3300018035|Ga0187875_10127174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium1435Open in IMG/M
3300018035|Ga0187875_10395590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium739Open in IMG/M
3300018060|Ga0187765_10288608Not Available980Open in IMG/M
3300018085|Ga0187772_10045179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2685Open in IMG/M
3300018085|Ga0187772_10512440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium847Open in IMG/M
3300018090|Ga0187770_11497672All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia549Open in IMG/M
3300020150|Ga0187768_1163158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia515Open in IMG/M
3300020581|Ga0210399_10420265All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium1114Open in IMG/M
3300021171|Ga0210405_11247400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia548Open in IMG/M
3300021361|Ga0213872_10459757Not Available511Open in IMG/M
3300021377|Ga0213874_10082311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium1045Open in IMG/M
3300021403|Ga0210397_10684490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia787Open in IMG/M
3300021406|Ga0210386_11066094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia687Open in IMG/M
3300021478|Ga0210402_10417178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium1246Open in IMG/M
3300021478|Ga0210402_11310776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia651Open in IMG/M
3300022521|Ga0224541_1039935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia508Open in IMG/M
3300025453|Ga0208455_1061886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium771Open in IMG/M
3300025898|Ga0207692_10811735All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia612Open in IMG/M
3300025915|Ga0207693_10041206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3636Open in IMG/M
3300025915|Ga0207693_10163318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium1753Open in IMG/M
3300025932|Ga0207690_11008717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia693Open in IMG/M
3300026872|Ga0207785_1024003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium533Open in IMG/M
3300027795|Ga0209139_10239675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia641Open in IMG/M
3300027855|Ga0209693_10161230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium1107Open in IMG/M
3300027895|Ga0209624_10869425Not Available589Open in IMG/M
3300027908|Ga0209006_10513622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium998Open in IMG/M
3300027911|Ga0209698_10888278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium669Open in IMG/M
3300028801|Ga0302226_10175695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia923Open in IMG/M
3300028806|Ga0302221_10347249Not Available646Open in IMG/M
3300028906|Ga0308309_11023023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia715Open in IMG/M
3300030056|Ga0302181_10005530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria8270Open in IMG/M
3300030509|Ga0302183_10089838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1212Open in IMG/M
3300031028|Ga0302180_10124327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1454Open in IMG/M
3300031543|Ga0318516_10132485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1426Open in IMG/M
3300031549|Ga0318571_10350828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium566Open in IMG/M
3300031680|Ga0318574_10216751All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium1102Open in IMG/M
3300031680|Ga0318574_10707365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia591Open in IMG/M
3300031713|Ga0318496_10687610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia564Open in IMG/M
3300031713|Ga0318496_10830968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia509Open in IMG/M
3300031719|Ga0306917_11166319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia599Open in IMG/M
3300031744|Ga0306918_10325931All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium1188Open in IMG/M
3300031744|Ga0306918_11326647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia553Open in IMG/M
3300031747|Ga0318502_10572636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium679Open in IMG/M
3300031747|Ga0318502_10593728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium666Open in IMG/M
3300031768|Ga0318509_10484638Not Available691Open in IMG/M
3300031770|Ga0318521_10715162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia608Open in IMG/M
3300031778|Ga0318498_10304466All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia715Open in IMG/M
3300031781|Ga0318547_10996026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia524Open in IMG/M
3300031799|Ga0318565_10246316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium869Open in IMG/M
3300031819|Ga0318568_10952444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia531Open in IMG/M
3300031821|Ga0318567_10263961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium968Open in IMG/M
3300031831|Ga0318564_10122449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium1158Open in IMG/M
3300031833|Ga0310917_10741909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium664Open in IMG/M
3300031835|Ga0318517_10027816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2245Open in IMG/M
3300031860|Ga0318495_10374656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia629Open in IMG/M
3300031890|Ga0306925_11713564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium606Open in IMG/M
3300031945|Ga0310913_11214846Not Available524Open in IMG/M
3300032009|Ga0318563_10303518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium864Open in IMG/M
3300032052|Ga0318506_10286359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium730Open in IMG/M
3300032054|Ga0318570_10354193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia668Open in IMG/M
3300032060|Ga0318505_10054395All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium1725Open in IMG/M
3300032060|Ga0318505_10527969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia556Open in IMG/M
3300032064|Ga0318510_10511598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia521Open in IMG/M
3300032068|Ga0318553_10281378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium870Open in IMG/M
3300032076|Ga0306924_12037689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia590Open in IMG/M
3300032160|Ga0311301_10160821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4012Open in IMG/M
3300032160|Ga0311301_10856492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium1234Open in IMG/M
3300032160|Ga0311301_11801124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium729Open in IMG/M
3300032160|Ga0311301_12519510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia574Open in IMG/M
3300032770|Ga0335085_10631717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium1200Open in IMG/M
3300032782|Ga0335082_11555331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia533Open in IMG/M
3300032783|Ga0335079_10497350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium1301Open in IMG/M
3300032805|Ga0335078_10371465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1891Open in IMG/M
3300032828|Ga0335080_11662035Not Available627Open in IMG/M
3300032892|Ga0335081_10056994All Organisms → cellular organisms → Bacteria6080Open in IMG/M
3300032892|Ga0335081_11458638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium761Open in IMG/M
3300032892|Ga0335081_11525576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium738Open in IMG/M
3300032954|Ga0335083_10853338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → unclassified Micrococcales → Micrococcales bacterium726Open in IMG/M
3300032955|Ga0335076_11204218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia641Open in IMG/M
3300032955|Ga0335076_11530926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia554Open in IMG/M
3300033290|Ga0318519_10859096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia560Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil24.11%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil12.77%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil7.80%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland6.38%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment5.67%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.96%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.55%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.55%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.84%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.84%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.13%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.13%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.42%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.42%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.42%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.42%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.42%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.71%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.71%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.71%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.71%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.71%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.71%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.71%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.71%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.71%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006577Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012507Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610Host-AssociatedOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300020150Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MGEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021361Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2Host-AssociatedOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022521Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24EnvironmentalOpen in IMG/M
3300025453Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026872Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 74 (SPAdes)EnvironmentalOpen in IMG/M
3300027795Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028801Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3EnvironmentalOpen in IMG/M
3300028806Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030056Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12269J14319_1031049833300001356Peatlands SoilMTAATSAVPTQDEQLRIRGLRIHAQIRGEGEPLLLYSGIWGE
Ga0062387_10036520913300004091Bog Forest SoilMTAGTPVAPVRDEQLRIKGLRIHAQIRGEGEPLLLYSGLWAEVGLWEQLLPHLDGFRTIA
Ga0070661_10137149523300005344Corn RhizosphereMTAVTSAAPVRDVQLRIRGLRIHAQVHGEGEPLLLYSGIWGEVRLW
Ga0070714_10012733833300005435Agricultural SoilMTTVTPAAPARDVQLRIRGLRIHAQVHGEGEPLLLYSGIWGE
Ga0070714_10144506913300005435Agricultural SoilMTAATLAGPARDVQLRIRGLRIHAQVHGEGEPLLLYSGIWGEVRLWDRLLPHLAGFQTIA
Ga0070710_1106697923300005437Corn, Switchgrass And Miscanthus RhizosphereMTTATSAAPVRDVQLRIRGLRIHAQVHGEGEPLLLYSGIWGEVRLW
Ga0070711_10147752723300005439Corn, Switchgrass And Miscanthus RhizosphereMTTATSAAPVRDVQLRIRGLRIHAQVHGEGEPLLLYSGIWGEVRLWDR
Ga0070706_10042531323300005467Corn, Switchgrass And Miscanthus RhizosphereMTTAASVAPVKDVALNIRGLRIHAQVCGEGEPLLLYSGIWGEVRLWE
Ga0070735_1026959613300005534Surface SoilMGDASIAMPVRHEQFRIRGLRIHAQISGEGEPLLLYSGIWG
Ga0070704_10035991913300005549Corn, Switchgrass And Miscanthus RhizosphereMTAGTSVAPVKDEQLRIRGLRIHAQIRGEGEPLLLFSGIW
Ga0068856_10170881313300005614Corn RhizosphereMTTATPVAPARDVQLRIRGLRIHAQVHGAGEPLLLYSGIW
Ga0075015_10097790923300006102WatershedsMADATIAMPVRHEQFRIRGLRIHAQICGEGEPLLL
Ga0075015_10104007523300006102WatershedsMTAVTSAVPTQDEQLRIRGLRIHAQIRGEGEPLLLYSGIWG
Ga0075030_10068330833300006162WatershedsMTAATSAVPARDEQLRIRGLRIHAQIRGEGEPLLLYSGIW
Ga0075014_10047554413300006174WatershedsMTATSAVPTQDEQLRIRGLRIHAQIRGEGEPLLLYSGIWGEVGLWERLLP
Ga0070712_10002625713300006175Corn, Switchgrass And Miscanthus RhizosphereMTTVTSATPGRDVQLRIRGLRIHAQVHGEGEPLLLYSGIWGE
Ga0070765_10087450123300006176SoilMTAATSVAPVRDEQLRIRGLRIHAQIRGEGEPLLLFSGV
Ga0070765_10112038613300006176SoilMTAATSAAQVRDEQLSIRGLRIHAQIRGEGEPLLLFSGIWGEVGLW
Ga0074050_1091017823300006577SoilMTAVTSAAPVRDVQLRIRGLRIHAQVHGEGEPLLL
Ga0079222_1003120133300006755Agricultural SoilMTTTTSAEPARDVQLRIRGLRIHAQVHGEGEPLLLYSGIWGEVRLWDRLLP
Ga0079222_1040871133300006755Agricultural SoilMTTVTSAAPRRDVQLRIRGLRIHAQVHGEGAPLLLYSGIWGEVRLWERLLPHLAGFQTI
Ga0079222_1165603313300006755Agricultural SoilMTATTSVAPARDVQLRIRGLRIHARVHGEGEPLLLYSGIW
Ga0079221_1035282733300006804Agricultural SoilMTTVTSAAPGGDVQLRIRGLRIHAQVHGEGAPLLLYSGIWGEVRLWERL
Ga0116222_126679813300009521Peatlands SoilMAEATSVMPIRHEQFRIRGLRIHAQIRGEGEPLLLYSGLFGEARLWERLHPHLPGFQTIAFDPPGI
Ga0116222_126752113300009521Peatlands SoilMAEPTFVVPVRHEQFRIRGLRIHAQVRGEGEPLLLYSGLFGEARLWERLHPHLPGFQTIAFDPPGI
Ga0116222_133843613300009521Peatlands SoilMTAAAPTRDEQLRIRGLRIHAQIRGEGEPLLLYSGIWGEVGLWDQLL
Ga0116220_1030779213300009525Peatlands SoilMTIDYPQLAHQQIRVNGLRIHVQTCGEGDPLLLYSGIWGEVLLWEHLLPHLRGFRTIAFD
Ga0116220_1052309713300009525Peatlands SoilMTAVTSAVPTRDEQLRIRGLRIHAQIRGEGEPLLLYSGIWGEVGLWE
Ga0116216_1006551733300009698Peatlands SoilMTTATSAVPTRDEQLRIRGLRIHAQIRGEGEPLLLYSGIWGEVGLWEQLLP
Ga0116216_1051134723300009698Peatlands SoilMTTATSAVPTKDEQLRIRGLRIHAQIRGEGEPLLLYSGIWGEVGLWEQLLP
Ga0116216_1066993923300009698Peatlands SoilMTAATSAVPTQDEQLRIRGLRIHAQIRGEGEPLLLYSGIWGEVGLWERLLP
Ga0116217_1048860613300009700Peatlands SoilLTVAPSAAPTRDEQLSIRGLRIHAQIRGEGEPLLLYSGIWGEVGLWEQLLPHLAGF
Ga0116217_1079711313300009700Peatlands SoilMPHRTHRQLRIRGQKIHAQICGTGDPLLLYSGIWGEVHLWDSLLPYLTGFQA
Ga0116217_1083825013300009700Peatlands SoilMTATSAVPTQDEQLRIRGLRIHAQIRGEGEPLLLYSGIWGEVGLWERLLPHLDGFRTIA
Ga0116219_1006495613300009824Peatlands SoilMAEPTFVVPVRHEQFRIRGLRIHAQVRGEGEPLLLYSGL
Ga0134125_1027474533300010371Terrestrial SoilMTAVTSAAPVRDVQLRIRGLRIHAQVHGEGEPLLLYSGIWGEVRLWDRLLPHLAGF
Ga0134128_1019885343300010373Terrestrial SoilMTAVTSAAPVRDVQLRIRGLRIHAQVHGEGEPLLLYSGIWGEVRLWD
Ga0136449_10326362723300010379Peatlands SoilMTAATSAAPVRDEQLRVRGLRIHAQIRGEGEPLLLFSGIWGEVGLWEQLLPHL
Ga0126361_1040390813300010876Boreal Forest SoilMTAGTSAAPVRDEQLSIKGLRIHTQIRGEGEPLLLF
Ga0137379_1131137313300012209Vadose Zone SoilMTAVTSAAPVRDVQLRIRGLRIHAQVHGEGEPLLLYSGI
Ga0137387_1004618343300012349Vadose Zone SoilMAVSGSAPQVTNEQLRIRGLRVHIQMRGEGEPLLLYSGIWGEV
Ga0137371_1087965413300012356Vadose Zone SoilMTATAAAPGARITHEQLRINGLRIHAQICGEGEPLL
Ga0157342_105173013300012507Arabidopsis RhizosphereMTTVTSAAPVRDVQLRIRGLRIHAQVHGEGEPLLLYSGIWGEVRLWER
Ga0164309_1090142013300012984SoilMTAATSVAPVRDEQLRIKGLRIHAQIRGEGEPLLLFS
Ga0157376_1111164813300014969Miscanthus RhizosphereMTAATSVAPVTDEQLRIRGLRIHAQIRGEGEPLLLFSGIWGEVGLWEQLLPHLRGFRTIA
Ga0182041_1057430323300016294SoilMTATTSVAPVRDVQLRIRGLRIHAQVHGEGEPLLLYSGIWGE
Ga0182034_1170044423300016371SoilMTAATSVAPARDVQLRIRGLRIHAQVHGEGEPLLLYSGIW
Ga0187812_104437213300017821Freshwater SedimentMAEATFVTPVRHEQFRIRGLRIHAQVRGEGEPLLLYSG
Ga0187820_119727423300017924Freshwater SedimentMTTTSAAPIPPVSDVQLRIRGLRIHAQICGEGEPLLLYSGIWG
Ga0187806_106598523300017928Freshwater SedimentMTAATSAVPVRHEQLRIRGLRIHAQICGEGEPLLLYSGIWGEVGLWDRLLPYLDGFQT
Ga0187808_1047826823300017942Freshwater SedimentMAEATSVMPVRHEQFRIRGLNIHAQIRGEGEALLLYSGLFGEARLWERLHPH
Ga0187819_1025981723300017943Freshwater SedimentMAEATSVMPIRHEQFRIRGLRIHAQIRGEGEPLLLYSGLFGEARLWERLHPHLPG
Ga0187785_1027696123300017947Tropical PeatlandMTATAAAPGARITHEQLRINGLRIHAQICGEGEPLLLFSGVWGEVGLWDGLLPH
Ga0187780_1118505913300017973Tropical PeatlandMPVATSALPVRHEQLRIRGLRVHAQICGEGEPLLLYSGIWGEVGLWDGLLPY
Ga0187777_1055872713300017974Tropical PeatlandVTATRAAPAAPIIHEQLRINGLRIHAQICGEGEPLLLFSGVWGEVGLWDGLLPHLPGFRT
Ga0187777_1111722023300017974Tropical PeatlandMTATAPVPLPQIRDEQLRIKGLRIHAQICGEGEPLL
Ga0187823_1027334223300017993Freshwater SedimentMTTTSAAPIPPVSDVQLRIRGLRIHAQICGEGEPLLLYSGIWGEVGLWE
Ga0187815_1048900413300018001Freshwater SedimentMAEATSVMPIRHEQFRIRGLRIHAQIRGEGEPLLLYSGIWGEVGLWERLLPHLPGFQTI
Ga0187805_1016791513300018007Freshwater SedimentMAEATSVMPVRHEQFRIRGLRIHAQVRGEGEPLLLYSGLFGEARLWERLHP
Ga0187863_1068436213300018034PeatlandMSAANSAKPVTDEQLSIRGLRIHAQIRGEGEPLLLFSGIWGEVG
Ga0187875_1012717413300018035PeatlandMTAGTSAAPVRDEQLSIKGLRIHAQIRGEGEPLLLYSGIWGEVGLWEQLLPHLD
Ga0187875_1039559013300018035PeatlandMSAANSAKPVTDEQLSIRGLRIHAQIRGEGEPLLLFSGIWGEVGLWDQ
Ga0187765_1028860813300018060Tropical PeatlandMTAATSAASARDVQLRIRGLRIHAQVHGDGEPLLLYSGI
Ga0187772_1004517933300018085Tropical PeatlandMAEATFAMPVRHEKFLIRGLRIHTQICGEGEPLLLYSGIWGEVRLW
Ga0187772_1051244023300018085Tropical PeatlandMTAATSVAPVRHEQLRIRGLRIHAQICGEGEPLLLYSGIWGEVGLWDRLLPYLDGFQTIAFD
Ga0187770_1149767223300018090Tropical PeatlandMAEATFAMPVRHEKFLIRGLRIHTQICGEGEPLLLYSGIWGEVRLWERLLPHLP
Ga0187768_116315813300020150Tropical PeatlandMAEATTAMPVRDVQFRIRGLRIHAQIRGEGEPLLLYSGIFGELRLWELLLPHLPGFQTIAFDP
Ga0210399_1042026513300020581SoilMTAATSAAQVRDEQLSIRGLRIHAQIRGEGEPLLLF
Ga0210405_1124740013300021171SoilMTAATSVAPVRDEQLRIKGLRIHAQIRGEGEPLLLFSGIWGEVGLWE
Ga0213872_1045975713300021361RhizosphereMAEATTAMPVRDQQFRIRGLRIHAQICGEGEPLLLYSGI
Ga0213874_1008231123300021377Plant RootsMPVATSAASARHEQLSVRGLRVHAQICGEGEPLLLYSGIWGEVGLWDGL
Ga0210397_1068449013300021403SoilMTAATSIAPVRDEQLRIKGLRIHAQIRGEGEPLLLFSGIWGEVGLWEQLLPHLRGFRTIA
Ga0210386_1106609413300021406SoilMTAATSAGQVRDEQLSIRGLRIHAQIRGEGEPLLLFSGIWGEVGLWEQLLPHLR
Ga0210402_1041717813300021478SoilMTAATSVAPVRDEQLRIKGLRIHAQIRGEGEPLLLFSGIWGEVGLWEQ
Ga0210402_1131077623300021478SoilMTAATSIAPVRDEQLRIKGLRIHAQIRGEGEPLLLFSGIWGEVGLWEQ
Ga0224541_103993513300022521SoilMTAATSAAPVRDEQLSIKGLRIHTQIRGEGEPLLLYSGIWGEVGLWEQLLPHLDGFRTIAFD
Ga0208455_106188613300025453PeatlandMTPAASGMQITHRQLRIRGLRIHVQTCGVGEPLLLYSGIWGEVKLWESL
Ga0207692_1081173523300025898Corn, Switchgrass And Miscanthus RhizosphereMTTATSAAPVRDVQLRIRGLRIHAQVHGEGEPLLLYSGIWGEVRLWDRLLP
Ga0207693_1004120613300025915Corn, Switchgrass And Miscanthus RhizosphereMTAVTSAAPVRDVQLRIRGLRIHAQVHGEGEPLLLYSGIWGEVRLWDRLLP
Ga0207693_1016331813300025915Corn, Switchgrass And Miscanthus RhizosphereMTTVTSATPGRDVQLRIRGLRIHAQVHGEGEPLLLYSGIWGEIRLWDRLLPHLAGFQTIAFDPPGI
Ga0207690_1100871723300025932Corn RhizosphereMTAVTSAAPVRDVQLRIRGLRIHAQVHGEGEPLLLYSGIWGEVRLWDRLLPHLAGFQ
Ga0207785_102400313300026872Tropical Forest SoilMAEATTVMPVRHERFRIHGLRIHAQICGEGMPLLLYSGI
Ga0209139_1023967513300027795Bog Forest SoilMTAATSAAQVRDEQLSIRGLRIHAQIRGEGEPLLLYSGIWGEVGLWEQLLP
Ga0209693_1016123023300027855SoilMTAATSVAPVRDEQLRVRGLRIHAQIRGEGEPLLLYSGIWGEVGLWEQLLPHLDGSARSPSTRRASA
Ga0209624_1086942523300027895Forest SoilMTAATSGAQVRDEQLSIKGLRIHAQVRGEGEPLLLFSGI
Ga0209006_1051362213300027908Forest SoilMTAATSGAQVRDEQLSIKGLRIHAQIRGEGEPLLLFSGIW
Ga0209698_1088827823300027911WatershedsMADATIAMPVRHEQFRIRGLRIHAQICGEGEPLLLYSGIWGQVGLW
Ga0302226_1017569513300028801PalsaMTAATSAAPVRDEQLSIKGLRIHTQIRGEGEPLLLYSGIWGEVGLWEQLLPHLDGFRT
Ga0302221_1034724923300028806PalsaMTAATSAAPVRDEQLSIKGLRIHTQIRGEGEPLLLYSGIWGE
Ga0308309_1102302323300028906SoilMTAATSAAQVRDEQLSIRGLRIHAQIRGEGEPLLLFSGIWGEVGLWEQLLPHLRGFRTIAFD
Ga0302181_1000553083300030056PalsaMTATSAAPVRDEQLNIRGLRIHAQIRGEGEPLLLYS
Ga0302183_1008983833300030509PalsaMTAVTSAAPVRDEQLSINGLRIHAQIRGEGEPLLLYSGIWGEVGLW
Ga0302180_1012432733300031028PalsaMTAVTSAAPVRDEQLSIRGLRIHAQIRGEGEPLLLFSGIWGEVGLWER
Ga0318516_1013248523300031543SoilMPAATSAAPVRHEQLRIRGLRIHAQICGEGEPLLLYSGIWGEVG
Ga0318571_1035082813300031549SoilMAEVTTVMPIRHEQFRIRGLRIHAQICGEGEPLLLYSGIWGE
Ga0318574_1021675113300031680SoilMTAATSVAPARDVQLRIRGLRIHAQVHGEGEPLLLYSGIWGEVCL
Ga0318574_1070736523300031680SoilMTAAPMTASGSGQDVPTEDVQVRFRGLRIHAQVRGEGEPLLLYSGIWGEVRLWDRL
Ga0318496_1068761023300031713SoilMTAAVPTEDVQLRFRGLRIHAQVSGEGEPLLLYSGIWGEVGLW
Ga0318496_1083096823300031713SoilLTAVVSAVPAQDVQLRIRGLRIHAQVHGEGEPLLLYSGIWGEVRLWERLLPY
Ga0306917_1116631913300031719SoilMTVTASAAPVRHEQLRIRGLRIHAQICGEGEPLLLYSGIWGEVGLWDRLLPYL
Ga0306918_1032593123300031744SoilMTAATSVAPARDVQLRIRGLRIHAQVHGDGEPLLLYSGIWG
Ga0306918_1132664713300031744SoilMTAAVPTEDVQLRFRGLRIHAQVSGEGEPLLLYSGIWGE
Ga0318502_1057263623300031747SoilMTAATSVAPARDVQLRIRGLRIHAQVHGEGEPLLLYSGIWGEVCLWER
Ga0318502_1059372823300031747SoilMTAAISVAPARDVQLRIRGLRIHAQVRGEGEPLLLYS
Ga0318509_1048463823300031768SoilMTAATSVAPARDVQLRIRGLRIHAQVHGDGEPLLLYSGIWGE
Ga0318521_1071516223300031770SoilMTAATSVAPARDVQLRIRGLRIHAQVHGDGEPLLLYSGIWGEVRLWDGL
Ga0318498_1030446623300031778SoilMTAAVPTEDVQLRFRGLRIHAQVSGEGEPLLLYSGIWGEVGLCNDC
Ga0318547_1099602613300031781SoilMTATGPAEDVQLRIRGLRIHAQVRGEGQPLLLYSGIWGEVRLWERLLPHLAG
Ga0318565_1024631613300031799SoilMTATGPAEDVQLRIRGLRIHAQVRGEGQPLLLYSGIW
Ga0318568_1095244413300031819SoilMTAAVPTEDVQLRFRGLRIHAQVSGEGEPLLLYSGIWGEVGLCND
Ga0318567_1026396123300031821SoilMAEATTAMPVRHEQFRIRGLRIHAQIRGEGEPLLLYSGIWGEVGLWERLLPHLPGFR
Ga0318564_1012244913300031831SoilMTVTASAAPVRHEQLRIRGLRIHAQICGEGEPLLLYSGIWGEVGLWDRLLPYLDGFQTIA
Ga0310917_1074190923300031833SoilMTAATSVAPARDVQLRIRGLRIHAQVHGEGEPLLLYSGI
Ga0318517_1002781633300031835SoilMTAATSAAPARDVQLRIGGLRIHAQVHGEGEPLLLY
Ga0318495_1037465613300031860SoilMTAATSVAPARDVQLRIRGLRIHAQVHGEGEPLLLYSGIWGEVCLWERLLPH
Ga0306925_1171356423300031890SoilMTAATSVAPARDVQLRIRGLRIHAQVHGEGEPLLLYSGIWGE
Ga0310913_1121484623300031945SoilMAEATTAMPVRHEQFRIRGLRIHAQIRGEGEPLLLYSGIW
Ga0318563_1030351813300032009SoilMPVATSAAPVRHEQLRIRGLRIHAQICGEGEPLLLYSGIWGEVG
Ga0318506_1028635913300032052SoilMTAAISVAPARDVQLRIRGLRIHAQVRGEGEPLLLYSGIWGEVR
Ga0318570_1035419313300032054SoilMTAATSVAPARDVQLRIRGLRIHAQVHGEGEPLLLYSGIWGEVCLWEQLLPH
Ga0318505_1005439513300032060SoilMTAATSAAPARDVQLRIGGLRIHAQVHGEGEPLLLYSGIWGEVRLWERLLPHLAGFQTMA
Ga0318505_1052796923300032060SoilMTVTASAAPVRHEQLRIRGLRIHAQICGEGEPLLLYSGIWGEVGLWDRLLP
Ga0318510_1051159823300032064SoilMTAAISVAPARDVQLRIRGLRIHAQVRGEGEPLLLYSGIWGEVRLWERLLPH
Ga0318553_1028137813300032068SoilMADTTSAPPVRDVQFHIRGLRIHAQICGEGEPLLLYS
Ga0306924_1203768923300032076SoilMTATGPAEDVQLRIRGLRIHAQVRGEGPPLLLYSGIWGEVRLWERLLP
Ga0311301_1016082143300032160Peatlands SoilMTAATSAVPTQDEQLRIRGLRIHAQIRGEGEPLLLYSGIWGEVGLWERLLPHLDGFRTIA
Ga0311301_1085649223300032160Peatlands SoilMTATSAVPTQDEQLRIRGLRIHAQIRGEGEPLLLYSGIWGEVGLWERLLPHLDGFRTIAF
Ga0311301_1180112413300032160Peatlands SoilMAEIMSVPPVQDERFLIRGLHIHARIRGEGEPLLLYSGIWGQVSLWDRLLP
Ga0311301_1251951023300032160Peatlands SoilMTTATSAVPTKDEQLRIRGLRIHAQIRGEGEPLLLYSGIWGEVGLWEQLLPH
Ga0335085_1063171723300032770SoilMTAATSVAPARDVQLRIRGLRIHAQVHGEGEPLLLYSGIWGEVRLWE
Ga0335082_1155533113300032782SoilLTAVIPAVPTRDVQLRIRGLRIHAQVHGEGEPLLLYSGIWGEVRLWDRLLPHLAG
Ga0335079_1049735013300032783SoilMTATPASSGVTHEQLRIHGLRIHAQIRGSGEPLLLFSGVWGEVGLWDGLLPYLPGFQTIAFDPP
Ga0335078_1037146523300032805SoilMNLTTATPVPPVRDEQLRINGLRIHAQIRGEGEPLLLYSGIWGEVGLWERLLPYLPGFQT
Ga0335080_1166203513300032828SoilMTTAASTVPTEDVQLRIRGLRIHAQVCGEGEPLLLYSGIWGEV
Ga0335081_1005699453300032892SoilMAPTVAAPEITDVQLRIRGLRIHAQVSGSGEPLLLYSGIWGEVQLWRPLLPYLDQF
Ga0335081_1145863813300032892SoilMTATGPAAPLRHEQVRIQGLRTHVQICGEGEPLLLYSGVWGEVGLWERLL
Ga0335081_1152557613300032892SoilMTAATAVAPARDVQLRIRGLRIHAQVHGEGEPLLLYSG
Ga0335083_1085333823300032954SoilMTIATSVAPARDVQLRIRGLRIHAQVHGEGEPLLLYSGIWGEVRLWERLLPYLA
Ga0335076_1120421813300032955SoilMTAATAVAPARDVQLRIRGLRIHAQVHGEGEPLLLYSGIWGEVRLWDRLLPYLAGFQTI
Ga0335076_1153092613300032955SoilMTAAPMTGTGPAEDVPTEDVQLRYRGLRIHAQVRGEGEPLLLYSGIWGEVRLWERLLP
Ga0318519_1085909613300033290SoilMTAATSVAPARDVQLRIRGLRIHAQVRGEGEPLLLYSGIWGEVRLW


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.