Basic Information | |
---|---|
Family ID | F053403 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 141 |
Average Sequence Length | 44 residues |
Representative Sequence | LIINAMQLLQAEEMITVAVVLFAFAALANALLLWIEHRLHRRV |
Number of Associated Samples | 122 |
Number of Associated Scaffolds | 141 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.71 % |
% of genes near scaffold ends (potentially truncated) | 98.58 % |
% of genes from short scaffolds (< 2000 bps) | 88.65 % |
Associated GOLD sequencing projects | 114 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.56 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (89.362 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.950 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.950 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.028 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.75% β-sheet: 0.00% Coil/Unstructured: 42.25% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 141 Family Scaffolds |
---|---|---|
PF00903 | Glyoxalase | 19.15 |
PF05014 | Nuc_deoxyrib_tr | 8.51 |
PF02611 | CDH | 5.67 |
PF01979 | Amidohydro_1 | 4.26 |
PF03401 | TctC | 3.55 |
PF00128 | Alpha-amylase | 3.55 |
PF12681 | Glyoxalase_2 | 3.55 |
PF14759 | Reductase_C | 3.55 |
PF01977 | UbiD | 2.84 |
PF11941 | DUF3459 | 2.13 |
PF03992 | ABM | 2.13 |
PF13356 | Arm-DNA-bind_3 | 1.42 |
PF13545 | HTH_Crp_2 | 1.42 |
PF07883 | Cupin_2 | 1.42 |
PF03466 | LysR_substrate | 0.71 |
PF13187 | Fer4_9 | 0.71 |
PF01381 | HTH_3 | 0.71 |
PF00589 | Phage_integrase | 0.71 |
PF06724 | DUF1206 | 0.71 |
PF13518 | HTH_28 | 0.71 |
PF00027 | cNMP_binding | 0.71 |
PF09084 | NMT1 | 0.71 |
PF00892 | EamA | 0.71 |
PF00571 | CBS | 0.71 |
PF02775 | TPP_enzyme_C | 0.71 |
PF00682 | HMGL-like | 0.71 |
PF01145 | Band_7 | 0.71 |
PF03724 | META | 0.71 |
PF02624 | YcaO | 0.71 |
COG ID | Name | Functional Category | % Frequency in 141 Family Scaffolds |
---|---|---|---|
COG3613 | Nucleoside 2-deoxyribosyltransferase | Nucleotide transport and metabolism [F] | 8.51 |
COG2134 | CDP-diacylglycerol pyrophosphatase | Lipid transport and metabolism [I] | 5.67 |
COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 3.55 |
COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 3.55 |
COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 3.55 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 3.55 |
COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 3.55 |
COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 2.84 |
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.71 |
COG1944 | Ribosomal protein S12 methylthiotransferase accessory factor YcaO | Translation, ribosomal structure and biogenesis [J] | 0.71 |
COG3187 | Heat shock protein HslJ | Posttranslational modification, protein turnover, chaperones [O] | 0.71 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.71 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 89.36 % |
Unclassified | root | N/A | 10.64 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000580|AF_2010_repII_A01DRAFT_1024593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 949 | Open in IMG/M |
3300000789|JGI1027J11758_12079342 | Not Available | 539 | Open in IMG/M |
3300000837|AP72_2010_repI_A100DRAFT_1006897 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1610 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100888089 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
3300004082|Ga0062384_100512165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 797 | Open in IMG/M |
3300004268|Ga0066398_10013718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1248 | Open in IMG/M |
3300004268|Ga0066398_10224266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 505 | Open in IMG/M |
3300004463|Ga0063356_105162067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 561 | Open in IMG/M |
3300005187|Ga0066675_10014411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4285 | Open in IMG/M |
3300005332|Ga0066388_102796965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 891 | Open in IMG/M |
3300005332|Ga0066388_104572412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 704 | Open in IMG/M |
3300005355|Ga0070671_100972992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 743 | Open in IMG/M |
3300005365|Ga0070688_100546897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acetobacter → environmental samples → Acetobacter sp. CAG:267 | 880 | Open in IMG/M |
3300005436|Ga0070713_101481268 | Not Available | 658 | Open in IMG/M |
3300005447|Ga0066689_10041616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2417 | Open in IMG/M |
3300005529|Ga0070741_10966228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis → Candidatus Contendobacter odensis Run_B_J11 | 733 | Open in IMG/M |
3300005576|Ga0066708_10598615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 707 | Open in IMG/M |
3300005602|Ga0070762_11067137 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300005607|Ga0070740_10163312 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 955 | Open in IMG/M |
3300005607|Ga0070740_10232654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis → Candidatus Contendobacter odensis Run_B_J11 | 759 | Open in IMG/M |
3300005713|Ga0066905_100994503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 739 | Open in IMG/M |
3300005764|Ga0066903_101908388 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1138 | Open in IMG/M |
3300005836|Ga0074470_10805043 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
3300006038|Ga0075365_10122183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Tepidamorphaceae → Lutibaculum | 1797 | Open in IMG/M |
3300006176|Ga0070765_101194202 | Not Available | 718 | Open in IMG/M |
3300006176|Ga0070765_101700452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 593 | Open in IMG/M |
3300006606|Ga0074062_12515640 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
3300006853|Ga0075420_101885269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 511 | Open in IMG/M |
3300006904|Ga0075424_100333137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1616 | Open in IMG/M |
3300009162|Ga0075423_10033928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae | 5189 | Open in IMG/M |
3300009176|Ga0105242_11435111 | Not Available | 719 | Open in IMG/M |
3300009645|Ga0116106_1007846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4074 | Open in IMG/M |
3300009683|Ga0116224_10040559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2281 | Open in IMG/M |
3300009698|Ga0116216_10440418 | Not Available | 789 | Open in IMG/M |
3300010043|Ga0126380_10760908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 787 | Open in IMG/M |
3300010043|Ga0126380_11196663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 655 | Open in IMG/M |
3300010043|Ga0126380_11787990 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 555 | Open in IMG/M |
3300010046|Ga0126384_11380010 | Not Available | 656 | Open in IMG/M |
3300010046|Ga0126384_11555610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 621 | Open in IMG/M |
3300010048|Ga0126373_11629789 | Not Available | 710 | Open in IMG/M |
3300010301|Ga0134070_10006356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3629 | Open in IMG/M |
3300010336|Ga0134071_10596543 | Not Available | 577 | Open in IMG/M |
3300010358|Ga0126370_10164229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1636 | Open in IMG/M |
3300010358|Ga0126370_12215046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 542 | Open in IMG/M |
3300010359|Ga0126376_10462832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1162 | Open in IMG/M |
3300010359|Ga0126376_11825347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 646 | Open in IMG/M |
3300010361|Ga0126378_12364592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 607 | Open in IMG/M |
3300010366|Ga0126379_10882438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 996 | Open in IMG/M |
3300010379|Ga0136449_100804498 | All Organisms → cellular organisms → Bacteria | 1552 | Open in IMG/M |
3300010379|Ga0136449_102399085 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
3300010399|Ga0134127_13445371 | Not Available | 518 | Open in IMG/M |
3300011119|Ga0105246_10526590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1008 | Open in IMG/M |
3300012199|Ga0137383_10683647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 750 | Open in IMG/M |
3300012202|Ga0137363_11184097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 650 | Open in IMG/M |
3300012208|Ga0137376_10797575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 813 | Open in IMG/M |
3300012929|Ga0137404_10034925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3751 | Open in IMG/M |
3300012944|Ga0137410_11955745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 520 | Open in IMG/M |
3300012948|Ga0126375_11827622 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
3300012985|Ga0164308_12274068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 504 | Open in IMG/M |
3300014296|Ga0075344_1119919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 556 | Open in IMG/M |
3300014489|Ga0182018_10087510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1840 | Open in IMG/M |
3300014501|Ga0182024_11347137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 825 | Open in IMG/M |
3300015200|Ga0173480_10500819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 727 | Open in IMG/M |
3300015200|Ga0173480_11252266 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 504 | Open in IMG/M |
3300015372|Ga0132256_100387830 | Not Available | 1497 | Open in IMG/M |
3300015374|Ga0132255_103162912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acetobacter → environmental samples → Acetobacter sp. CAG:267 | 702 | Open in IMG/M |
3300016270|Ga0182036_10808156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 764 | Open in IMG/M |
3300016371|Ga0182034_10275757 | Not Available | 1337 | Open in IMG/M |
3300016371|Ga0182034_10315058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1259 | Open in IMG/M |
3300016404|Ga0182037_11682305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 565 | Open in IMG/M |
3300016422|Ga0182039_10830261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 822 | Open in IMG/M |
3300017959|Ga0187779_11021498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 574 | Open in IMG/M |
3300017970|Ga0187783_10368687 | Not Available | 1045 | Open in IMG/M |
3300017973|Ga0187780_10383097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 996 | Open in IMG/M |
3300017973|Ga0187780_11031183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 600 | Open in IMG/M |
3300017993|Ga0187823_10162408 | Not Available | 712 | Open in IMG/M |
3300018085|Ga0187772_10927735 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 633 | Open in IMG/M |
3300018089|Ga0187774_10373287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 858 | Open in IMG/M |
3300019786|Ga0182025_1103874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 721 | Open in IMG/M |
3300020582|Ga0210395_11271136 | Not Available | 539 | Open in IMG/M |
3300021168|Ga0210406_10128046 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2142 | Open in IMG/M |
3300021168|Ga0210406_10525935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 932 | Open in IMG/M |
3300021171|Ga0210405_10112222 | All Organisms → cellular organisms → Bacteria | 2152 | Open in IMG/M |
3300021404|Ga0210389_10691723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 799 | Open in IMG/M |
3300021432|Ga0210384_10303570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Tepidamorphaceae → Lutibaculum | 1437 | Open in IMG/M |
3300021475|Ga0210392_11055210 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300021477|Ga0210398_10499288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 991 | Open in IMG/M |
3300021560|Ga0126371_11695793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 756 | Open in IMG/M |
3300024288|Ga0179589_10619875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 508 | Open in IMG/M |
3300025931|Ga0207644_11342745 | Not Available | 601 | Open in IMG/M |
3300025936|Ga0207670_11595081 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300027706|Ga0209581_1261948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 527 | Open in IMG/M |
3300027855|Ga0209693_10030433 | All Organisms → cellular organisms → Bacteria | 2629 | Open in IMG/M |
3300027874|Ga0209465_10590785 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300027884|Ga0209275_10750929 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300027911|Ga0209698_10058434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3343 | Open in IMG/M |
3300028881|Ga0307277_10559771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 513 | Open in IMG/M |
3300028906|Ga0308309_11127804 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 677 | Open in IMG/M |
3300030706|Ga0310039_10311966 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
3300031249|Ga0265339_10102821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 1485 | Open in IMG/M |
3300031545|Ga0318541_10466556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 706 | Open in IMG/M |
3300031549|Ga0318571_10122319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 874 | Open in IMG/M |
3300031561|Ga0318528_10350582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 792 | Open in IMG/M |
3300031564|Ga0318573_10734006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 531 | Open in IMG/M |
3300031640|Ga0318555_10376367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 769 | Open in IMG/M |
3300031668|Ga0318542_10530786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 612 | Open in IMG/M |
3300031681|Ga0318572_10152896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1333 | Open in IMG/M |
3300031723|Ga0318493_10792407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 534 | Open in IMG/M |
3300031726|Ga0302321_100688266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1146 | Open in IMG/M |
3300031748|Ga0318492_10084337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1541 | Open in IMG/M |
3300031770|Ga0318521_10781166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 581 | Open in IMG/M |
3300031792|Ga0318529_10460797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 591 | Open in IMG/M |
3300031793|Ga0318548_10111504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1317 | Open in IMG/M |
3300031795|Ga0318557_10580213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 514 | Open in IMG/M |
3300031796|Ga0318576_10187982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 970 | Open in IMG/M |
3300031796|Ga0318576_10412184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 638 | Open in IMG/M |
3300031799|Ga0318565_10403562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 662 | Open in IMG/M |
3300031832|Ga0318499_10017660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa | 2440 | Open in IMG/M |
3300031833|Ga0310917_10105521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1819 | Open in IMG/M |
3300031879|Ga0306919_10954111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 656 | Open in IMG/M |
3300031890|Ga0306925_10027704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 5739 | Open in IMG/M |
3300031897|Ga0318520_10736183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 617 | Open in IMG/M |
3300031912|Ga0306921_10260605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2031 | Open in IMG/M |
3300031946|Ga0310910_11523244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
3300031981|Ga0318531_10037074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2027 | Open in IMG/M |
3300032039|Ga0318559_10111925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1217 | Open in IMG/M |
3300032041|Ga0318549_10480248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 559 | Open in IMG/M |
3300032041|Ga0318549_10480269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 559 | Open in IMG/M |
3300032054|Ga0318570_10197987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 907 | Open in IMG/M |
3300032054|Ga0318570_10506987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 550 | Open in IMG/M |
3300032059|Ga0318533_10920263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 641 | Open in IMG/M |
3300032060|Ga0318505_10369698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 677 | Open in IMG/M |
3300032064|Ga0318510_10200891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 805 | Open in IMG/M |
3300032090|Ga0318518_10687627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 520 | Open in IMG/M |
3300032160|Ga0311301_10279419 | All Organisms → cellular organisms → Bacteria | 2705 | Open in IMG/M |
3300032160|Ga0311301_11670842 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300032205|Ga0307472_101666719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 629 | Open in IMG/M |
3300032805|Ga0335078_11095230 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
3300032805|Ga0335078_11661204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 703 | Open in IMG/M |
3300032828|Ga0335080_10555395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1213 | Open in IMG/M |
3300033134|Ga0335073_12100907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 512 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.95% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.67% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.96% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.96% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.26% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.26% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.84% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.84% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.84% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.13% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.42% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.42% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.42% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.42% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.42% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.42% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.71% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.71% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.71% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.71% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.71% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.71% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.71% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.71% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.71% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.71% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.71% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.71% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.71% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.71% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.71% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.71% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.71% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300014296 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1 | Environmental | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AF_2010_repII_A01DRAFT_10245931 | 3300000580 | Forest Soil | SLIINAMQLLQAEEMITVAVVLFAFAALANALLLWIEHRLHRRV* |
JGI1027J11758_120793421 | 3300000789 | Soil | IINAMQLLQGEELMTVALVLFLFAAFANALLLWIEHRLPRVA* |
AP72_2010_repI_A100DRAFT_10068974 | 3300000837 | Forest Soil | LAEMFAAKHGLGSLIINAMQLLQAEEMITIAVVLFVFAALANAMLLWIEHQLHRRV* |
JGIcombinedJ26739_1008880891 | 3300002245 | Forest Soil | QSEDMVTVAIILFVFAAIANALLLWIEHRLHRRV* |
Ga0062384_1005121652 | 3300004082 | Bog Forest Soil | LGLGAMIMNAMSLAQSEEMMTVAIVLFTFAAIANGILLFIEHRLHRRV* |
Ga0066398_100137183 | 3300004268 | Tropical Forest Soil | LIINAMQLMQAEEMVTIAVVLFAFAALANALLLWIEHQLHRRV* |
Ga0066398_102242661 | 3300004268 | Tropical Forest Soil | LIINAMQLLQAEEMITIAVVLFVFAALANALLLWIEHRLHRRV* |
Ga0063356_1051620671 | 3300004463 | Arabidopsis Thaliana Rhizosphere | INAMQLMQAEEMVTVAVVLFGFAAFANAMLLWIEHQLHPRV* |
Ga0066675_100144111 | 3300005187 | Soil | GLGSLIINAMQLMQAEEMLTVAVVLFTFAALANALLLWIEHRLHRRV* |
Ga0066388_1027969652 | 3300005332 | Tropical Forest Soil | AAKHGLGSLIINAMQLLQAEEMITIAVVLFVFAALANALLLWIEHQLHRRV* |
Ga0066388_1045724121 | 3300005332 | Tropical Forest Soil | EMFAAKHGLGSLIINAMQLLQAEEMITIAVVLFVFAALANAMLLWIEHQLHRRV* |
Ga0070671_1009729921 | 3300005355 | Switchgrass Rhizosphere | AKHGLGFLIINAMQMLQGEEMITVAVVLFVFAALANALLLWIEHRLHRGV* |
Ga0070688_1005468974 | 3300005365 | Switchgrass Rhizosphere | NAMQLLQNEEMITVALMLFLFAAVANALLLWLEHTLHRRG* |
Ga0070713_1014812682 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | GSLIINAMQLLQGEEMVSVALVLFAFAALANALLLFIEHRLHRRV* |
Ga0066689_100416161 | 3300005447 | Soil | LGFLIINAMQLLQTEEMVAVAVVLFAFAALANALLLWIEHRLHRRV* |
Ga0070741_109662281 | 3300005529 | Surface Soil | YGLGSLIINAMQLLQPEEMIAVTIVLFLFAVLANALLLFMEHKLHRRA* |
Ga0066708_105986151 | 3300005576 | Soil | QGLGSLIINAMQLLQAEEMVAVAVVLFAFAALANALLLWIEHRLHRRV* |
Ga0070762_110671371 | 3300005602 | Soil | AQSEDMVTVAIILFVFAAIANTLLLWIEHRLHRKV* |
Ga0070740_101633121 | 3300005607 | Surface Soil | AEMFAAKAGLGFLIINAMQLLQNREMVSVAIVLFGFAAAANALLLWIEHRLQRRA* |
Ga0070740_102326541 | 3300005607 | Surface Soil | FASKYGLGSLIINAMQLLQPEEMIAVTIVLFLFAVLANALLLFMEHKLHRRA* |
Ga0066905_1009945032 | 3300005713 | Tropical Forest Soil | NAMQLMQAEEMVTIAVVLFAFAALANAMLLWIEHQLHPRV* |
Ga0066903_1019083881 | 3300005764 | Tropical Forest Soil | LGFLIMNAMSLLQNEEMIAVAVLLFVFAALANALLLWAEHHLHPRV* |
Ga0074470_108050432 | 3300005836 | Sediment (Intertidal) | GFLIINAMSLAQSEEMLTVAIVLFTFAALANTFLLWIENRLHRRI* |
Ga0075365_101221832 | 3300006038 | Populus Endosphere | INAMQLMQAEEMLTVAVVLFAFAALANALLLWIEHRLHHRV* |
Ga0070765_1011942021 | 3300006176 | Soil | KLGLGSMIMNDMSLAQSEDMVTVAIILFVFAAIANTLLLWIEHRLHRKV* |
Ga0070765_1017004522 | 3300006176 | Soil | LAQSEDMVTVAIILFVFAAIANALLLWIEHRLHRRV* |
Ga0074062_125156402 | 3300006606 | Soil | LGFLIINAMQLMQAEEMVTIAVVLFVFAALANAMLLWIEHQLHPRV* |
Ga0075420_1018852692 | 3300006853 | Populus Rhizosphere | ISTVQPEEMLSVAIVLFSFAALANALLLWSEHRLYHRG* |
Ga0075424_1003331373 | 3300006904 | Populus Rhizosphere | AKHGLGFLIINAMQLMQAEEMVTVAVVLFGFAALANAMLLWIEHQLHPQV* |
Ga0075423_100339281 | 3300009162 | Populus Rhizosphere | EMFAAKHGLGFLIINAMQLMQAEEMVTIAVVLFGFAAFANAMLLWIEHQLHPRV* |
Ga0105242_114351112 | 3300009176 | Miscanthus Rhizosphere | LIINAMQMLQAEEMITVAVVLFVFAALANALLLWIEHRLHRRV* |
Ga0116106_10078465 | 3300009645 | Peatland | ASKLGLGSMIMSDMSLAQSEDMVTVAIILFVFAACANALLLWIEHRLHRKV* |
Ga0116224_100405591 | 3300009683 | Peatlands Soil | SLAQSEEMMTVAIVLFTFAAIANGVLLWIEHRLHRRV* |
Ga0116216_104404182 | 3300009698 | Peatlands Soil | SMIMSDMSLAQSEDMVTVAIILFVFAACANALLLWIEHRLHRKV* |
Ga0126380_107609081 | 3300010043 | Tropical Forest Soil | INAMQLMQAEEMVTVAVVLFAFAALANAILLWIEHQLHPRV* |
Ga0126380_111966631 | 3300010043 | Tropical Forest Soil | KHGLGSLIINAMQLLQAEEMITIAVVLFVFAALANALLLWIEHQLHRRV* |
Ga0126380_117879901 | 3300010043 | Tropical Forest Soil | IINAMQLLQAEEMITIAVVLFVFAALANAMLLWIEHQLHRRV* |
Ga0126384_113800102 | 3300010046 | Tropical Forest Soil | LMQAEEMLSVAVVLFAFAALANALLLWIEHRLHRRI* |
Ga0126384_115556102 | 3300010046 | Tropical Forest Soil | FLIINAMQLMQAEEMVTVAVVLFAFAALANAILLWIEHQLHPRV* |
Ga0126373_116297892 | 3300010048 | Tropical Forest Soil | GSLIINAMQLMQAEEMLSVAVVLFAFAALANALLLWIEHRLHRRI* |
Ga0134070_100063563 | 3300010301 | Grasslands Soil | KQGLGFLIINAMQLLQAEEMVAVAVVLFAFAALANALLLWIEHRLHRRV* |
Ga0134071_105965431 | 3300010336 | Grasslands Soil | LLQAEEMMTVAVVLFAFAALANALLLSIEHRLHRRV* |
Ga0126370_101642291 | 3300010358 | Tropical Forest Soil | NAMQLMQPEEMVTTAVVLFAFAALANALLLWIEHQLHRRV* |
Ga0126370_122150462 | 3300010358 | Tropical Forest Soil | NAMQLMQAEEMVTIAVVLFAFAALANALLLWIEHQLHPRV* |
Ga0126376_104628322 | 3300010359 | Tropical Forest Soil | MFAAKHGLGFLIINAMQLMQAEEMVTIAVVLFAFAALANALLLWIEHQLHRRV* |
Ga0126376_118253472 | 3300010359 | Tropical Forest Soil | FAAKHGLGFLIINAMQLMQAEEMVTVAVVLFAFAALANAILLWIEHQLHPRV* |
Ga0126378_123645922 | 3300010361 | Tropical Forest Soil | QAEEMITIAVVLFAFAALANALLLWIEHQLHRRV* |
Ga0126379_108824382 | 3300010366 | Tropical Forest Soil | AKHGLGFLIINAMQLLQTEEMLTVAVVLFVFAAVANALLLWFEHQLHRRT* |
Ga0136449_1008044985 | 3300010379 | Peatlands Soil | LGSMIMSDMSLAQSEDMVTVAIILFVFAAIANALLLWIEHRLHRRV* |
Ga0136449_1023990851 | 3300010379 | Peatlands Soil | LGLGSMIMSDMSLAQSEDMVTVAIILFVFAACANALLLWIEHRLHRKV* |
Ga0134127_134453712 | 3300010399 | Terrestrial Soil | GLGFLIINAMQMLQGEEMITVAVVLFVFAALANALLLWIEHRLHRRV* |
Ga0105246_105265903 | 3300011119 | Miscanthus Rhizosphere | VQNEEMITVAVVLFAFAAVANALLLWIDHRLFQRT* |
Ga0137383_106836472 | 3300012199 | Vadose Zone Soil | INAMQLMQAEEMVTIAVVLFGFAAFANAMLLWIEHQLHPRV* |
Ga0137363_111840971 | 3300012202 | Vadose Zone Soil | INAMQLMQAEEMITVAVVLFAFAALANALLLWIEHQLHRRV* |
Ga0137376_107975752 | 3300012208 | Vadose Zone Soil | IINAMQLMQAEEMVTIAVVLFAFAALANAMLLWIEHQLHPRV* |
Ga0137404_100349251 | 3300012929 | Vadose Zone Soil | AMQLLQAEEMMTVAVVLFAFAALANALLLWIEHRLHRRV* |
Ga0137410_119557452 | 3300012944 | Vadose Zone Soil | LIINAQSLLQTEEMLSVAIVLFVSAVLANSLLLWMEHRLHRRV* |
Ga0126375_118276221 | 3300012948 | Tropical Forest Soil | AKHGLGSLIINAMQLLQAEEMITIAVVLFVFAALANALLLWIEHQLHRRA* |
Ga0164308_122740681 | 3300012985 | Soil | LAEMFAAKHGLGFLIINAMQMLQAEEMITVAVVLFVFAALANALLLWIEHRLHGGV* |
Ga0075344_11199193 | 3300014296 | Natural And Restored Wetlands | FLIINAMQLLQTEEMLTVAVVLFLFAAAANGLLLWMEHHLHRRA* |
Ga0182018_100875101 | 3300014489 | Palsa | MFASKLGLGSMIMSDMSLAQSEDMVTVAIVLFAFAAIANALLLWIEHRLNGKV* |
Ga0182024_113471373 | 3300014501 | Permafrost | SMIMNDMSLAQSEDMVTVAIILFVFAAIANTLLLWIEHRLHRRV* |
Ga0173480_105008191 | 3300015200 | Soil | LGALIINAMQLLQNEEMVAVAIVLFLFAALANAVLLWIEHRLHRRV* |
Ga0173480_112522661 | 3300015200 | Soil | NAMALLQTEEMITVAIVLFVFAAAANALLLWMERQMHRRV* |
Ga0132256_1003878302 | 3300015372 | Arabidopsis Rhizosphere | INAMQMLQGEEMITVAVVLFVFAALANALLLWIEHRLHRGV* |
Ga0132255_1031629121 | 3300015374 | Arabidopsis Rhizosphere | AMQLLQAEEMVTVAVVLFVFAAAANALLLWMEHSLHRRT* |
Ga0182036_108081561 | 3300016270 | Soil | LLQGEEMITVAVVLFVFAALANAFLLWIEHRLHRGV |
Ga0182034_102757572 | 3300016371 | Soil | AKHGLGFLIINAMQLLQAEEMVTVALVLFVFAIAANALLLVIEHRLHRRV |
Ga0182034_103150582 | 3300016371 | Soil | NAMSLLQNEEMIAVAVLLFVFAALANALLLWAEHHLHPRV |
Ga0182037_116823052 | 3300016404 | Soil | AEMFAAKHGLGFLIINAMQLMQAEEMVTIAVVLFAFAALANALLLWVEHQLHRRV |
Ga0182039_108302612 | 3300016422 | Soil | LLQTQEMIAVAVFLFTFAALANALLLWLEHRLHRRV |
Ga0187779_110214981 | 3300017959 | Tropical Peatland | EMFASEHGLGSLIINAMQLLQNEEMITVAVVLFLFAALANSLLLWIEHHLHRRI |
Ga0187783_103686872 | 3300017970 | Tropical Peatland | LLQGEEMMTVTIVLFAFAAIANAVLLWIEHRLFEP |
Ga0187780_103830972 | 3300017973 | Tropical Peatland | AEMFASEHGLGSLIINAMQLLQNEEMITVAVVLFLFAALANSLLLWIEHHLHRRI |
Ga0187780_110311832 | 3300017973 | Tropical Peatland | SKQGLGFLIMNAMTLLQTEEMIAIAVLLFVFAAFANASLLWIEHRLYRRCDHEDV |
Ga0187823_101624082 | 3300017993 | Freshwater Sediment | GLGFLIINAMSLAQSEEMLAVAIVLFVFAALANAVLLSMEHRLHRRA |
Ga0187772_109277351 | 3300018085 | Tropical Peatland | TDMQLLQGEEMMTVTIVLFAFAAIANAVLLWIEHRLHRRV |
Ga0187774_103732871 | 3300018089 | Tropical Peatland | LIINAMQLLQNEEMITVAVVLFLFAALANSLLLWIEHHLHRRI |
Ga0182025_11038741 | 3300019786 | Permafrost | LIINAMTLLQTKEMISIAVVLFAFAAVANAILLWIEHRLHRRV |
Ga0210395_112711362 | 3300020582 | Soil | LGLGSMIMSDMSLAQSEDMVTVAIILFVFAACANALLLWIEHRLHRKI |
Ga0210406_101280464 | 3300021168 | Soil | LMQAEEMVTIAVVLFAFAALANAMLLWIEHRFHPRV |
Ga0210406_105259351 | 3300021168 | Soil | LLQGEEMLSVAVVLFAFAAVANALLLWIEHQLHRRV |
Ga0210405_101122221 | 3300021171 | Soil | LAQSEDMVTVAIILFVFAAIANALLLWIEHRLDRRV |
Ga0210389_106917233 | 3300021404 | Soil | FASKLGLGSMIMNDMSLAQSEDMVTVAIILFVFAAIANTLLLWIEHRLHRKV |
Ga0210384_103035702 | 3300021432 | Soil | SLIINAMQLMQAEEMLSVAVVLFAFAALANALLLWIEQRLHRRA |
Ga0210392_110552102 | 3300021475 | Soil | MSLAQSEDMVTVAIVLFVFAAIANALLLWVEHRLHRKV |
Ga0210398_104992881 | 3300021477 | Soil | GLGSMIMSDMSLAQSEDMVTVAIILFVFAAIANALLLWIEHRLHRRV |
Ga0126371_116957931 | 3300021560 | Tropical Forest Soil | GFLIINAMQLMQAEEMITIAVVLFAFAALANALLLWIEHQLHRRV |
Ga0179589_106198751 | 3300024288 | Vadose Zone Soil | INAMQLLQAEEMIAVAVVLFAFAALANALLLWIEHRLHRRV |
Ga0207644_113427452 | 3300025931 | Switchgrass Rhizosphere | HGLGFLIINAMQMLQGEEMITVAVVLFVFAALANALLLWIEHRLHRRV |
Ga0207670_115950811 | 3300025936 | Switchgrass Rhizosphere | AKHGLGFLIINAMQMLQGEEMITVAVVLFVFAALANALLLWIEHRLHRGV |
Ga0209581_12619481 | 3300027706 | Surface Soil | AEMFAAKAGLGFLIINAMQLLQNREMVSVAIVLFGFAAAANALLLWIEHRLQRRA |
Ga0209693_100304331 | 3300027855 | Soil | LGSMIMSDMSLAQSEDMVTVAIILFVFAAIANALLLWIEHRLHRRV |
Ga0209465_105907852 | 3300027874 | Tropical Forest Soil | MADRDYTAEEMMTVAVLLFAFAALANALLLWMEHRLHRRV |
Ga0209275_107509292 | 3300027884 | Soil | LGLGSMIMNDMSLAQSEDMVTVAIVLFVFAAIANALLLWVEHRLHRKV |
Ga0209698_100584345 | 3300027911 | Watersheds | SKLGLGSMIMNDMSLAQSEDMVTVAIILFVFAAIANALLLWIEHRLHRRV |
Ga0307277_105597711 | 3300028881 | Soil | LIMNAMQLLQAEEMITVAVVLFAFAALANALLLWIEHQLHGGA |
Ga0308309_111278042 | 3300028906 | Soil | TDMQLLQGEDMMTVTIVLFGFAAIANAALLWIEHRLHRRV |
Ga0310039_103119661 | 3300030706 | Peatlands Soil | DMSLAQSEDMVTVAIILFVFAACANALLLWIEHRLHRKV |
Ga0265339_101028213 | 3300031249 | Rhizosphere | LIINAMQMLQGQEMMAVTVVLFVFAVLANAGLLWMEHKLQHRA |
Ga0318541_104665562 | 3300031545 | Soil | MNAMSLLQNEEMIAVAVLLFVFAALANALLLWAEHYLHPRV |
Ga0318571_101223191 | 3300031549 | Soil | KHGLGFLIINAMQLMQAEEMVTVAVVLFAFAALANAILLWIEHQLHPRV |
Ga0318528_103505821 | 3300031561 | Soil | LIINAMQLLQAEEMITIAVVLFAFAALANALLLWIEHRLHRRV |
Ga0318573_107340061 | 3300031564 | Soil | NAMQLLQGEEMITVAVVLFVFAALANAFLLWIEHRLHRGV |
Ga0318555_103763672 | 3300031640 | Soil | AKHGLGFLIINAMQLMQAEEMVTIAVVLFAFAALANAMLLWIEHQLHPRV |
Ga0318542_105307862 | 3300031668 | Soil | AMQLLQAEEMITIAVVLFAFAALANALLLWIEHRLHRRV |
Ga0318572_101528962 | 3300031681 | Soil | INAMQLMQAEEMVTVAVVLFAFAALANAILLWIEHQLHPRV |
Ga0318493_107924071 | 3300031723 | Soil | YLLINAMQLLQGEEMMTVAIVLFGFAALANALMLAAEHRLHRRV |
Ga0302321_1006882661 | 3300031726 | Fen | IINAMQLLQAEEMITVALVLFAFAALANALLLWIEHQLHRRV |
Ga0318492_100843371 | 3300031748 | Soil | IINAMQLMQAEEMVTIAVVLFAFAALANAILLWIEHQLHPRV |
Ga0318521_107811661 | 3300031770 | Soil | FAAKHGLGFLIINAMQLMQAEEMVTVAVVLFAFAALANAILLWIEHQLHPRV |
Ga0318529_104607972 | 3300031792 | Soil | KHGLGFLIINAMQLMQAEEMVTVAVVLFAFAAFANAILLWIEHQLHPRV |
Ga0318548_101115042 | 3300031793 | Soil | GFLIINAMQLLQVEEMITVAVVLFVFAALANAFLLWIEHRLHRGV |
Ga0318557_105802131 | 3300031795 | Soil | GFLIINAMQLMQAEEMVTVAVVLFAFAALANAILLWIEHQLHPRV |
Ga0318576_101879821 | 3300031796 | Soil | HGLGFLIINAMQLLQGEEMITVAVVLFVFAALANAFLLWIEHRLHRGV |
Ga0318576_104121842 | 3300031796 | Soil | LGALIINAMQLMQAEEMVTIAVVLFAFAALANALLLWIEHRLHRRV |
Ga0318565_104035622 | 3300031799 | Soil | QLMQAEEMVTVAVVLFAFAALANAILLWIEHQLHPRV |
Ga0318499_100176603 | 3300031832 | Soil | INAMQLMQAEEMVTVAVVLFAFAAFANAILLWIEHQLHPRV |
Ga0310917_101055213 | 3300031833 | Soil | NAMTLLQTEEMIAIAVLLFVFAAFANASLLWIEHRLYRRV |
Ga0306919_109541111 | 3300031879 | Soil | MQAEEMVTVAVVLFAFAAFANAILLWIEHQLHPRV |
Ga0306925_100277044 | 3300031890 | Soil | MQLMQAEEMVTIAVVLFAFAALANAMLLWIEHQLHPRV |
Ga0318520_107361831 | 3300031897 | Soil | LIINAMQLLQAEEMITVAVVLFAFAALANALLLWIEHRLHRRV |
Ga0306921_102606051 | 3300031912 | Soil | LGFLIMNAMSLLQNEEMIAVAVLLFVFAALANALLLWAEHYLHPRV |
Ga0310910_115232441 | 3300031946 | Soil | FLIINAMLLMQAEEMVTVAVVLFAFAALANAILLWIEHQLHPRV |
Ga0318531_100370743 | 3300031981 | Soil | KHGLGFLIINAMQLLQGEEMITVAVVLFVFAALANAFLLWIEHRLHRGV |
Ga0318559_101119251 | 3300032039 | Soil | LIINAMQLMQAEEMVTVAVVLFAFAAFANAILLWIEHQLHPRV |
Ga0318549_104802482 | 3300032041 | Soil | LLQGEEMIGVAVLLFAFAALANALLLWFEHHLHRV |
Ga0318549_104802692 | 3300032041 | Soil | INAMQLMQAEEMVTIAVVLFAFAALANALLLWVEHQLHRRV |
Ga0318570_101979872 | 3300032054 | Soil | INAMQLMQAEEMVTIAVVLFAFAALANAMLLWIEHQLHPRV |
Ga0318570_105069872 | 3300032054 | Soil | LIINAMQLMQAEEMVTIAVVLFAFAALANALLLWIEHRLHRRV |
Ga0318533_109202632 | 3300032059 | Soil | AMQLMQAEEMVTIAVVLFAFAALANAMLLWIEHQLHPRV |
Ga0318505_103696981 | 3300032060 | Soil | AKHGLGFLIINAMQLMQAEEMVTVAVVLFAFAALANAILLWIEHQLHPRV |
Ga0318510_102008911 | 3300032064 | Soil | EMFAAKHGLGFLIINAMQLLQGEEMITVAVVLFVFAALANAFLLWIEHRLHRGV |
Ga0318518_106876272 | 3300032090 | Soil | GLGFLIINAMQLMQAEEMVTVAVVLFAFAALANAILLWIEHQLHPRV |
Ga0311301_102794195 | 3300032160 | Peatlands Soil | MIMSDMSLAQSEDMVTVAIILFVFAAIANALLLWIEHRLHRRV |
Ga0311301_116708422 | 3300032160 | Peatlands Soil | LGLGSMIMSDMSLAQSEDMVTVAIILFVFAACANALLLWIEHRLHRKV |
Ga0307472_1016667192 | 3300032205 | Hardwood Forest Soil | FLIINAMSLLQTEEMMTVAVLLFAFAALANALLLWMEHRLHRRV |
Ga0335078_110952301 | 3300032805 | Soil | LQGQEMMMVAIVLFAFAAIANGLLLWIEHRLHRRV |
Ga0335078_116612041 | 3300032805 | Soil | MNDMSLAQSEDMVTVAIILFVFAAIANALLLWIEHRLHRRV |
Ga0335080_105553953 | 3300032828 | Soil | LQGEEMMTIAIVLFGFAALANALMLAVEHRLHRRV |
Ga0335073_121009072 | 3300033134 | Soil | GLGFLIINAMTLLQTKEMISIAVVLFAFAAVANAILLWIEHRLHRRV |
⦗Top⦘ |