| Basic Information | |
|---|---|
| Family ID | F053400 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 141 |
| Average Sequence Length | 43 residues |
| Representative Sequence | LKNRLATIIGDGRDIRNNATLATAILALKCGEMIHPFEVLR |
| Number of Associated Samples | 115 |
| Number of Associated Scaffolds | 141 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.84 % |
| % of genes near scaffold ends (potentially truncated) | 92.20 % |
| % of genes from short scaffolds (< 2000 bps) | 91.49 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.035 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa (14.894 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.695 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.007 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 141 Family Scaffolds |
|---|---|---|
| PF04015 | DUF362 | 87.23 |
| PF01464 | SLT | 1.42 |
| PF12804 | NTP_transf_3 | 0.71 |
| PF00004 | AAA | 0.71 |
| PF02371 | Transposase_20 | 0.71 |
| PF04972 | BON | 0.71 |
| PF14236 | DUF4338 | 0.71 |
| PF02922 | CBM_48 | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 141 Family Scaffolds |
|---|---|---|---|
| COG2006 | Uncharacterized conserved protein, DUF362 family | Function unknown [S] | 87.23 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.04 % |
| Unclassified | root | N/A | 4.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005178|Ga0066688_10672602 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300005531|Ga0070738_10431002 | Not Available | 512 | Open in IMG/M |
| 3300005591|Ga0070761_10260958 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300005602|Ga0070762_11146530 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300005712|Ga0070764_10181613 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300006052|Ga0075029_100006340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 6528 | Open in IMG/M |
| 3300006059|Ga0075017_101174572 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300006059|Ga0075017_101227174 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300006176|Ga0070765_101630201 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300006796|Ga0066665_10672173 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300006800|Ga0066660_10689629 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300009038|Ga0099829_11630657 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300009088|Ga0099830_10482225 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300009089|Ga0099828_10371326 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300009522|Ga0116218_1179941 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300009522|Ga0116218_1233955 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300009551|Ga0105238_12032693 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300009628|Ga0116125_1150634 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300009629|Ga0116119_1190178 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300009644|Ga0116121_1311336 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300009665|Ga0116135_1312530 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300009759|Ga0116101_1204970 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300010341|Ga0074045_10602476 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300010379|Ga0136449_102743914 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300010398|Ga0126383_12871781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300012189|Ga0137388_11063091 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300012189|Ga0137388_11999800 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300012201|Ga0137365_10769063 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300012203|Ga0137399_10985351 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300012361|Ga0137360_11677737 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300014151|Ga0181539_1240493 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300014152|Ga0181533_1340529 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300014159|Ga0181530_10024349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4498 | Open in IMG/M |
| 3300014159|Ga0181530_10371478 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300014162|Ga0181538_10343891 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300014164|Ga0181532_10351386 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300014164|Ga0181532_10613251 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300014165|Ga0181523_10261548 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300014167|Ga0181528_10348632 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300014491|Ga0182014_10322100 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300014501|Ga0182024_12233876 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300014655|Ga0181516_10147544 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300014658|Ga0181519_10878282 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300014838|Ga0182030_11167462 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300015242|Ga0137412_10040392 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3809 | Open in IMG/M |
| 3300016404|Ga0182037_10839819 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300018008|Ga0187888_1202346 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300018023|Ga0187889_10060895 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1977 | Open in IMG/M |
| 3300018033|Ga0187867_10206313 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300018037|Ga0187883_10184068 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300018040|Ga0187862_10172588 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
| 3300018042|Ga0187871_10427448 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300018043|Ga0187887_10132819 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
| 3300018043|Ga0187887_10830891 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300018047|Ga0187859_10918729 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300018060|Ga0187765_11001413 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300018468|Ga0066662_12418071 | Not Available | 553 | Open in IMG/M |
| 3300020581|Ga0210399_10968989 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300021405|Ga0210387_11101463 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300021407|Ga0210383_10515470 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300021407|Ga0210383_11798390 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300021420|Ga0210394_10002514 | All Organisms → cellular organisms → Bacteria | 24954 | Open in IMG/M |
| 3300021420|Ga0210394_11521109 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300021432|Ga0210384_10295392 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
| 3300021433|Ga0210391_11415128 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300021477|Ga0210398_11229152 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300021559|Ga0210409_10444471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1157 | Open in IMG/M |
| 3300023068|Ga0224554_1056196 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300023088|Ga0224555_1119798 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300025905|Ga0207685_10627903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300026273|Ga0209881_1177351 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300026317|Ga0209154_1132201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1050 | Open in IMG/M |
| 3300026319|Ga0209647_1013348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 5396 | Open in IMG/M |
| 3300027104|Ga0208095_1017767 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300027591|Ga0209733_1005710 | All Organisms → cellular organisms → Bacteria | 3168 | Open in IMG/M |
| 3300027641|Ga0208827_1137470 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300027667|Ga0209009_1178838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300027727|Ga0209328_10043971 | All Organisms → cellular organisms → Bacteria | 1372 | Open in IMG/M |
| 3300027729|Ga0209248_10264631 | Not Available | 500 | Open in IMG/M |
| 3300027745|Ga0209908_10246664 | Not Available | 503 | Open in IMG/M |
| 3300027898|Ga0209067_10000517 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 24551 | Open in IMG/M |
| 3300027903|Ga0209488_10007681 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8068 | Open in IMG/M |
| 3300027908|Ga0209006_10052084 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3674 | Open in IMG/M |
| 3300028748|Ga0302156_10225022 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300028776|Ga0302303_10042951 | All Organisms → cellular organisms → Bacteria | 1795 | Open in IMG/M |
| 3300028792|Ga0307504_10273008 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300028866|Ga0302278_10400767 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300029636|Ga0222749_10028209 | All Organisms → cellular organisms → Bacteria | 2367 | Open in IMG/M |
| 3300029910|Ga0311369_11055843 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300029911|Ga0311361_10735410 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300029922|Ga0311363_11387537 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300029943|Ga0311340_10901180 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300029944|Ga0311352_10722498 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300029987|Ga0311334_11612935 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300029988|Ga0302190_10422548 | Not Available | 504 | Open in IMG/M |
| 3300029993|Ga0302304_10306556 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300029999|Ga0311339_10752561 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300029999|Ga0311339_11226466 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300030007|Ga0311338_12082493 | Not Available | 501 | Open in IMG/M |
| 3300030054|Ga0302182_10425626 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300030399|Ga0311353_10516185 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300030399|Ga0311353_10521340 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300030739|Ga0302311_10658843 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300030760|Ga0265762_1094704 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300030760|Ga0265762_1103341 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300030848|Ga0075388_11558494 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300031028|Ga0302180_10498955 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300031128|Ga0170823_13120895 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300031231|Ga0170824_109254998 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300031234|Ga0302325_12848060 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300031236|Ga0302324_100963043 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300031236|Ga0302324_101327612 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300031236|Ga0302324_102020749 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300031236|Ga0302324_102026821 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300031236|Ga0302324_103039368 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300031261|Ga0302140_10383425 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300031261|Ga0302140_10740137 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300031524|Ga0302320_11417362 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300031525|Ga0302326_11149644 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300031525|Ga0302326_12530582 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300031788|Ga0302319_11874735 | Not Available | 514 | Open in IMG/M |
| 3300031823|Ga0307478_10865284 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300031823|Ga0307478_11310776 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300031954|Ga0306926_11737236 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300032074|Ga0308173_12150736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300032160|Ga0311301_10363811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 2248 | Open in IMG/M |
| 3300032160|Ga0311301_12945382 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300032783|Ga0335079_10893474 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300032783|Ga0335079_10924948 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300032783|Ga0335079_11869816 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300032805|Ga0335078_10043519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6654 | Open in IMG/M |
| 3300032805|Ga0335078_10446559 | All Organisms → cellular organisms → Bacteria | 1680 | Open in IMG/M |
| 3300032805|Ga0335078_10747477 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300032805|Ga0335078_11223210 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300032805|Ga0335078_12368757 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300032828|Ga0335080_10670241 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300032892|Ga0335081_11982304 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300032892|Ga0335081_12365249 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300032893|Ga0335069_10842774 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300033004|Ga0335084_11335717 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300033887|Ga0334790_239024 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 14.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 9.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.51% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 7.80% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.09% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 6.38% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 5.67% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.26% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.55% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.84% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.13% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.13% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.42% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.42% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.42% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.42% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.42% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.71% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.71% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.71% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.71% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.71% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.71% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300023068 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 20-24 | Environmental | Open in IMG/M |
| 3300023088 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34 | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026273 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027104 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF024 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300029988 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300029993 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030848 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066688_106726021 | 3300005178 | Soil | NRLATIMGDGRDIRNNATLATALLALKCGEMIHPFVVLR* |
| Ga0070738_104310022 | 3300005531 | Surface Soil | VEELKNRLATMMGDGRDIQNNATLATALLALKCGEMIHPFVVLR* |
| Ga0070761_102609581 | 3300005591 | Soil | EPVDHLKTQLAALIGDGREIKNNATLAAALLALKCGEMIHPFMVLR* |
| Ga0070762_111465302 | 3300005602 | Soil | SIQQLQDRLAIMIGDGAGIRNNATLALVLLALRCGEVIHPFMVFR* |
| Ga0070764_101816132 | 3300005712 | Soil | LFTYRISIQQLQDRLAIMIGDGAGIRNNATLAVVLLALRCGEVIHPFMVFR* |
| Ga0075029_1000063404 | 3300006052 | Watersheds | VYQEPVEHLKAKLAALGGDGHYIRNNATLATAILALKCGEMIHPFEVLR* |
| Ga0075017_1011745722 | 3300006059 | Watersheds | KNRLAIIIGDGRDIRNNATLATAILALKCGEMIHPFVVLR* |
| Ga0075017_1012271742 | 3300006059 | Watersheds | IIGNGRDIRNNATLATAILALKCGEMIHPFEVLR* |
| Ga0070765_1016302011 | 3300006176 | Soil | LKNRLATIMGDGRDIRNNATLATALLALRCGEMIHPFEVLR* |
| Ga0066665_106721731 | 3300006796 | Soil | VEELKNRLATIMGDGRDMRNNATLATALLALRCGEMIHPFEVLR* |
| Ga0066660_106896291 | 3300006800 | Soil | VYQEPIGGLRNRLATIIGDGRDIRNNATLATAILALKCGEMIHPFEVLR* |
| Ga0099829_116306572 | 3300009038 | Vadose Zone Soil | DRIQELKQRLSALVGDGVRIRNNATLATAALALKCGEAIHPFAVMR* |
| Ga0099830_104822251 | 3300009088 | Vadose Zone Soil | NRLATIIGDGRDIRNNATLATAILALKCGEMIHPFEVLR* |
| Ga0099828_103713262 | 3300009089 | Vadose Zone Soil | LSVYQEPIESLKNRLAAMIGDGREIQNNATLATAILALKCGEMIHPFEVLR* |
| Ga0116218_11799412 | 3300009522 | Peatlands Soil | LATIIGDGRDIRNNATLATAILALKCGEMIHPFEVLR* |
| Ga0116218_12339552 | 3300009522 | Peatlands Soil | TIIGEGRDIRNNATLATSILALKCGEMIHPFEVLR* |
| Ga0105238_120326931 | 3300009551 | Corn Rhizosphere | IVGDGRDIRNNATLATAILALKCGEMIHPFEVLR* |
| Ga0116125_11506342 | 3300009628 | Peatland | VEGLKARLATLIGDGRDILNNATLATAILALRCGEMIHPFMVLR* |
| Ga0116119_11901782 | 3300009629 | Peatland | VEHLKARLATLIGDGLDVRNNATLATAILALKCGEMIHPFEVLR* |
| Ga0116121_13113361 | 3300009644 | Peatland | RLATLVGDGRGIRNNATLAAAILALKCGEMIHPFEVLR* |
| Ga0116135_13125301 | 3300009665 | Peatland | IMGDSRDIRNNATLATALLALKCGEMIHPFVVLR* |
| Ga0116101_12049702 | 3300009759 | Peatland | EPVEDLKTKLATLIGDGSDVRNNATLATAILALRCGEMIHPFMVLR* |
| Ga0074045_106024762 | 3300010341 | Bog Forest Soil | FVYQEPIGGLKNRLATIIGNGRDIRNNATLATALLALKCGEMIHPFEVLR* |
| Ga0136449_1027439142 | 3300010379 | Peatlands Soil | FVYQEPVNQLKNRLAMIVGDGRDIQDNATLATAILALKCGEMIHPFEVLR* |
| Ga0126383_128717811 | 3300010398 | Tropical Forest Soil | KRKLVTIVGEGMAIRNNATIAAAVLALRCGEMIHPFMVLR* |
| Ga0137388_110630911 | 3300012189 | Vadose Zone Soil | GGLRNRLATIIGNGRDIRNNATLATAILALKCGEMIHPFEVLR* |
| Ga0137388_119998001 | 3300012189 | Vadose Zone Soil | AMVGDDRDIRNNATLATAILALKCGEMIHPFEVLR* |
| Ga0137365_107690631 | 3300012201 | Vadose Zone Soil | KNRLATVIGDGRDTRNNATLATAILALKCGEMIHPFEVLR* |
| Ga0137399_109853512 | 3300012203 | Vadose Zone Soil | RLATIVGDGRDIRNNATLATAILAMKCGEMIHPFEVLR* |
| Ga0137360_116777372 | 3300012361 | Vadose Zone Soil | PIGGLKNRLATIVGDGRDIRNNATLATALLALKCGEMIHPFVVLR* |
| Ga0181539_12404931 | 3300014151 | Bog | VYQEPIGGLRNRLATIIGNGRDIRNNATLATAILALKCGEMIHPFEVLR* |
| Ga0181533_13405291 | 3300014152 | Bog | HLKARLATLVGDGHDIRNNATLATAILALKCGEMIHPFEVLR* |
| Ga0181530_100243491 | 3300014159 | Bog | QEPVEHLKAKLAALVGDGHEIRNNAALATAILALKCGEMIHPFEVLG* |
| Ga0181530_103714781 | 3300014159 | Bog | TLVGDGRGIRNNASLAAAILALKCGEMIHPFEVLR* |
| Ga0181538_103438912 | 3300014162 | Bog | LRNRLATIIGNGRDIRNNATLATAILALKCGEMIHPFEVLR* |
| Ga0181532_103513862 | 3300014164 | Bog | VYQEPIGGLRNRLATIIGDGHDIRNNATLATAILALKCGEMIHPFEVLR* |
| Ga0181532_106132511 | 3300014164 | Bog | EPVEHLKARLATLVGDGRDIRNNATLATAILALKCGAMIHPFEVLR* |
| Ga0181523_102615481 | 3300014165 | Bog | LQDRLAVILRNSACISNNATLATVLLALRCGEMMHPFMVLR* |
| Ga0181528_103486321 | 3300014167 | Bog | PIGGLRNRLATIIGNGRDIRNNATLATAILALKCGEMIHPFEVLR* |
| Ga0182014_103221001 | 3300014491 | Bog | ERVEHLKARLATLVGDGREIRNNATLATAILALKCGEMIHPFEVLR* |
| Ga0182024_122338762 | 3300014501 | Permafrost | ATIMGDGREVRNNATLATALLALKCGEMIHPFVVLR* |
| Ga0181516_101475441 | 3300014655 | Bog | EPVDHLKAGLATLVGDGRDIRNNATLATAILALRCGEMIHPFVVLR* |
| Ga0181519_108782822 | 3300014658 | Bog | EELKNRLATIMGDGRDIRNNATLATALLALRCGEMIHPFEVLR* |
| Ga0182030_111674622 | 3300014838 | Bog | NRLATIMGDGREVRNNATLATALLALKCGEMIHPFVVLR* |
| Ga0137412_100403925 | 3300015242 | Vadose Zone Soil | IGGLKNRLATIIGDGRDIRNNATLATAILALKCGEMIHPFEVLR* |
| Ga0182037_108398191 | 3300016404 | Soil | KLATIVGDGSVIRNNATLATAVLALRCGEMIHPFMVLR |
| Ga0187888_12023462 | 3300018008 | Peatland | YQEPVENLKAKLAALVGDGRDIRNNATLATAILALKCGEMIHPFEVLR |
| Ga0187889_100608953 | 3300018023 | Peatland | VEHLKARLATLVGDGRDIRSNATLATAILALKCGEMIHPFEVLR |
| Ga0187867_102063131 | 3300018033 | Peatland | PIGGLKNRLATIIGNGRDIRNNATLATALLALKCGEMIHPFEVLR |
| Ga0187883_101840681 | 3300018037 | Peatland | PVGGLKNRLEVIVGDGRDTRNNATLATALLALKCGEMIHPFEVLR |
| Ga0187862_101725881 | 3300018040 | Peatland | SVEPLKNKLATIMGDGRVIRNNATLATALLALKCGEMIHPFVVLR |
| Ga0187871_104274482 | 3300018042 | Peatland | EHLRARLATLIGDGRETRNNATLATSLLALRCGEMIHPFEVLR |
| Ga0187887_101328192 | 3300018043 | Peatland | FVYQESVEPLKNKLATIMGDGREVRNNATLATALLALKCGEMIHPFVVLR |
| Ga0187887_108308912 | 3300018043 | Peatland | ATIVGDGRDIRNNATLASAILALKCGEMIHPFEVLR |
| Ga0187859_109187291 | 3300018047 | Peatland | TLVGDGRDLRNNATLATATLALKCGEMIHPFEVLR |
| Ga0187765_110014131 | 3300018060 | Tropical Peatland | LAIMIGAGAGIRNNATLAVVLLALRCGEMIHPFMVLR |
| Ga0066662_124180711 | 3300018468 | Grasslands Soil | LKRRLGAMVGDGSDIRNNATLATALVALRCGEMIHPFMVLS |
| Ga0210399_109689891 | 3300020581 | Soil | EPLKNRLATIMGDGREVRNNATLATALLALKCGEMIHPFVVLR |
| Ga0210387_111014632 | 3300021405 | Soil | IGGLRNRLATIIGNGRDIRNNATLATAILALKCGEMIHPFEVLR |
| Ga0210383_105154701 | 3300021407 | Soil | LATIMGDGRDIRNNATLATGLLALKCGEMIHPFVVLR |
| Ga0210383_117983901 | 3300021407 | Soil | AALIGDGREIKNNATLAAALLALKCGEMIHPFMVLR |
| Ga0210394_1000251428 | 3300021420 | Soil | MNRLATIMGDGREVRNNAALATGLLALKCGGMIHPFVVLR |
| Ga0210394_115211091 | 3300021420 | Soil | SVEALKNRLATIMGDGRDIRNNATLATGLLALKCGQMIHPFVVLR |
| Ga0210384_102953924 | 3300021432 | Soil | LKNRLEMIVGDGRDIRNNATLSTALLALKCGEMIHPFEVLR |
| Ga0210391_114151281 | 3300021433 | Soil | ILSLFTYRESIQQLQDRLAIMIGDGAGIRNNATLAVVLLALRCGEVIHPFMVFR |
| Ga0210398_112291521 | 3300021477 | Soil | TKVGEGLGVQNAATVATALLALKCGEIIHPFVVLR |
| Ga0210409_104444713 | 3300021559 | Soil | LFVCQKPVEELKNRLATIMGDGRDIRNNATLATALLALRCGEMIHPFEVLR |
| Ga0224554_10561962 | 3300023068 | Soil | AKLATLVGDGRGIRDNATLATAILALKCGEMIHPFEVLR |
| Ga0224555_11197982 | 3300023088 | Soil | VQQLQDRLAVILGNSACIRNNATLATVLLALRCGEMMHPFMVLR |
| Ga0207685_106279032 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | LFVYQEPIGGLKNRLATIVGDGRDIRNNATLATALLALKCGEMIHPFVVLR |
| Ga0209881_11773512 | 3300026273 | Soil | LKNRLATIMGDGRDVRNNATLATAILALKCGEMIHPFEVLR |
| Ga0209154_11322013 | 3300026317 | Soil | LTTIIGNGRDIRNNATLATAILALKCGEMIHPFEVLR |
| Ga0209647_10133485 | 3300026319 | Grasslands Soil | LAIIIGDGRDIRNNATLATAILALKCGEMIHPFQVLR |
| Ga0208095_10177671 | 3300027104 | Forest Soil | GLRNRLANIIGNGREIRNNATLATAILALKCGEMIHPFEVLR |
| Ga0209733_10057105 | 3300027591 | Forest Soil | KNRLATIVGDGRDIRNNATLATALLALRCGEMIHPFEVLR |
| Ga0208827_11374701 | 3300027641 | Peatlands Soil | PLKNKLATIMGDGREVLNNATLATALLALKCGEMIHPFVVLR |
| Ga0209009_11788382 | 3300027667 | Forest Soil | LFVYQEPIGGLKNRLATIIGDGRGIRNNATLATAILALKCGEMIHPFEVLR |
| Ga0209328_100439711 | 3300027727 | Forest Soil | KNKLATIIGDGRDIRNNATLAAALLALKCGEMIHPFEVLR |
| Ga0209248_102646312 | 3300027729 | Bog Forest Soil | LKHRLATIIGDGRDIQNNATLATALLALKCGEMIHPFVVLR |
| Ga0209908_102466641 | 3300027745 | Thawing Permafrost | ESIQQLQDRLAIMIGDGAGIRNNATLAVVLLALRCGEVIHPFMVFR |
| Ga0209067_1000051722 | 3300027898 | Watersheds | VYQEPVEHLKAKLAALGGDGHYIRNNATLATAILALKCGEMIHPFEVLR |
| Ga0209488_1000768110 | 3300027903 | Vadose Zone Soil | FVYQEPIGGLKNRLATIIGDGRDMRNNATLATAILALKCGEMIHPFEVLR |
| Ga0209006_100520847 | 3300027908 | Forest Soil | VYQEPVGGLKNRLATIIGDGRDIRNNATLATALLALKCGEMIHPFVVLR |
| Ga0302156_102250221 | 3300028748 | Bog | ESVEPLKNRLATIMGDGREVRNNATLATALLALKCGEMIHPFVVLR |
| Ga0302303_100429511 | 3300028776 | Palsa | LATIMGDGREVRNNATLATALLALKCGEMIHPFVVLR |
| Ga0307504_102730081 | 3300028792 | Soil | LFVYQEPIGGLKNRLATIIGDGRDIRNNATLATAILALKCGEVIHPFEVLR |
| Ga0302278_104007671 | 3300028866 | Bog | VEHLKARLATLIGDGHDIRNNATLATAILALKCGEMIHPFEVLR |
| Ga0222749_100282094 | 3300029636 | Soil | LFVYQEPVEELKNRLATIMGDGRDIRNNATLATALLALRCGEMIHPFEVLR |
| Ga0311369_110558431 | 3300029910 | Palsa | SVEPLKNRLATIMGDGRDVRNNATLATALLALKCGEMIHPFVVLR |
| Ga0311361_107354102 | 3300029911 | Bog | KNRLATIMGDGRDIRNNATLATALLALRCGEMIHPFEVLR |
| Ga0311363_113875371 | 3300029922 | Fen | VYKEPVEQLKAKLATLVGDGRGIRDNATLATAILALKCGEMIHPFEVLR |
| Ga0311340_109011802 | 3300029943 | Palsa | LKNRLATIIGDGRDIRNNATLATAILALKCGEMIHPFEVLR |
| Ga0311352_107224981 | 3300029944 | Palsa | GLATLVGDGRDIRNNATLATAILALRCGEMIHPFVVLR |
| Ga0311334_116129352 | 3300029987 | Fen | QEPVVGLKNRLAAMIGDGRNIRNNATLATALLALKCGEMIHPFEVLR |
| Ga0302190_104225482 | 3300029988 | Bog | YQEPVEHLKARLATLIGDGHDIRNNATLATAILALKCGEMIHPFEVLR |
| Ga0302304_103065561 | 3300029993 | Palsa | ATIIGDGRDVRNNATLATALLALKCGEMIHPFVVLR |
| Ga0311339_107525612 | 3300029999 | Palsa | YQEPVDHLKTTLATLVGDGRDIHNNATLATAILALRCGEIIHPFMVLR |
| Ga0311339_112264662 | 3300029999 | Palsa | ATIMGDGRDIRNNATLATALLALRCGEMIHPFEVLR |
| Ga0311338_120824932 | 3300030007 | Palsa | VLKNRLATIMGDGRDIRNNATLATGLLALKCGEMIHPFVVLR |
| Ga0302182_104256261 | 3300030054 | Palsa | GGLKNRLATIIGDGQGIRNNATLATALLALKCGEMIHPFEVLR |
| Ga0311353_105161851 | 3300030399 | Palsa | LFAYQEPVDHLKTRLATLVGDGRDIHNNATLATAILALRCGEIIHPFMVLR |
| Ga0311353_105213402 | 3300030399 | Palsa | ATIMGDGRDIRNNATLATALLALKCGEMIHPFVVLR |
| Ga0302311_106588432 | 3300030739 | Palsa | LATIMGDGRDVRNNATLATALLALKCGEMIHPFVVLR |
| Ga0265762_10947041 | 3300030760 | Soil | LKAKLAVLVGDGRGIRNNATLAAAILALKCGEMIHPFEVLR |
| Ga0265762_11033412 | 3300030760 | Soil | LFVYQESVEALKNRLATIMGDGRDIRNNATLATGLLALKCGEMIHPFVVLR |
| Ga0075388_115584942 | 3300030848 | Soil | FVYQEPIGGLRNRLATVIGNGRDIRNNATLATAILALKCGEMIHPFEVLR |
| Ga0302180_104989552 | 3300031028 | Palsa | AAIIGDGRDIRNNATLATAILALQCGEMIHPFEVLR |
| Ga0170823_131208951 | 3300031128 | Forest Soil | LATLIGDGRDIRNNATLATAILALRCGEMIHPFVVLR |
| Ga0170824_1092549982 | 3300031231 | Forest Soil | IGGLKNRLATVIGDGRDIRNNATLATAILALKCGEMIHPFEVLR |
| Ga0302325_128480602 | 3300031234 | Palsa | KTKLATLIGDGSDVRNNATLATAILALRCGEMIHPFMVLR |
| Ga0302324_1009630432 | 3300031236 | Palsa | AIIGDGRDVRNNATLASALLALKCGEMIHPFEVLR |
| Ga0302324_1013276121 | 3300031236 | Palsa | YQEPVEEFKNRLATIMGDGRDIRNNATLATALLALRCGEMIHPFEVLR |
| Ga0302324_1020207491 | 3300031236 | Palsa | IGGLKNRLATIVGDGRDIRNNATLTTALLALKCGEMIHPFVVLR |
| Ga0302324_1020268212 | 3300031236 | Palsa | ASLVGDGHEIRNNATLATAILALKCGEMIHPFEVLR |
| Ga0302324_1030393681 | 3300031236 | Palsa | KNRLATIVGDGRDIRNNATLATAILALKCGEMIHPFEVLR |
| Ga0302140_103834251 | 3300031261 | Bog | EPVEDLKAKLATLIGDGSDVRNNATLATAILALRCGEMIHPFVVLR |
| Ga0302140_107401371 | 3300031261 | Bog | LFVYQEPIGGLKNRLATIIGNGRDIRNNATLATALLALKCGEMIHPFEVLR |
| Ga0302320_114173621 | 3300031524 | Bog | LATVIGDGREVQNNATLATALLALKCGEMIHPFMVLR |
| Ga0302326_111496442 | 3300031525 | Palsa | YQESVEALKNRLAKIMGDGREVRNNATLATALLALKCGEMIHPFVVLR |
| Ga0302326_125305821 | 3300031525 | Palsa | YQEPIGGLKNRLATIICDGRDIQNNATLATAILALKCGEMIHPFEVLR |
| Ga0302319_118747352 | 3300031788 | Bog | LFVYQEPIDLLKTRLATLIGDGRDIQNNATLATAILALRCGEMIHPFVVLR |
| Ga0307478_108652841 | 3300031823 | Hardwood Forest Soil | PIGGLRNRLATIIGDGHDIRNNATLATAILALKCGEMIHPFEVLR |
| Ga0307478_113107762 | 3300031823 | Hardwood Forest Soil | LKNRLAAMLGDGRDIQNNATLATAILALKCGEMIHPFVVLR |
| Ga0306926_117372361 | 3300031954 | Soil | QEPVGALKNRLAAIVGDGREVRNNATLATAILALKCGEMIHPFQVLR |
| Ga0308173_121507362 | 3300032074 | Soil | RLAAMVGDGSAIRNNATLATAVLALRCGEMIHPFMVLR |
| Ga0311301_103638113 | 3300032160 | Peatlands Soil | ATIMGDGRDVRNNATLATALLALKCGEMIHPFVVLR |
| Ga0311301_129453822 | 3300032160 | Peatlands Soil | LATIMGDGRDIRNNATLATGLLALKCGQMIHPFLVLR |
| Ga0335079_108934742 | 3300032783 | Soil | YREPIQQLQDRLADIIGDGAGIRNNATLAVVLLALRCGEMIHPFMVLR |
| Ga0335079_109249482 | 3300032783 | Soil | AILGDGRDTRNNATLRTALLALKCGEMIHPFVVLR |
| Ga0335079_118698162 | 3300032783 | Soil | VYQEPVDGLKNRLAMLIGDGKKIQDNATLATAILALKCGEMIHPFMVLR |
| Ga0335078_100435199 | 3300032805 | Soil | FTYREPIQQLQDRLADIIGDGAGIRNNATLAVVLLALRCGEMIHPFMVLR |
| Ga0335078_104465591 | 3300032805 | Soil | QDRLADIIGDGAGIRNNATLAVVLLALRCGEMIHPFMVLK |
| Ga0335078_107474772 | 3300032805 | Soil | QLQDRLADIIGDGAGIRNNATLAVVLLALRCGEMIHPFMVFR |
| Ga0335078_112232101 | 3300032805 | Soil | KKRLAMLIGDGKKIQDNATLATAILALKCGEMIHPFMVLR |
| Ga0335078_123687572 | 3300032805 | Soil | RLAAIIGDGSTIRNNATLAIALLALRCGEMIHPFMVLR |
| Ga0335080_106702412 | 3300032828 | Soil | LETIIGEGRDIRNNATLATAILALKCGEMIHPFVVLR |
| Ga0335081_119823042 | 3300032892 | Soil | SIQLLQDRLAIIIGDGTAIRNNATLAVVLLALRCGEMIHPFMVLR |
| Ga0335081_123652492 | 3300032892 | Soil | IQQLQDRLANIIGDGAGIRNNATLAVVLLALRCGEMIHPFMVFR |
| Ga0335069_108427742 | 3300032893 | Soil | HLKTRLTALIGDGREIRNNATLATALLALKCGEMIHPFMVLR |
| Ga0335084_113357171 | 3300033004 | Soil | PIGGLKNRLATIIGDGRDIRNNATLATAILALKCGEMIHPFVVLR |
| Ga0334790_239024_394_507 | 3300033887 | Soil | LATIIGDGRDIQDNATLATAILALRCGEMIHPFMVLR |
| ⦗Top⦘ |