| Basic Information | |
|---|---|
| Family ID | F053300 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 141 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MKEIDQMLNQWIHSSIIRAKLRELIVKENFKSFDLGVEHKKELKK |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 141 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 38.30 % |
| % of genes near scaffold ends (potentially truncated) | 21.28 % |
| % of genes from short scaffolds (< 2000 bps) | 93.62 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | unclassified viruses (69.504 % of family members) |
| NCBI Taxonomy ID | 12429 |
| Taxonomy | All Organisms → Viruses → unclassified viruses |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (37.589 % of family members) |
| Environment Ontology (ENVO) | Unclassified (90.780 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (96.454 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 91.11% β-sheet: 0.00% Coil/Unstructured: 8.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 141 Family Scaffolds |
|---|---|---|
| PF00118 | Cpn60_TCP1 | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 141 Family Scaffolds |
|---|---|---|---|
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.33 % |
| Unclassified | root | N/A | 5.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001450|JGI24006J15134_10241808 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 524 | Open in IMG/M |
| 3300001589|JGI24005J15628_10150690 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 707 | Open in IMG/M |
| 3300002488|JGI25128J35275_1005920 | All Organisms → Viruses → Predicted Viral | 3315 | Open in IMG/M |
| 3300004448|Ga0065861_1155731 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 525 | Open in IMG/M |
| 3300006029|Ga0075466_1058646 | All Organisms → Viruses → Predicted Viral | 1116 | Open in IMG/M |
| 3300006484|Ga0070744_10021109 | All Organisms → Viruses → Predicted Viral | 1933 | Open in IMG/M |
| 3300006735|Ga0098038_1299289 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 500 | Open in IMG/M |
| 3300006737|Ga0098037_1202492 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 649 | Open in IMG/M |
| 3300006737|Ga0098037_1227686 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 603 | Open in IMG/M |
| 3300006738|Ga0098035_1225912 | Not Available | 620 | Open in IMG/M |
| 3300006749|Ga0098042_1160475 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 548 | Open in IMG/M |
| 3300006749|Ga0098042_1186044 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 500 | Open in IMG/M |
| 3300006750|Ga0098058_1071647 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 956 | Open in IMG/M |
| 3300006789|Ga0098054_1081592 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 1219 | Open in IMG/M |
| 3300006789|Ga0098054_1318072 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 555 | Open in IMG/M |
| 3300006793|Ga0098055_1127277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 987 | Open in IMG/M |
| 3300006793|Ga0098055_1175287 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 820 | Open in IMG/M |
| 3300006793|Ga0098055_1255542 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 659 | Open in IMG/M |
| 3300006920|Ga0070748_1252572 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 634 | Open in IMG/M |
| 3300006921|Ga0098060_1037898 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 1452 | Open in IMG/M |
| 3300006921|Ga0098060_1086008 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 899 | Open in IMG/M |
| 3300006921|Ga0098060_1128164 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 710 | Open in IMG/M |
| 3300006921|Ga0098060_1174326 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 592 | Open in IMG/M |
| 3300006921|Ga0098060_1189356 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 564 | Open in IMG/M |
| 3300006924|Ga0098051_1027724 | Not Available | 1614 | Open in IMG/M |
| 3300006925|Ga0098050_1085135 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 813 | Open in IMG/M |
| 3300006928|Ga0098041_1023132 | All Organisms → Viruses → Predicted Viral | 2030 | Open in IMG/M |
| 3300006928|Ga0098041_1118403 | Not Available | 854 | Open in IMG/M |
| 3300007276|Ga0070747_1317425 | Not Available | 534 | Open in IMG/M |
| 3300007900|Ga0111031_1057224 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 1243 | Open in IMG/M |
| 3300008050|Ga0098052_1214491 | Not Available | 744 | Open in IMG/M |
| 3300008216|Ga0114898_1024478 | All Organisms → Viruses → Predicted Viral | 2066 | Open in IMG/M |
| 3300008217|Ga0114899_1159000 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 731 | Open in IMG/M |
| 3300008218|Ga0114904_1070914 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 879 | Open in IMG/M |
| 3300008219|Ga0114905_1125556 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 871 | Open in IMG/M |
| 3300008220|Ga0114910_1169033 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 614 | Open in IMG/M |
| 3300008220|Ga0114910_1203939 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 543 | Open in IMG/M |
| 3300008220|Ga0114910_1222201 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 512 | Open in IMG/M |
| 3300009071|Ga0115566_10537569 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 659 | Open in IMG/M |
| 3300009172|Ga0114995_10641850 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 580 | Open in IMG/M |
| 3300009173|Ga0114996_11227569 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 524 | Open in IMG/M |
| 3300009193|Ga0115551_1056168 | All Organisms → Viruses → Predicted Viral | 1917 | Open in IMG/M |
| 3300009418|Ga0114908_1157154 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 726 | Open in IMG/M |
| 3300009420|Ga0114994_10673668 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 676 | Open in IMG/M |
| 3300009437|Ga0115556_1308719 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 557 | Open in IMG/M |
| 3300009512|Ga0115003_10107592 | All Organisms → Viruses → Predicted Viral | 1712 | Open in IMG/M |
| 3300009512|Ga0115003_10636985 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 621 | Open in IMG/M |
| 3300009602|Ga0114900_1082705 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 908 | Open in IMG/M |
| 3300009603|Ga0114911_1168176 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 610 | Open in IMG/M |
| 3300009606|Ga0115102_10261083 | All Organisms → Viruses → Predicted Viral | 1515 | Open in IMG/M |
| 3300009620|Ga0114912_1053791 | All Organisms → Viruses → Predicted Viral | 1021 | Open in IMG/M |
| 3300010149|Ga0098049_1249165 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 540 | Open in IMG/M |
| 3300010150|Ga0098056_1286935 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 543 | Open in IMG/M |
| 3300010153|Ga0098059_1144732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 937 | Open in IMG/M |
| 3300010153|Ga0098059_1203748 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 770 | Open in IMG/M |
| 3300010155|Ga0098047_10241847 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 687 | Open in IMG/M |
| 3300010883|Ga0133547_11047240 | All Organisms → Viruses → Predicted Viral | 1574 | Open in IMG/M |
| 3300017697|Ga0180120_10287190 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 661 | Open in IMG/M |
| 3300017708|Ga0181369_1085890 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 665 | Open in IMG/M |
| 3300017708|Ga0181369_1118802 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 538 | Open in IMG/M |
| 3300017709|Ga0181387_1091410 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 620 | Open in IMG/M |
| 3300017713|Ga0181391_1005609 | All Organisms → Viruses → Predicted Viral | 3354 | Open in IMG/M |
| 3300017714|Ga0181412_1028874 | All Organisms → Viruses → Predicted Viral | 1502 | Open in IMG/M |
| 3300017714|Ga0181412_1044332 | All Organisms → Viruses → Predicted Viral | 1147 | Open in IMG/M |
| 3300017717|Ga0181404_1106483 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 686 | Open in IMG/M |
| 3300017719|Ga0181390_1031096 | All Organisms → Viruses → Predicted Viral | 1669 | Open in IMG/M |
| 3300017719|Ga0181390_1051474 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 1208 | Open in IMG/M |
| 3300017721|Ga0181373_1046144 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 795 | Open in IMG/M |
| 3300017727|Ga0181401_1102237 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 728 | Open in IMG/M |
| 3300017728|Ga0181419_1037385 | All Organisms → Viruses → Predicted Viral | 1303 | Open in IMG/M |
| 3300017734|Ga0187222_1070931 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 798 | Open in IMG/M |
| 3300017734|Ga0187222_1075139 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 772 | Open in IMG/M |
| 3300017737|Ga0187218_1112278 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 651 | Open in IMG/M |
| 3300017739|Ga0181433_1094256 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 730 | Open in IMG/M |
| 3300017739|Ga0181433_1131840 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 594 | Open in IMG/M |
| 3300017741|Ga0181421_1075808 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 881 | Open in IMG/M |
| 3300017743|Ga0181402_1174930 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 538 | Open in IMG/M |
| 3300017744|Ga0181397_1100503 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 760 | Open in IMG/M |
| 3300017745|Ga0181427_1127555 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 619 | Open in IMG/M |
| 3300017746|Ga0181389_1151386 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 617 | Open in IMG/M |
| 3300017748|Ga0181393_1027311 | All Organisms → Viruses → Predicted Viral | 1635 | Open in IMG/M |
| 3300017750|Ga0181405_1009358 | All Organisms → Viruses → Predicted Viral | 2815 | Open in IMG/M |
| 3300017751|Ga0187219_1182841 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 587 | Open in IMG/M |
| 3300017753|Ga0181407_1168893 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 536 | Open in IMG/M |
| 3300017755|Ga0181411_1174120 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 612 | Open in IMG/M |
| 3300017756|Ga0181382_1156434 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 591 | Open in IMG/M |
| 3300017757|Ga0181420_1208825 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 565 | Open in IMG/M |
| 3300017758|Ga0181409_1219483 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 544 | Open in IMG/M |
| 3300017760|Ga0181408_1170749 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 557 | Open in IMG/M |
| 3300017767|Ga0181406_1260723 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 508 | Open in IMG/M |
| 3300017768|Ga0187220_1174513 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 649 | Open in IMG/M |
| 3300017770|Ga0187217_1166781 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 734 | Open in IMG/M |
| 3300017770|Ga0187217_1207301 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 647 | Open in IMG/M |
| 3300017771|Ga0181425_1022678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → unclassified Acinetobacter → Acinetobacter sp. | 2080 | Open in IMG/M |
| 3300017771|Ga0181425_1127063 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 812 | Open in IMG/M |
| 3300017772|Ga0181430_1199165 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 572 | Open in IMG/M |
| 3300017773|Ga0181386_1174298 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 653 | Open in IMG/M |
| 3300017782|Ga0181380_1296467 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 530 | Open in IMG/M |
| 3300020185|Ga0206131_10004569 | Not Available | 15070 | Open in IMG/M |
| 3300020185|Ga0206131_10369568 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 611 | Open in IMG/M |
| 3300020438|Ga0211576_10366994 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 740 | Open in IMG/M |
| 3300020438|Ga0211576_10506722 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 609 | Open in IMG/M |
| 3300021084|Ga0206678_10332031 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 726 | Open in IMG/M |
| 3300021085|Ga0206677_10064568 | All Organisms → Viruses → Predicted Viral | 1837 | Open in IMG/M |
| 3300021957|Ga0222717_10316043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 887 | Open in IMG/M |
| 3300021959|Ga0222716_10412122 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 782 | Open in IMG/M |
| 3300021959|Ga0222716_10523807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 662 | Open in IMG/M |
| 3300022061|Ga0212023_1035460 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 693 | Open in IMG/M |
| 3300022061|Ga0212023_1062015 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 518 | Open in IMG/M |
| 3300022072|Ga0196889_1030718 | All Organisms → Viruses → Predicted Viral | 1088 | Open in IMG/M |
| 3300024346|Ga0244775_10233440 | All Organisms → Viruses → Predicted Viral | 1536 | Open in IMG/M |
| 3300025066|Ga0208012_1037354 | Not Available | 736 | Open in IMG/M |
| 3300025078|Ga0208668_1059230 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 700 | Open in IMG/M |
| 3300025084|Ga0208298_1088427 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 570 | Open in IMG/M |
| 3300025086|Ga0208157_1025066 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 1772 | Open in IMG/M |
| 3300025097|Ga0208010_1084176 | Not Available | 668 | Open in IMG/M |
| 3300025099|Ga0208669_1007563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3183 | Open in IMG/M |
| 3300025099|Ga0208669_1013223 | All Organisms → Viruses → Predicted Viral | 2253 | Open in IMG/M |
| 3300025099|Ga0208669_1093856 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 632 | Open in IMG/M |
| 3300025099|Ga0208669_1108361 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 572 | Open in IMG/M |
| 3300025108|Ga0208793_1127503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 690 | Open in IMG/M |
| 3300025110|Ga0208158_1132360 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 573 | Open in IMG/M |
| 3300025110|Ga0208158_1148551 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 533 | Open in IMG/M |
| 3300025132|Ga0209232_1124508 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 847 | Open in IMG/M |
| 3300025251|Ga0208182_1022963 | All Organisms → Viruses → Predicted Viral | 1517 | Open in IMG/M |
| 3300025251|Ga0208182_1058518 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 776 | Open in IMG/M |
| 3300025264|Ga0208029_1096621 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 540 | Open in IMG/M |
| 3300025277|Ga0208180_1033548 | All Organisms → Viruses → Predicted Viral | 1430 | Open in IMG/M |
| 3300025277|Ga0208180_1042617 | All Organisms → Viruses → Predicted Viral | 1209 | Open in IMG/M |
| 3300025282|Ga0208030_1050268 | All Organisms → Viruses → Predicted Viral | 1188 | Open in IMG/M |
| 3300025282|Ga0208030_1077782 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 876 | Open in IMG/M |
| 3300025508|Ga0208148_1040005 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 1212 | Open in IMG/M |
| 3300025712|Ga0209305_1048567 | All Organisms → Viruses → Predicted Viral | 1486 | Open in IMG/M |
| 3300025822|Ga0209714_1176813 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 524 | Open in IMG/M |
| 3300027788|Ga0209711_10451158 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 515 | Open in IMG/M |
| 3300028125|Ga0256368_1048079 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 753 | Open in IMG/M |
| 3300028599|Ga0265309_10817287 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 638 | Open in IMG/M |
| 3300029448|Ga0183755_1033349 | All Organisms → Viruses → Predicted Viral | 1483 | Open in IMG/M |
| 3300031519|Ga0307488_10113971 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 1948 | Open in IMG/M |
| 3300032274|Ga0316203_1147416 | All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157 | 655 | Open in IMG/M |
| 3300032277|Ga0316202_10054460 | All Organisms → Viruses → Predicted Viral | 1873 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 37.59% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 26.24% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 12.77% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.96% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.55% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.84% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.13% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 1.42% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.42% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.42% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.42% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.71% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.71% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.71% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.71% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.71% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007900 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf. Combined Assembly of MM1PM1 | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008216 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar | Environmental | Open in IMG/M |
| 3300008217 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 | Environmental | Open in IMG/M |
| 3300008218 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 | Environmental | Open in IMG/M |
| 3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
| 3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009418 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009437 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009602 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 | Environmental | Open in IMG/M |
| 3300009603 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 | Environmental | Open in IMG/M |
| 3300009606 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009620 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017734 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2) | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300021084 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025066 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025078 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025097 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025251 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 (SPAdes) | Environmental | Open in IMG/M |
| 3300025264 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025277 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 (SPAdes) | Environmental | Open in IMG/M |
| 3300025282 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025712 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes) | Environmental | Open in IMG/M |
| 3300025822 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300028599 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300032274 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24006J15134_102418082 | 3300001450 | Marine | MKEIDQMLXQWIHSSIIRAKLRELIVKENFKSFHLGVEHEQITN* |
| JGI24005J15628_101506902 | 3300001589 | Marine | MKEIDQMLDQWIHSSIIRAKLRELIVKENFKSFHLGVEHEQITN* |
| JGI25128J35275_10059204 | 3300002488 | Marine | MREIDNMLNQWIHSSIIRAKLRELIVKENFKSFDLGVEYKKELKK* |
| Ga0065861_11557311 | 3300004448 | Marine | MKEIDQMLDQWIYNSIIRAKLRELIVDECFKTFHLGVEHKEEK* |
| Ga0075466_10586464 | 3300006029 | Aqueous | MKEIDDMLNHWIHNSIIRAKLRELIVKENFKSFDLGVEDGKQTK* |
| Ga0070744_100211096 | 3300006484 | Estuarine | VEEIDQMLDQWIHNSIVRAKLRELIVKENFKSFDLGVEYKKELKK* |
| Ga0098038_12992892 | 3300006735 | Marine | MKEIDQMLNQWIHSSIIRAKLRELIVKECFKSFDLGVEHKKESKK* |
| Ga0098037_12024924 | 3300006737 | Marine | MKEIDQMLKQWIHSSIIRAKLRELIVKECFKSFDLGVED |
| Ga0098037_12276863 | 3300006737 | Marine | MKEIDQMLNQWIHSSIIRAKLRELIVKENFKSFDLGVEYKKELKR* |
| Ga0098035_12259122 | 3300006738 | Marine | LKEIDNMLNQWIHSSIIRAKLRELIVKENFKSFDLGVEYKKEIKK* |
| Ga0098042_11604752 | 3300006749 | Marine | MKEIDQMLDQWIHNSIIRAKLRELIVKENFKSFDLGVEYSKQTK* |
| Ga0098042_11860441 | 3300006749 | Marine | MKEIDKMLNQWIHNSIIRAKLRELIVKENFKSFDLGVEHKKELKK* |
| Ga0098058_10716472 | 3300006750 | Marine | MKEIDQMLNQWIHNSIIRAKLRELIVKENFKSFDLGVEDGKQTK* |
| Ga0098054_10815925 | 3300006789 | Marine | MKEIDQLINQWIHSSIIRAKLRELIVKENFKSFDLGVEHSKQTK* |
| Ga0098054_13180722 | 3300006789 | Marine | MKEIDQMLKQWIHNSIIRAKLRELIVKECFKSFDLGVEHKKELKK* |
| Ga0098055_11272772 | 3300006793 | Marine | MKEIDQMLDQWIHSSIIRAKLRELIVKENFKSFDLGVEYKKELKK* |
| Ga0098055_11752872 | 3300006793 | Marine | MREIDKMLAQWIHNSIIRAKLRELIVDECFKSFHLGVEHEPDTKVNI* |
| Ga0098055_12555422 | 3300006793 | Marine | MKEIDQMLDQWIHNSIIRAKLRELIVKENFKSFDLGVEYKKELKK* |
| Ga0070748_12525722 | 3300006920 | Aqueous | MKEIDQMLKQWIHSSIIRAKLRELIVKENFKSFDLGVEDGKQTK* |
| Ga0098060_10378984 | 3300006921 | Marine | MKEIDQMLKQWIHNSIIRAKLRELIVKENFKSFDLGVEDGKQTK* |
| Ga0098060_10860082 | 3300006921 | Marine | MKEIDQMLHQWIHSSIIRAKLRELIVDECFKTFHLGVEHEQILKK* |
| Ga0098060_11281641 | 3300006921 | Marine | MKEIDQMLHQWIHSSIIRAKLRELIVKENFKSFDLGVEDGKQTK* |
| Ga0098060_11743263 | 3300006921 | Marine | MKEIDQMLNQWIHNSIIRAKLRELIVKECFKSFDLGVEHKKELKK* |
| Ga0098060_11893561 | 3300006921 | Marine | MKEIDQMLKQWIHNSIIRAKLRELIVKENFKSFDLGVEYKKELKK* |
| Ga0098051_10277247 | 3300006924 | Marine | MKEIDQMLDQWIHNSIIRAKLRELIVKENFKSFDLGVEDGKQTK* |
| Ga0098050_10851352 | 3300006925 | Marine | LKEIDQMLDQWIHSSVIRAKLRELIVKENFKSFDLGVEYKKELKK* |
| Ga0098041_10231322 | 3300006928 | Marine | MKEIDQMLNQWIHNSIIRDKLRELIVKENFKSFDLGVEHKKELKK* |
| Ga0098041_11184031 | 3300006928 | Marine | RMKEIDQMLNQWIHSSIIRAKLRELIVKENFKSFDLGVEYKKELKR* |
| Ga0070747_13174251 | 3300007276 | Aqueous | MKEIDNMLNQWIHNSIIRAKLRELIVKENFKSFDLGVEDGKQTK* |
| Ga0111031_10572244 | 3300007900 | Marine Sediment | MKEIDQMLDQWIHSSIIRAKLRELIVKENFKSFDLGVEDGKQTK* |
| Ga0098052_12144912 | 3300008050 | Marine | MKEIDNMLNQWIHSSIIRAKLRELIVKENFKSFDLGVEYKKEIKK* |
| Ga0114898_10244783 | 3300008216 | Deep Ocean | MKEIDQMLGQWIHSSIIRAKLRELIVKENFKSFDLGVEHKKELKK* |
| Ga0114899_11590001 | 3300008217 | Deep Ocean | MKEIDNMLNQWIHSGIIRAKLRELIVKENFKSFDLGVEYKKELKK* |
| Ga0114904_10709143 | 3300008218 | Deep Ocean | MKEIDNMLNQWIHSSIIRAKLRELIVKENFKSFDLGVEHKKEINK* |
| Ga0114905_11255563 | 3300008219 | Deep Ocean | MKEIDQMLGQWIHSSIIRAKLRELIVKENFKSFDLGVEHKK |
| Ga0114910_11690332 | 3300008220 | Deep Ocean | MKEIDQMLNQWIHSSIIRAKLRELIVKENFKSFDLGVEYKKELKK* |
| Ga0114910_12039393 | 3300008220 | Deep Ocean | MLGQWIHSSIIRAKLRELIVKENFKSFDLGVEHKKELKK* |
| Ga0114910_12222013 | 3300008220 | Deep Ocean | QMLGQWIHSSIIRAKLRELIVKENFKSFDLGVEHKKELKK* |
| Ga0115566_105375693 | 3300009071 | Pelagic Marine | MKEIDQMLDQWIHNGIIRAKLRELIVKENFKSFDLGVEDGKQTK* |
| Ga0114995_106418501 | 3300009172 | Marine | MLNMKEIDQMLGQWIHNSIIRAKLRELIVKENFKSFDLGVEHKEELKK* |
| Ga0114996_112275691 | 3300009173 | Marine | HKDMKEIDEKLDQWIHNSIIRAEIRELIVKENFKSFDLGVEYKKEIKK* |
| Ga0115551_10561683 | 3300009193 | Pelagic Marine | MKEIDQMLDQWIHSSVIRAKLRELIVKENFKSFDLGVEYKK* |
| Ga0114908_11571543 | 3300009418 | Deep Ocean | MKEIDNMLNQWIHSSIIRAKLRELIVKENFKSFDLGVEHKKELKK* |
| Ga0114994_106736682 | 3300009420 | Marine | MKEIDEKLDQWIYSSIIRAEIRELIVKENFKSFDLGVEYKKEIKK* |
| Ga0115556_13087191 | 3300009437 | Pelagic Marine | MKEIDNMLDQWIHSSIIRAKLRELIVKENFKSFDLGVEYKK* |
| Ga0115003_101075923 | 3300009512 | Marine | MKEIDQMLDQWIHSSIIRAKLRELIVDECFKTFHLGVEHKEEK* |
| Ga0115003_106369852 | 3300009512 | Marine | MLNMKEIDQMLDQWIHNSIIRAKLRELIVKENFKSFDLGVEYKKEIKK* |
| Ga0114900_10827055 | 3300009602 | Deep Ocean | MKEIDNMLNQWIHSSVIRAKLRELIVKENFKSFDLGVEYKKELNK* |
| Ga0114911_11681761 | 3300009603 | Deep Ocean | MKEIDQMLGQWIHSSIIRAKLRELIVKENFKSFDLGV |
| Ga0115102_102610832 | 3300009606 | Marine | MKEIDDMLGHWIHNSIIRAKLRELIVKENFKSFDLGVEHSKQTK* |
| Ga0114912_10537912 | 3300009620 | Deep Ocean | MKEIDQMLNQWIHSSIIRAKLRELIVKENFKSFDLGVEHKKELKK* |
| Ga0098049_12491652 | 3300010149 | Marine | MKEIDKMLNQWIHNSIIRAKLRELIVKENFKSFDLGVEYKKELKK* |
| Ga0098056_12869352 | 3300010150 | Marine | MKEIDQMLDQWIHNSIIRAKLRELIVKENFKSFDLGVEYKKEIKK* |
| Ga0098059_11447322 | 3300010153 | Marine | MKEIDQMLNQWIHNSIIRAKLRELIVDECFKTFHLGVEHEQILKK* |
| Ga0098059_12037482 | 3300010153 | Marine | MKEIDQMLDQWIHNSIIRAKLRELIVKECFKSFDLGVEHGKQIKIDKI* |
| Ga0098047_102418473 | 3300010155 | Marine | MLDQWIHSSIIRAKLRELIVKENFKSFDLGVEYKKEIKK* |
| Ga0133547_110472406 | 3300010883 | Marine | MKEIDEKLDQWIHNSIIRAEIRELIVKENFKSFDLGVEYKKEIKK* |
| Ga0180120_102871903 | 3300017697 | Freshwater To Marine Saline Gradient | MKEIDQMLDQWIHSSIIRAKLRELIVKENFKSFDLGVEDGKQTK |
| Ga0181369_10858902 | 3300017708 | Marine | MKEIDKMLNQWIHNSIIRAKLRELIVKENFKSFDLGVEDGKQTK |
| Ga0181369_11188023 | 3300017708 | Marine | MKEIDKMLNQWIHNSIIRAKLRELIVKECFKSFDLGVEH |
| Ga0181387_10914103 | 3300017709 | Seawater | MKEIDQMLNQWIHSSIIRAKLRELIVKECFKSFDLGVEDGKQTK |
| Ga0181391_10056097 | 3300017713 | Seawater | MEEIDQMLNQWIHNSIIRAKLRELIVKENFKSFDLGVEHKKELKK |
| Ga0181412_10288743 | 3300017714 | Seawater | VEEIDKMLNQWIHNSIIRAKLRELIVKENFKSFDLGVEYKKELKK |
| Ga0181412_10443324 | 3300017714 | Seawater | MMKEIDQMLNQWIHSSIIRAKLRELIVKENFKSFHLGVEHEQILKK |
| Ga0181404_11064832 | 3300017717 | Seawater | MKEIDQMLKQWIHSSIIRAKLRELIVKENFKSFDLGVEHSKQTK |
| Ga0181390_10310968 | 3300017719 | Seawater | MKEIDQMLKQWIHSSIIRAKLRELIVKENFKSFDLG |
| Ga0181390_10514743 | 3300017719 | Seawater | MEEIDKMLNQWIHNSIIRAKLRELIVKENFKSFDLGVEYKKELKK |
| Ga0181373_10461444 | 3300017721 | Marine | MKEIDQMLDQWIHNSIIKAKLRELIVKENFKSFDLGVEYKKELKK |
| Ga0181401_11022371 | 3300017727 | Seawater | EMKEIDQMLDQWIHSSIIRAKLRELIVKENFKSFDLGVEYKKELKK |
| Ga0181419_10373853 | 3300017728 | Seawater | MKEIDQMLDQWIHNSIIRARLRELIVKENFKSFDLGVEYKKELKK |
| Ga0187222_10709311 | 3300017734 | Seawater | MKEIDQMLDQWIHSSIIRAKLRELIVKENFKSFDLGVEYSKQTK |
| Ga0187222_10751391 | 3300017734 | Seawater | DQMLKQWIHNSIIRAKLRELIVKENFKSFHLGVEHEQILKK |
| Ga0187218_11122782 | 3300017737 | Seawater | MKEIDQMLNQWIHSSIIRAKLRELIVKENFKSFDLGVEHEQILKK |
| Ga0181433_10942563 | 3300017739 | Seawater | MEEIDKMLKQWIHSSIIRAKLRELIVKENFKSFHLGVEHEQILKK |
| Ga0181433_11318403 | 3300017739 | Seawater | CTNKSNKRMEEIDQMLDQWIRNSIVRAKLRELIVKENFKSFDLGVEYKKELKK |
| Ga0181421_10758081 | 3300017741 | Seawater | VEEIDQMLDQWIHNSIVRAKLRELIVKENFKSFDLGVEHKEELKK |
| Ga0181402_11749303 | 3300017743 | Seawater | MKEIDQMLKQWIHSSIIRAKLRELIVKENFKSFDLGVEYKKE |
| Ga0181397_11005031 | 3300017744 | Seawater | IDNMLKQWIHSSIIRAKLRELIVNECFKSFHLGVEHEQILKK |
| Ga0181427_11275551 | 3300017745 | Seawater | VKEIDQMLKQWIHSSIIRAKLRELIVKENFKSFDLG |
| Ga0181389_11513863 | 3300017746 | Seawater | MKEIDQMLNQWIHNSIIRAKLRELIVNECFKSFHLGVEHEQILKK |
| Ga0181393_10273115 | 3300017748 | Seawater | MEEIDQMLNQWIHNSVIRAKLRELIVKENFKSFDLGVEYKKELKK |
| Ga0181405_10093582 | 3300017750 | Seawater | MKEIDNMLKQWIHSSIIRAKLRELIVNECFKSFHLGVEHEQILKK |
| Ga0187219_11828414 | 3300017751 | Seawater | VKEIDQMLNQWIHNSIIRAKLRELIVKENFKSFHLGVEHEQITN |
| Ga0181407_11688932 | 3300017753 | Seawater | MKEIDDMLDHWIHNSIIRAKLRELIVKENFKSFDLGVE |
| Ga0181411_11741201 | 3300017755 | Seawater | MKEIDQMLDQWIHNSIIRARLRELIVKENFKSFDLGVEYKKELKKXTI |
| Ga0181382_11564343 | 3300017756 | Seawater | MKEIDQMLDQWIHSSVIRAKLRELIVKENFKSFDLGVEYKKELKK |
| Ga0181420_12088253 | 3300017757 | Seawater | VEEIDKMLNQWIYNSIIRAKLRELIVKENFKSFDLGVEYKKELKK |
| Ga0181409_12194831 | 3300017758 | Seawater | MKEIDQMLNQWIHSSIIRAKLRELIVKENFKSFHLGVEHEQILKK |
| Ga0181408_11707492 | 3300017760 | Seawater | MEEIDQMLKQWIHSSIIRAKLRELIVKENFKSFHLGVEHEQILKK |
| Ga0181406_12607231 | 3300017767 | Seawater | MKEIDDMLNHWIHNSIIRAKLRELIVKENFKSFDLGVEYSKQTK |
| Ga0187220_11745132 | 3300017768 | Seawater | MKEIDQMLDQWIHSSIIRAKLRELIVKENFKSFHLGVEHEQILKK |
| Ga0187217_11667813 | 3300017770 | Seawater | MKEIDDMLNHWIHNSIIRAKLRELIVKENFKSFHLGVEHEQILKK |
| Ga0187217_12073013 | 3300017770 | Seawater | MKEIDQMLGQWIHSSIIRAKLRELIVNECFKSFHLGVEHEQILKK |
| Ga0181425_10226784 | 3300017771 | Seawater | MKEIDQMLDQWIHSSIIRAKLRELIVKENFKSFDLGVEYKKELKK |
| Ga0181425_11270634 | 3300017771 | Seawater | MEEIDQMLDQWIRNSIVRAKLRELIVKECFKSFDLGVEDGKQTK |
| Ga0181430_11991653 | 3300017772 | Seawater | MKEIDQMLHQWIHSSIIRAKLRELIVKENFKSFDLGVEHKEELKK |
| Ga0181386_11742983 | 3300017773 | Seawater | MMKEIDQMLNQWIHSGIIRAKLRELIVKENFKSFHLGVEHEQILKK |
| Ga0181380_12964673 | 3300017782 | Seawater | VEEIDQMLDQWIHNSIVRAKLRELIVKENFKSFDLGVEYKKELK |
| Ga0206131_1000456917 | 3300020185 | Seawater | MKEIDQMLNQWIHNSIIRAKLRELIVKENFKSFDLGVEDGKQTK |
| Ga0206131_103695683 | 3300020185 | Seawater | MKEIDDMLGHWIHNSIIRAKLRELIVKENFKSFDLGVEDGKQTK |
| Ga0211576_103669943 | 3300020438 | Marine | MKEIDQMLKQWIHNSIIRAKLRELIVKENFKSFDLGVEHS |
| Ga0211576_105067221 | 3300020438 | Marine | VKEIDQMLKQWIHSSIIRAKLRELIVKENFKSFDLGVEHEQILKK |
| Ga0206678_103320312 | 3300021084 | Seawater | VKEIDQMLHQWIHSSIIRAKLRELIVDECFKTFHLGVEHEQILKK |
| Ga0206677_100645683 | 3300021085 | Seawater | MMKEIDQMLNQWIHSSIIRAKLRELIVKENFKSFDLGVEHEQILKK |
| Ga0222717_103160432 | 3300021957 | Estuarine Water | VKEIDQMLKQWIHSSIIRAKLRELIVNECFKSFHLGVEHEQILKK |
| Ga0222716_104121222 | 3300021959 | Estuarine Water | MKEIDDMLGHWIHNSIIRAKLRELIVKENFKSFDLGVEHSKQTK |
| Ga0222716_105238072 | 3300021959 | Estuarine Water | MKEIDQMLDQWIHSSIIRAKLRELIVNECFKSFHLGVEHEQILKK |
| Ga0212023_10354601 | 3300022061 | Aqueous | MKEIDDMLNHWIHNSIIRAKLRELIVKENFKSFDLGVEDGK |
| Ga0212023_10620152 | 3300022061 | Aqueous | MKEIDQMLKQWIHSSIIRAKLRELIVKENFKSFDLGVEDGKQTK |
| Ga0196889_10307183 | 3300022072 | Aqueous | MKEIDNMLNQWIHNSIIRAKLRELIVKENFKSFDLGVEDGKQTK |
| Ga0244775_102334403 | 3300024346 | Estuarine | VEEIDQMLDQWIHNSIVRAKLRELIVKENFKSFDLGVEYKKELKK |
| Ga0208012_10373542 | 3300025066 | Marine | MLNQWIHSSIIRAKLRELIVKENFKSFDLGVEYKKEIKK |
| Ga0208668_10592304 | 3300025078 | Marine | MLDQWIHSSIIRAKLRELIVKENFKSFDLGVEYKKEIKK |
| Ga0208298_10884272 | 3300025084 | Marine | MKEIDQLINQWIHSSIIRAKLRELIVKENFKSFDLGVEHSKQTK |
| Ga0208157_10250666 | 3300025086 | Marine | MKEIDQMLNQWIHSSIIRAKLRELIVKENFKSFDLGVEYKKELKR |
| Ga0208010_10841762 | 3300025097 | Marine | LKEIDNMLNQWIHSSIIRAKLRELIVKENFKSFDLGVEYKKEIKK |
| Ga0208669_10075633 | 3300025099 | Marine | MKEIDQMLDQWIHNSIIRAKLRELIVKENFKSFDLGVEYKKELKK |
| Ga0208669_10132234 | 3300025099 | Marine | MKEIDQMLKQWIHNSIIRAKLRELIVKENFKSFDLGVEDGKQTK |
| Ga0208669_10938564 | 3300025099 | Marine | MKEIDQMLHQWIHSSIIRAKLRELIVKENFKSFDLGVEDGKQTK |
| Ga0208669_11083612 | 3300025099 | Marine | MKEIDQMLDQWIHNSIIRAKLRELIVKENFKSFDLGVEYSKQTK |
| Ga0208793_11275033 | 3300025108 | Marine | VKEIDQMLNQWIHSSIIRAKLRELIVKENFKSFDLGVEYKKELKK |
| Ga0208158_11323601 | 3300025110 | Marine | VKEIDQMLNQWIHSSIIRAKLRELIVKECFKSFDLGVE |
| Ga0208158_11485512 | 3300025110 | Marine | MKEIDQMLNQWIHSSIIRAKLRELIVKECFKSFDLGVEHKKESKK |
| Ga0209232_11245085 | 3300025132 | Marine | NNKIIVKEIDQMLKQWIHSSIIRAKLRELIVKENFKSFDLGVEYKKELKK |
| Ga0208182_10229635 | 3300025251 | Deep Ocean | MKEIDQMLGQWIHSSIIRAKLRELIVKENFKSFDLGVEHKKELKK |
| Ga0208182_10585181 | 3300025251 | Deep Ocean | MKEIDQMLNQWIHSSIIRAKLRELIVKENFKSFDLGVEHKKEINK |
| Ga0208029_10966212 | 3300025264 | Deep Ocean | MKEIDQMLDQWIHSSIIRAKLRELIVKENFKSFDLGVEHKKELKKXTI |
| Ga0208180_10335486 | 3300025277 | Deep Ocean | MKEIDQMLGQWIHSSIIRAKLRELIVKENFKSFDLGVEHKKE |
| Ga0208180_10426176 | 3300025277 | Deep Ocean | MKEIDNMLNQWIHSSIIRAKLRELIVKENFKSFDLGVEYKKELKK |
| Ga0208030_10502681 | 3300025282 | Deep Ocean | MKEIDQMLGQWIHSSIIRAKLRELIVKENFKSFDLGVEYKKELKK |
| Ga0208030_10777821 | 3300025282 | Deep Ocean | GQWIHSSIIRAKLRELIVKENFKSFDLGVEYKKELKK |
| Ga0208148_10400054 | 3300025508 | Aqueous | MKEIDDMLNHWIHNSIIRAKLRELIVKENFKSFDLGVEDGKQTK |
| Ga0209305_10485673 | 3300025712 | Pelagic Marine | MKEIDQMLDQWIHSSVIRAKLRELIVKENFKSFDLGVEYKK |
| Ga0209714_11768133 | 3300025822 | Pelagic Marine | MKEIDNMLDQWIHSSIIRAKLRELIVKENFKSFDLGVEHKKELKK |
| Ga0209711_104511583 | 3300027788 | Marine | MKEIDQMLDQWIHSSIIRAKLRELIVDECFKTFHLGVEHKEELKK |
| Ga0256368_10480793 | 3300028125 | Sea-Ice Brine | MKEIDEKLDQWIYSSIIRAEIRELIVKENFKSFDLGVEYKKEIKK |
| Ga0265309_108172873 | 3300028599 | Sediment | MKEIDNMLDQWIHSSIIRAKLRELIVKENFKSFDLGVEDGKQTK |
| Ga0183755_10333491 | 3300029448 | Marine | MKEIDNMLNQWIHSSIIRAKLRELIVKENFKSFDLGVEYKKELNK |
| Ga0307488_101139718 | 3300031519 | Sackhole Brine | MKEIDEKLDQWIHNSIIRAEIRELIVKENFKSFDLGVEYKKEIKK |
| Ga0316203_11474162 | 3300032274 | Microbial Mat | MKEIDNMLNHWIHNSIIRAKLRELIVKENFKSFDLGVEDGKQTK |
| Ga0316202_100544601 | 3300032277 | Microbial Mat | MKEIDQMLDQWIHNSIIRAKLRELIVKENFKSFDLGVEDGKQTK |
| ⦗Top⦘ |