| Basic Information | |
|---|---|
| Family ID | F053253 |
| Family Type | Metagenome |
| Number of Sequences | 141 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MIDFDLDTPIEKILTDMLDKVEGHVGDCDCVNCNSLEVLAYMIKVEE |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 141 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 75.18 % |
| % of genes near scaffold ends (potentially truncated) | 29.79 % |
| % of genes from short scaffolds (< 2000 bps) | 69.50 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (67.376 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater (17.021 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.482 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (56.738 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.33% β-sheet: 0.00% Coil/Unstructured: 62.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 141 Family Scaffolds |
|---|---|---|
| PF06067 | DUF932 | 21.99 |
| PF08241 | Methyltransf_11 | 0.71 |
| PF00535 | Glycos_transf_2 | 0.71 |
| PF02675 | AdoMet_dc | 0.71 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.71 |
| PF07463 | NUMOD4 | 0.71 |
| PF00210 | Ferritin | 0.71 |
| PF00565 | SNase | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 141 Family Scaffolds |
|---|---|---|---|
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.58 % |
| Unclassified | root | N/A | 1.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352005|2200032339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 718 | Open in IMG/M |
| 3300001282|B570J14230_10033043 | All Organisms → Viruses → Predicted Viral | 1821 | Open in IMG/M |
| 3300001282|B570J14230_10058405 | All Organisms → Viruses → Predicted Viral | 1255 | Open in IMG/M |
| 3300002274|B570J29581_102835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1117 | Open in IMG/M |
| 3300002294|B570J29584_1001157 | All Organisms → Viruses → Predicted Viral | 2474 | Open in IMG/M |
| 3300002296|B570J29587_1001141 | All Organisms → Viruses → Predicted Viral | 2577 | Open in IMG/M |
| 3300002306|B570J29618_1001936 | All Organisms → Viruses → Predicted Viral | 1435 | Open in IMG/M |
| 3300002381|B570J29641_1008745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
| 3300002386|B570J29613_1010647 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
| 3300002393|B570J29605_1002890 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1184 | Open in IMG/M |
| 3300002835|B570J40625_100000613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 60923 | Open in IMG/M |
| 3300002835|B570J40625_100009318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17944 | Open in IMG/M |
| 3300002835|B570J40625_100059939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5232 | Open in IMG/M |
| 3300002835|B570J40625_100078021 | All Organisms → Viruses → Predicted Viral | 4314 | Open in IMG/M |
| 3300002835|B570J40625_100202798 | All Organisms → Viruses → Predicted Viral | 2146 | Open in IMG/M |
| 3300003411|JGI25911J50253_10100451 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 884 | Open in IMG/M |
| 3300005527|Ga0068876_10293509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 924 | Open in IMG/M |
| 3300005527|Ga0068876_10406311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 759 | Open in IMG/M |
| 3300006639|Ga0079301_1106189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 856 | Open in IMG/M |
| 3300007162|Ga0079300_10063415 | All Organisms → Viruses → Predicted Viral | 1134 | Open in IMG/M |
| 3300007165|Ga0079302_1084268 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
| 3300007165|Ga0079302_1106479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
| 3300007973|Ga0105746_1113475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 897 | Open in IMG/M |
| 3300008106|Ga0114339_1041484 | All Organisms → Viruses → Predicted Viral | 2365 | Open in IMG/M |
| 3300008107|Ga0114340_1051914 | All Organisms → Viruses → Predicted Viral | 1790 | Open in IMG/M |
| 3300008107|Ga0114340_1063950 | All Organisms → Viruses → Predicted Viral | 1570 | Open in IMG/M |
| 3300008107|Ga0114340_1237598 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
| 3300008107|Ga0114340_1265617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
| 3300008108|Ga0114341_10379584 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
| 3300008110|Ga0114343_1075971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1219 | Open in IMG/M |
| 3300008111|Ga0114344_1055204 | All Organisms → Viruses → Predicted Viral | 1521 | Open in IMG/M |
| 3300008114|Ga0114347_1004592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13867 | Open in IMG/M |
| 3300008114|Ga0114347_1050531 | All Organisms → Viruses → Predicted Viral | 1773 | Open in IMG/M |
| 3300008114|Ga0114347_1163686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 783 | Open in IMG/M |
| 3300008116|Ga0114350_1003978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7597 | Open in IMG/M |
| 3300008116|Ga0114350_1004026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9612 | Open in IMG/M |
| 3300008120|Ga0114355_1018802 | All Organisms → Viruses → Predicted Viral | 3683 | Open in IMG/M |
| 3300008120|Ga0114355_1096591 | All Organisms → Viruses → Predicted Viral | 1173 | Open in IMG/M |
| 3300008120|Ga0114355_1157437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 796 | Open in IMG/M |
| 3300008120|Ga0114355_1196933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 654 | Open in IMG/M |
| 3300008264|Ga0114353_1203513 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 931 | Open in IMG/M |
| 3300008450|Ga0114880_1076050 | All Organisms → Viruses → Predicted Viral | 1351 | Open in IMG/M |
| 3300009081|Ga0105098_10653264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
| 3300009159|Ga0114978_10589187 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
| 3300009165|Ga0105102_10139990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1171 | Open in IMG/M |
| 3300009170|Ga0105096_10558790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
| 3300009183|Ga0114974_10048092 | All Organisms → Viruses → Predicted Viral | 2871 | Open in IMG/M |
| 3300009183|Ga0114974_10341711 | Not Available | 870 | Open in IMG/M |
| 3300009183|Ga0114974_10445191 | Not Available | 735 | Open in IMG/M |
| 3300010354|Ga0129333_11523247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
| 3300010885|Ga0133913_10633872 | All Organisms → Viruses → Predicted Viral | 2803 | Open in IMG/M |
| 3300011010|Ga0139557_1000756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7679 | Open in IMG/M |
| 3300011011|Ga0139556_1042609 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
| 3300011268|Ga0151620_1030259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1850 | Open in IMG/M |
| 3300013372|Ga0177922_10962048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
| 3300017777|Ga0181357_1113231 | All Organisms → Viruses → Predicted Viral | 1022 | Open in IMG/M |
| 3300019784|Ga0181359_1058222 | All Organisms → Viruses → Predicted Viral | 1482 | Open in IMG/M |
| 3300020141|Ga0211732_1169604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
| 3300020151|Ga0211736_10295612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2488 | Open in IMG/M |
| 3300020151|Ga0211736_10508614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 918 | Open in IMG/M |
| 3300020159|Ga0211734_10006513 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2883 | Open in IMG/M |
| 3300020159|Ga0211734_10260469 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 865 | Open in IMG/M |
| 3300020160|Ga0211733_10127973 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2700 | Open in IMG/M |
| 3300020160|Ga0211733_10728320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1010 | Open in IMG/M |
| 3300020161|Ga0211726_10097548 | All Organisms → Viruses → Predicted Viral | 1916 | Open in IMG/M |
| 3300020161|Ga0211726_10225267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1889 | Open in IMG/M |
| 3300020161|Ga0211726_11056450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 835 | Open in IMG/M |
| 3300020172|Ga0211729_10589995 | All Organisms → Viruses → Predicted Viral | 1574 | Open in IMG/M |
| 3300020172|Ga0211729_10713197 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 836 | Open in IMG/M |
| 3300020172|Ga0211729_11281625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
| 3300020498|Ga0208050_1001188 | All Organisms → Viruses → Predicted Viral | 3727 | Open in IMG/M |
| 3300020506|Ga0208091_1011242 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1109 | Open in IMG/M |
| 3300020515|Ga0208234_1002189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3003 | Open in IMG/M |
| 3300020515|Ga0208234_1013238 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1000 | Open in IMG/M |
| 3300020517|Ga0208854_1049433 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300020527|Ga0208232_1009139 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1560 | Open in IMG/M |
| 3300020530|Ga0208235_1024235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 739 | Open in IMG/M |
| 3300020542|Ga0208857_1010038 | All Organisms → Viruses → Predicted Viral | 1616 | Open in IMG/M |
| 3300020549|Ga0207942_1024054 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 773 | Open in IMG/M |
| 3300020550|Ga0208600_1032735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 811 | Open in IMG/M |
| 3300020558|Ga0208362_1019180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1285 | Open in IMG/M |
| 3300021962|Ga0222713_10019337 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5763 | Open in IMG/M |
| 3300021963|Ga0222712_10725695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
| 3300022200|Ga0196901_1160175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 744 | Open in IMG/M |
| 3300027114|Ga0208009_1007833 | All Organisms → Viruses → Predicted Viral | 2733 | Open in IMG/M |
| 3300027114|Ga0208009_1023706 | All Organisms → Viruses → Predicted Viral | 1344 | Open in IMG/M |
| 3300027114|Ga0208009_1064009 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 654 | Open in IMG/M |
| 3300027380|Ga0208432_1003052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3327 | Open in IMG/M |
| 3300027499|Ga0208788_1042780 | All Organisms → Viruses → Predicted Viral | 1254 | Open in IMG/M |
| 3300027600|Ga0255117_1112479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1022513 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4518 | Open in IMG/M |
| 3300027756|Ga0209444_10056425 | All Organisms → Viruses → Predicted Viral | 1747 | Open in IMG/M |
| 3300027759|Ga0209296_1000609 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 30969 | Open in IMG/M |
| 3300027759|Ga0209296_1001093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 21702 | Open in IMG/M |
| 3300027793|Ga0209972_10040452 | All Organisms → Viruses → Predicted Viral | 2610 | Open in IMG/M |
| 3300027816|Ga0209990_10022557 | All Organisms → Viruses → Predicted Viral | 3514 | Open in IMG/M |
| 3300028025|Ga0247723_1005453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5730 | Open in IMG/M |
| 3300028025|Ga0247723_1009358 | All Organisms → Viruses → Predicted Viral | 3928 | Open in IMG/M |
| (restricted) 3300028114|Ga0247835_1130221 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 937 | Open in IMG/M |
| (restricted) 3300028581|Ga0247840_10081019 | All Organisms → Viruses → Predicted Viral | 2252 | Open in IMG/M |
| 3300029930|Ga0119944_1000199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10526 | Open in IMG/M |
| 3300031758|Ga0315907_10009747 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9659 | Open in IMG/M |
| 3300031758|Ga0315907_10031603 | All Organisms → Viruses → Predicted Viral | 4772 | Open in IMG/M |
| 3300031758|Ga0315907_10049794 | All Organisms → Viruses → Predicted Viral | 3691 | Open in IMG/M |
| 3300031758|Ga0315907_10053247 | All Organisms → Viruses → Predicted Viral | 3552 | Open in IMG/M |
| 3300031758|Ga0315907_10856613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 672 | Open in IMG/M |
| 3300031758|Ga0315907_10932240 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| 3300031787|Ga0315900_10601131 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 804 | Open in IMG/M |
| 3300031857|Ga0315909_10564542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 769 | Open in IMG/M |
| 3300031857|Ga0315909_10590888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 744 | Open in IMG/M |
| 3300031857|Ga0315909_10745310 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
| 3300031857|Ga0315909_10812072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
| 3300031857|Ga0315909_10864950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
| 3300031951|Ga0315904_10451303 | All Organisms → Viruses → Predicted Viral | 1149 | Open in IMG/M |
| 3300031951|Ga0315904_10793516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 780 | Open in IMG/M |
| 3300031963|Ga0315901_10846159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
| 3300032050|Ga0315906_10014094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9147 | Open in IMG/M |
| 3300032116|Ga0315903_10245598 | All Organisms → Viruses → Predicted Viral | 1551 | Open in IMG/M |
| 3300032116|Ga0315903_10313985 | All Organisms → Viruses → Predicted Viral | 1317 | Open in IMG/M |
| 3300032116|Ga0315903_10362837 | All Organisms → Viruses → Predicted Viral | 1195 | Open in IMG/M |
| 3300032116|Ga0315903_10408768 | All Organisms → Viruses → Predicted Viral | 1102 | Open in IMG/M |
| 3300032116|Ga0315903_10720495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 742 | Open in IMG/M |
| 3300032116|Ga0315903_10852266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 658 | Open in IMG/M |
| 3300032116|Ga0315903_10862163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
| 3300033418|Ga0316625_101321655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
| 3300033557|Ga0316617_100019388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3503 | Open in IMG/M |
| 3300033993|Ga0334994_0054526 | All Organisms → Viruses → Predicted Viral | 2480 | Open in IMG/M |
| 3300033993|Ga0334994_0088093 | All Organisms → Viruses → Predicted Viral | 1847 | Open in IMG/M |
| 3300033994|Ga0334996_0049213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2622 | Open in IMG/M |
| 3300033994|Ga0334996_0389431 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 658 | Open in IMG/M |
| 3300034101|Ga0335027_0069510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2775 | Open in IMG/M |
| 3300034101|Ga0335027_0130253 | All Organisms → Viruses → Predicted Viral | 1874 | Open in IMG/M |
| 3300034101|Ga0335027_0530296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 731 | Open in IMG/M |
| 3300034102|Ga0335029_0237291 | All Organisms → Viruses → Predicted Viral | 1186 | Open in IMG/M |
| 3300034102|Ga0335029_0672863 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
| 3300034104|Ga0335031_0017489 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5255 | Open in IMG/M |
| 3300034104|Ga0335031_0197581 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1363 | Open in IMG/M |
| 3300034106|Ga0335036_0553976 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
| 3300034108|Ga0335050_0152514 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1257 | Open in IMG/M |
| 3300034122|Ga0335060_0138249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1430 | Open in IMG/M |
| 3300034283|Ga0335007_0074148 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2572 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 17.02% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 16.31% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 12.77% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 12.77% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.64% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 6.38% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 5.67% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.13% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.42% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.42% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.42% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.42% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.71% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.71% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.71% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.71% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.71% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.71% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.71% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352005 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300002274 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002294 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002296 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002306 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002381 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002386 | Freshwater microbial communities from Lake Mendota, WI - 16NOV2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002393 | Freshwater microbial communities from Lake Mendota, WI - 05NOV2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300007162 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 | Environmental | Open in IMG/M |
| 3300007165 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008106 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-53-LTR | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020515 | Freshwater microbial communities from Lake Mendota, WI - 27SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020517 | Freshwater microbial communities from Lake Mendota, WI - 30NOV2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020542 | Freshwater microbial communities from Lake Mendota, WI - 05NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020550 | Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020558 | Freshwater microbial communities from Lake Mendota, WI - 13OCT2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027380 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series LW 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027600 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8h | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028114 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5m | Environmental | Open in IMG/M |
| 3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2200241476 | 2199352005 | Freshwater | MDFDLDTPIEKILTNMLDNVEGHIVNCDCVNCNSLEVLAYMIMEKE |
| B570J14230_100330435 | 3300001282 | Freshwater | LPRLIHFMLERDIMDFDLDTPISKILTDMLDKVEGHVGDCDCVNCNSLEVLAYMIKVEE* |
| B570J14230_100584055 | 3300001282 | Freshwater | LDTPIEKILTNMLDNVEGHIVNCDCVNCNSLEVLAYMIMEKE* |
| B570J29581_1028352 | 3300002274 | Freshwater | MIDFDLDTPIEKILTDMLDKVEGHVGDCDCVNCNSLEVLAYMIXVEE* |
| B570J29584_10011578 | 3300002294 | Freshwater | MLERDIMDFDLDTPISKILTDMLDKVEGHVGDCDCVNCNSLEVLAYMIKVEE* |
| B570J29587_10011414 | 3300002296 | Freshwater | MDFDLDTPISKNLTDMLDKVEGHVGDCDCVNCNSLEVLAYMIKVEE* |
| B570J29618_10019362 | 3300002306 | Freshwater | MIDFDLDTPIEKILTDMLDKVEGHVGDCDCVNCNSLEVLAYMIKVEE* |
| B570J29641_10087453 | 3300002381 | Freshwater | DTPIEKILTDMLDKVEGHVGDCDCVNCNSLEVLAYMIMVEE* |
| B570J29613_10106471 | 3300002386 | Freshwater | MDFDXDTPXXKILTDMLDKVEGHVGDCDCVNCNSLEVLAYMIKVEE* |
| B570J29605_10028901 | 3300002393 | Freshwater | MDFDLDTPISKILTDMLDKVEGHVGDCDCVNCNSLEVLAYMIYRYA* |
| B570J40625_1000006137 | 3300002835 | Freshwater | MDFDLDTPIEKILTNMLDNVEGHIVNCDCVNCNSLEVLAYMIMEKE* |
| B570J40625_10000931843 | 3300002835 | Freshwater | MIDFDLDTPIEKILTDMLDKVEGHVGDCDCVNCNSLEVLAYMIMVEE* |
| B570J40625_10005993914 | 3300002835 | Freshwater | MDFDLDTPIEKILTDMLDKVEGHVGDCDCVNCNSLEVLAYM |
| B570J40625_1000780216 | 3300002835 | Freshwater | MDFDLDTPIEKILTDMLDKVEGHVGDCDCVNCNSLEVLAYMIKVEE* |
| B570J40625_1002027983 | 3300002835 | Freshwater | MDFDLDTPISKILTDMLDKVEGHVVNCDCVNCNSLEVLAYMIKVEE* |
| JGI25911J50253_101004513 | 3300003411 | Freshwater Lake | MLERVIMDFDLDTPISKILTDMLDKVEGHMPDCDCVNCNSLEVLAYMIKVEEDNA* |
| Ga0068876_102935094 | 3300005527 | Freshwater Lake | MIDFDLEMPLEKILTNMLDKVEGHVVNCSCVDCNSLEVLAYMIKVEE* |
| Ga0068876_104063112 | 3300005527 | Freshwater Lake | MLDFDLEYPLEKILTNMLDKVEGHVVNCKCVDCNSLEVLAYMIMVEE* |
| Ga0079301_11061893 | 3300006639 | Deep Subsurface | MLDFDLEYPLEKILTNMLDKVEGHVINCKCVDCNSLEVLAYMIKVEE* |
| Ga0079300_100634151 | 3300007162 | Deep Subsurface | MDFDLDTPISKILTDMLDKVEGHVGDCDCVNCNSLEVLAYMIKVEE* |
| Ga0079302_10842683 | 3300007165 | Deep Subsurface | MLDFDLEYPLEKILTNMLDKVEGHVVNCKCVDCNSLE |
| Ga0079302_11064792 | 3300007165 | Deep Subsurface | MLDFDLEYPLEKILTNMLDKVEGHVVNCKCVDCNSLEVLAYMIKVEE* |
| Ga0105746_11134752 | 3300007973 | Estuary Water | MLERVTMLDFDLDTPIAKILTDMLDKVEGHIVNCDCINCTSLEVLAYMIMEKEENVKQM* |
| Ga0114339_10414841 | 3300008106 | Freshwater, Plankton | MIDFDLEVPLEKILTDMLDKVEGHVVNCKCVDCNSLEVLAYMIKVEE* |
| Ga0114340_10519145 | 3300008107 | Freshwater, Plankton | MLERDTMLDFDLDTPLEKILTNMLDKVEGHVINCKCVNCNSLEVLAYMIMVEE* |
| Ga0114340_10639504 | 3300008107 | Freshwater, Plankton | MIDFDLEIPLEKILTDMLDKVEGHIVNCQCVDCNSLEVLAYMIKVEE* |
| Ga0114340_12375982 | 3300008107 | Freshwater, Plankton | MLERDIMLDFDLEYPLEKILTNMLDKVEGHVVNCKCVDCNSLEVLAYMIKVEE* |
| Ga0114340_12656172 | 3300008107 | Freshwater, Plankton | MIDFDLSVPLEKILTDMLDKVEGHVINCKCVDCNSLEVLAYMIKVEE* |
| Ga0114341_103795841 | 3300008108 | Freshwater, Plankton | MLERDTMLDFDLEYPLEKILTNMLDKVEGHVVNCKCVDCNSLEVLAYMIMVEE* |
| Ga0114343_10759712 | 3300008110 | Freshwater, Plankton | MLDFDLDTPLEKILTNMLDKVEGHVINCKCVNCNSLEVLAYMIMVEE* |
| Ga0114344_10552043 | 3300008111 | Freshwater, Plankton | MLERDIMLDFDLEYPLEKILTNMLDKVEGHVVNCKCVDCNSLEVLAYMIMVEE* |
| Ga0114347_100459218 | 3300008114 | Freshwater, Plankton | MLEKVTMLDFDLEMPLEKILTQMLDNVEGHIVNCNCKHCMSLEVLAYMIMEKE* |
| Ga0114347_10505312 | 3300008114 | Freshwater, Plankton | MIDFDLDTPLEKILTNMLDKVEGHVVNCKCVDCNSLEVLAYMIMVEE* |
| Ga0114347_11636863 | 3300008114 | Freshwater, Plankton | EYGIDLPRLIHFMLERDIMLDFDLEYPLEKILTNMLDKVEGHVVNCKCVDCNSLEVLAYMIKVEE* |
| Ga0114350_100397810 | 3300008116 | Freshwater, Plankton | MLERVTMLDFDLDVPLEKILTDMLDNVEGHIVNCSCKHCMSLEVLAYMIMEKEENVK* |
| Ga0114350_10040265 | 3300008116 | Freshwater, Plankton | MIDFDLEYPLEKILTNMLDKVEGHVVGCQCVDCNSLEVLAYMIKVEE* |
| Ga0114355_10188027 | 3300008120 | Freshwater, Plankton | MLDFDLEYPLKKLLTNMLDNVEGHVGDCDCVHCISLETLAYMIKVGEDNANI* |
| Ga0114355_10965911 | 3300008120 | Freshwater, Plankton | PLEKILTNMLDKVEGHVVNCKCVDCNSLEVLAYMIMVEE* |
| Ga0114355_11574373 | 3300008120 | Freshwater, Plankton | MIDFDLEYPLEKILTNMLDKVEGHVVNCSCVDCNSLEVLAYMIKVEE* |
| Ga0114355_11969331 | 3300008120 | Freshwater, Plankton | MIDFDLEVPLEKILTDMLDKVEGHVVNCSCVDCNSLEVLAYMIKVEE* |
| Ga0114353_12035132 | 3300008264 | Freshwater, Plankton | MLEKVTMLDFDLEMPLEKILTQMLDNVEGHIVNCNCKHCMSLEVLAYMIMEKEENVK* |
| Ga0114880_10760502 | 3300008450 | Freshwater Lake | MIDFDLEYPLEKILTNMLDKVEGHVVNCKCVDCNSLEVLAYMIKVEE* |
| Ga0105098_106532641 | 3300009081 | Freshwater Sediment | TPLEKILTNMLDKVEGHVVNCKCVDCNSLEVLAYMIKVEE* |
| Ga0114978_105891872 | 3300009159 | Freshwater Lake | MDFNLDTPIAKILTDMLDKVEGHIVNCDCINCTSLEVLAYMIMEKE* |
| Ga0105102_101399902 | 3300009165 | Freshwater Sediment | MLERGIMLDFDLDTPLEKILTNMLDKVEGHVVNCKCVDCNSLEVLAYMIKVEE* |
| Ga0105096_105587902 | 3300009170 | Freshwater Sediment | MLDRVIMDFDLDTPIEKILTDMLDKVEGHVGDCDCVNCNSLEVLAYMIKVEE* |
| Ga0114974_100480925 | 3300009183 | Freshwater Lake | MLERVIMDFDLDTPISKILTDMLDKVEGHMPDCDCVNCNSLEVLAYMIKVEE* |
| Ga0114974_103417113 | 3300009183 | Freshwater Lake | MLERVIMDFNLDTPIAKILTDMLDKVEGHIVNCDCINCTSLEVLAYMIMEKE |
| Ga0114974_104451913 | 3300009183 | Freshwater Lake | MLERVIMFDFDLDTPIAKILTDMLDKVEGHIVNCDCINCTSLEVLAYMIMEKE |
| Ga0129333_115232472 | 3300010354 | Freshwater To Marine Saline Gradient | GIDLPRLILFMLERDIMIDFDLEYPLPKLLEQMLDNAEGHEVGCQCKHCMSLEVLALMIMTEEDNANI* |
| Ga0133913_106338722 | 3300010885 | Freshwater Lake | MLERVIMDFNLDTPISKILTDMLDKVEGHIVNCDCINCTSLEVLAYMIMEKEENA* |
| Ga0139557_10007569 | 3300011010 | Freshwater | MLERVIMDFDLDTPIEKILTDMLDKVEGHVGDCDCVNCNSLEVLAYMIKVEE* |
| Ga0139556_10426092 | 3300011011 | Freshwater | MLERVIMDFDLDTPISKILTDMLDKVEGHVGDCDCVNCNSLEVLAYMIKVEE* |
| Ga0151620_10302594 | 3300011268 | Freshwater | MLDFDLEYPLEKILTNMLDKVEGHVINCSCVDCNSLEVLAYMIKVEE* |
| Ga0177922_109620483 | 3300013372 | Freshwater | MLERDIMDFDLDTPISKILTDMLDKVEGHVVNCDCVNCNSLEVLAYMIKVEE* |
| Ga0181357_11132312 | 3300017777 | Freshwater Lake | MDFDLDTPIEKILTDMLDKVEGHVGDCDCVNCNSLEVLAYMIKVEEDNA |
| Ga0181359_10582223 | 3300019784 | Freshwater Lake | MDFDLDTPIEKILTDMLDKVEGHVGDCDCVNCNSLEVLAYMIKVEE |
| Ga0211732_11696042 | 3300020141 | Freshwater | MLERDIMDFDLDTPISKILTDMLDKVEGHVVNCDCVNCNSLEVLAYMIKVEE |
| Ga0211736_102956125 | 3300020151 | Freshwater | MIDFDLDTPIAKILTDMLDKVEGHIVNCDCVNCTSLEVLAYMIM |
| Ga0211736_105086143 | 3300020151 | Freshwater | MDFDLDTPISKILTDMLDKVEGHVVNCDCVNCNSLEVLAYMIKVEE |
| Ga0211734_100065132 | 3300020159 | Freshwater | MDFDLDTPISKILTDMLDKVEGHVVNCDCVNCNSLEVLAYMIKVEEDNANI |
| Ga0211734_102604692 | 3300020159 | Freshwater | MLDFDLEYPLKKLLTNMLDNVEGHVGDCDCVHCISLETLAYMIKVEEDNANI |
| Ga0211733_101279731 | 3300020160 | Freshwater | MDFDLDTPISKILTDMLDKVEGHVVNCDCVNCNSLEVLAYM |
| Ga0211733_107283202 | 3300020160 | Freshwater | LHKPIHSMSERDTMLDFDLEYPLKKLLTNMLDNVEGHMGDCDCVHCISLETLAYMIKVEEDNANI |
| Ga0211726_100975484 | 3300020161 | Freshwater | MIDFDLDTPIAKILTDMLDKVEGHIVNCDCVNCTSLEVLAYMIMEKE |
| Ga0211726_102252671 | 3300020161 | Freshwater | MIDFNLDTPISKILTDMLDKVEGHVVNCDCVNCNSLEVLAYMIKVEEDNANI |
| Ga0211726_110564503 | 3300020161 | Freshwater | MLDFDLDTPIAKILTDMLDKVEGHIVNCDCINCTSLEVLAYMIMEKE |
| Ga0211729_105899955 | 3300020172 | Freshwater | LHKPIHSMSERDTMLDFDLEYPLKKLLTNMLDNVEGHVGDCDCVHCISLETLAYMIKVGEDNANI |
| Ga0211729_107131972 | 3300020172 | Freshwater | MSERDTMLDFDLEYPLKKLLTNMLDNVEGHMGDCDCVHCISLETLAYMIKVEEDNANI |
| Ga0211729_112816253 | 3300020172 | Freshwater | MDFDLDTPIEKILTDMLDKVEGHVGDCDCVNCNSLEVLAYMI |
| Ga0208050_10011885 | 3300020498 | Freshwater | MLERVTMDFDLDTPIEKILTNMLDNVEGHIVNCDCVNCNSLEVLAYMIMEKE |
| Ga0208091_10112421 | 3300020506 | Freshwater | MDFDLDTPISKILTDMLDKVEGHVGDCDCVNCNSLEVLAYMIKVEE |
| Ga0208234_10021891 | 3300020515 | Freshwater | MDFDLDTPIEKILTDMLDKVEGHVGDCDCVNCNSLEV |
| Ga0208234_10132383 | 3300020515 | Freshwater | MIDFDLDTPIEKILTDMLDKVEGHVGDCDCVNCNSLEV |
| Ga0208854_10494331 | 3300020517 | Freshwater | MIDFDLDTPIEKILTDMLDKVEGHVGDCDCVNCNSLEVLAYMIKVEE |
| Ga0208232_10091391 | 3300020527 | Freshwater | MIDFDLDTPIEKILTDMLDKVEGHVGDCDCVNCNSLEVLAY |
| Ga0208235_10242351 | 3300020530 | Freshwater | MIDFDLDTPIEKILTDMLDKVEGHVGDCDCVNCNSLEVLAYMI |
| Ga0208857_10100386 | 3300020542 | Freshwater | LIHSMLERDIMDFDLDTPIEKILTDMLDKVEGHVGDCDCVNCNSLEVLAYMIKVEE |
| Ga0207942_10240544 | 3300020549 | Freshwater | MLDFDLEYPLEKILTNMLDSVEGHVRDCDCVNCNSLEVLYYMIKVEE |
| Ga0208600_10327354 | 3300020550 | Freshwater | MDFDLDTPIEKILTDMLDKVEGHVGDCDCVNCNSLEVLAYMIKV |
| Ga0208362_10191803 | 3300020558 | Freshwater | MLERDIMDFDLDTPISKILTDMLDKVEGHVGDCDCVNCNSLEVLAYMIKVEE |
| Ga0222713_1001933711 | 3300021962 | Estuarine Water | MDFDLDTPISKILTDMLDKVEGHMGDCDCVNCNSLEVLAYMIKVEE |
| Ga0222712_107256953 | 3300021963 | Estuarine Water | MIDFDLEYPLEKILTNMLDKVEGHVINCKCVDCNSLEV |
| Ga0196901_11601752 | 3300022200 | Aqueous | MIDFDLEKPITEVIKNMLDICERHVVGCKCVHCNSLEVLAYMIMVED |
| Ga0208009_10078337 | 3300027114 | Deep Subsurface | MIDFDLEVPLKKILTDMLDKVEGHVVNCKCVDCNSLEVLAYMIKVEE |
| Ga0208009_10237062 | 3300027114 | Deep Subsurface | MLDFDLEYPLEKILTNMLDKVEGHVINCKCVDCNSLEVLAYMIKVEE |
| Ga0208009_10640093 | 3300027114 | Deep Subsurface | MLDFDLEYPLEKILTNMLDKVEGHVVNCKCVDCNSLEVLAYMIMVEE |
| Ga0208432_10030524 | 3300027380 | Deep Subsurface | MIDFDLEYPLEKILTNMLDKVEGHVINCKCVDCNSLEVLAYMIKVEE |
| Ga0208788_10427805 | 3300027499 | Deep Subsurface | LIHIMLERVTMIDFDLEVPLEKILTDMLDKVKLHVVNCKCVDCNSLEVLAYMIKVEE |
| Ga0255117_11124793 | 3300027600 | Freshwater | MDFDLDTPISKILTDMLDKVEGHVVNCDCVNCNSLE |
| (restricted) Ga0247833_102251310 | 3300027730 | Freshwater | MIDFDLEYPLEKILENMLDKVEGHVGDCDCVNCNSLEVLAYMIKVEEDNANI |
| Ga0209444_100564255 | 3300027756 | Freshwater Lake | MLERVIMDFDLDTPIEKILTDMLDKVEGHVGDCDCVNCNSLEVLAYMIKVEE |
| Ga0209296_10006098 | 3300027759 | Freshwater Lake | MDFNLDTPIAKILTDMLDKVEGHIVNCDCINCTSLEVLAYMIMEKE |
| Ga0209296_100109343 | 3300027759 | Freshwater Lake | MDFDLDTPISKILTDMLDKVEGHMPDCDCVNCNSLEVLAYMIKVEE |
| Ga0209972_100404526 | 3300027793 | Freshwater Lake | MIDFDLEYPLEKILTNMLDKVEGHVVNCKCVDCNSLEVLAYMIKVEE |
| Ga0209990_100225572 | 3300027816 | Freshwater Lake | MIDFDLEVPLEKILTDMLDKVEGHVVNCKCVDCNSLEVLAYMIKVEE |
| Ga0247723_10054535 | 3300028025 | Deep Subsurface Sediment | MLERDTMLDFDLEYPLEKILTNMLDKVEGHVVNCKCVDCNSLEVLAYMIKVEE |
| Ga0247723_10093584 | 3300028025 | Deep Subsurface Sediment | MIDFDLSVPLEKILTDMLDKVEGHVVNCKCVDCNSLEVLAYMIKVEE |
| (restricted) Ga0247835_11302211 | 3300028114 | Freshwater | MIDFDLEYPLEKILENMLDKVEGHVGDCDCVNCNSLEVLAYMIKVE |
| (restricted) Ga0247840_100810199 | 3300028581 | Freshwater | LEKILENMLDKVEGHVGDCDCVNCNSLEVLAYMIKVEEDNANI |
| Ga0119944_10001998 | 3300029930 | Aquatic | MLERDTMIDFDLEYPLEKILTNMLDKVEGHVVNCKCVDCNSLEVLAYMIMVEE |
| Ga0315907_1000974711 | 3300031758 | Freshwater | MLEKVTMLDFDLEMPLEKILTQMLDNVEGHIVNCNCKHCMSLEVLAYMIMEKE |
| Ga0315907_100316031 | 3300031758 | Freshwater | MIDFDLEIPLEKILTDMLDKVEGHIVNCQCVDCNSLEVLAYMIKVEE |
| Ga0315907_1004979410 | 3300031758 | Freshwater | MIDFDLDTPLEKILTNMLDKVEGHVVNCKCVDCNSLEVLAYMIMVEE |
| Ga0315907_100532477 | 3300031758 | Freshwater | MLERVTMLDFDLDVPLEKILTDMLDNVEGHIVNCSCKHCMSLEVLAYMIMEKEENVK |
| Ga0315907_108566132 | 3300031758 | Freshwater | MLDFDLEYPLKKLLTNMLDNVEGHVGDCDCVHCISLETLAYMIKVGEDNANI |
| Ga0315907_109322401 | 3300031758 | Freshwater | MIDFDLEMPLEKILTNMLDKVEGHVVNCSCVDCNSLEVLAYMIKVEE |
| Ga0315900_106011312 | 3300031787 | Freshwater | MLERDIMLDFDLEYPLEKILTNMLDKVEGHVVNCKCVDCNSLEVLAYMIKVEE |
| Ga0315909_105645421 | 3300031857 | Freshwater | MLDFDLEYPLEKILTNMLDKVEGHVVNCKCVDCNSLEVLAYMI |
| Ga0315909_105908883 | 3300031857 | Freshwater | MIDFDLEYPLEKILTNMLDKVEGHVVNCSCVDCNSLEVLAYMIKVEE |
| Ga0315909_107453104 | 3300031857 | Freshwater | MLDFDLEYPLEKILTNMLDKVEGHMVNCKCVDCNSLEVLAYMIMVE |
| Ga0315909_108120723 | 3300031857 | Freshwater | MLDFDLEYPLEKILTNMLDKVEGHVVNCKCVDCNSLEVLAYM |
| Ga0315909_108649503 | 3300031857 | Freshwater | PLEKILTNMLDKVEGHVVNCSCVDCNSLEVLAYMIKVEE |
| Ga0315904_104513032 | 3300031951 | Freshwater | MLDFDLDVPLEKILTDMLDNVEGHIVNCSCKHCMSLEVLAYMIMEKEENVK |
| Ga0315904_107935163 | 3300031951 | Freshwater | MLEMDIMLDFDLEYPLEKILTNMLDKVEGHVVNCKCVDCNSLEVLAYMIMVEE |
| Ga0315901_108461593 | 3300031963 | Freshwater | LPRLIHFMLERDTMLDFDLEYPLEKILTNMLDKVEGHVVNCKCVDCNSLEVLAYMIMVEE |
| Ga0315906_100140941 | 3300032050 | Freshwater | MIDFDLDTPLEKILTNMLDKVEGHVVNCKCVDCNSLEVLAYMI |
| Ga0315903_102455985 | 3300032116 | Freshwater | TMLDFDLDVPLEKILTDMLDNVEGHIVNCSCKHCMSLEVLAYMIMEKEENVK |
| Ga0315903_103139853 | 3300032116 | Freshwater | MLERDIMLDFDLEYPLEKILTNMLDKVEGHVVNCKCVDCNSLEVLAYMIMVEE |
| Ga0315903_103628373 | 3300032116 | Freshwater | MIDFDLEMPLEKILTNMLDKVEGHVVNCSCVDCNSLEVLAYMIK |
| Ga0315903_104087685 | 3300032116 | Freshwater | SMIDFDLEYPLEKILTNMLDKVEGHVVNCKCVDCNSLEVLAYMIKVEE |
| Ga0315903_107204953 | 3300032116 | Freshwater | LPRLIHFMLERDIMLDFDLEYPLEKILTNMLDKVEGHVVNCKCVDCNSLEVLAYMIKVEE |
| Ga0315903_108522662 | 3300032116 | Freshwater | MDFDLDTPIEKILTDMLDKVEGHVGDCDCVNCNSLEVLAYMIKVEEDNANI |
| Ga0315903_108621631 | 3300032116 | Freshwater | MLERDTMLDFDLDTPLEKILTNMLDKVEGHVINCKCVNCNSLEVLAYMIMVEE |
| Ga0316625_1013216552 | 3300033418 | Soil | MLDFDLDIPLSKILTDMLDKVEGHVINCKCVDCNSLEVLAYMIKVEE |
| Ga0316617_10001938811 | 3300033557 | Soil | MLERDTMLDFDLDIPLSKILTDMLDKVEGHVINCKCVDCNSLEVLAYMIKVEE |
| Ga0334994_0054526_1265_1408 | 3300033993 | Freshwater | MIDFDLDTPIEKILTDMLDKVEGHVGDCDCVNCNSLEVLAYMIMVEE |
| Ga0334994_0088093_2_121 | 3300033993 | Freshwater | MDFDLDTPIEKILTDMLDKVEGHVGDCDCVNCNSLEVLAY |
| Ga0334996_0049213_452_610 | 3300033994 | Freshwater | MLERVIMDFDLDTPIEKILTDMLDKREGHVGDCDCVNCNSLEVLAYMIKVEE |
| Ga0334996_0389431_547_657 | 3300033994 | Freshwater | MDFDLDTPIEKILADMLDKVEGHVGDCDCVNCNSLEV |
| Ga0335027_0069510_27_185 | 3300034101 | Freshwater | MLERDIMDFDLDTPIEKILADMLDKVEGHVGDCDCVNCNSLEVLAYMIKVEE |
| Ga0335027_0130253_1037_1198 | 3300034101 | Freshwater | MSERDTMLDFDLEYPLKKMLERMLDNVEGHVGDCDCVHCTSLEVLGYMIMVEE |
| Ga0335027_0530296_196_357 | 3300034101 | Freshwater | MLERVTMIDFDLEYPLEKILTNMLDKVEGHVVNCKCVDCNSLEVLAYMIMVEE |
| Ga0335029_0237291_1038_1184 | 3300034102 | Freshwater | DIMDFDLDTPISKILTDMLDKVEGHVVNCDCVNCNSLEVLAYMIKVEE |
| Ga0335029_0672863_228_389 | 3300034102 | Freshwater | MLERVTMFDFNLDTPISKILTDMLDKVEGHIVNCDCVNCNSLEVLAYMIMEKE |
| Ga0335031_0017489_3061_3201 | 3300034104 | Freshwater | MDFDLDTPIEKILTDMLDKVEGHVGNCDCVNCNSLEVLAYMIKVEE |
| Ga0335031_0197581_1170_1361 | 3300034104 | Freshwater | GIDLPRLIHIMLERVTMIDFDLEYPLEKILTNMLDKVEGHVGNCDCVNCTSLEVLAYMIKVEE |
| Ga0335036_0553976_289_450 | 3300034106 | Freshwater | MLERDTMLDFDLEYPLEKILTNMLDKVEGHVVNCKCVDCNSLEVLAYMIMVEE |
| Ga0335050_0152514_1142_1255 | 3300034108 | Freshwater | MIDFDLEIPLKKILTDMLDKVEGHVGDCDCVDCNSLEV |
| Ga0335060_0138249_3_107 | 3300034122 | Freshwater | MDFDLDTPISKILTDMLDKVEGHVGDCDCVNCNSL |
| Ga0335007_0074148_2315_2458 | 3300034283 | Freshwater | MIDFDLEYPLEKILTNMLDKVEGHVVNCKCVDCNSLEVLAYMIMVEE |
| ⦗Top⦘ |