 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F053230 |
| Family Type | Metagenome |
| Number of Sequences | 141 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MFEAIASFVLPVLKDILWTAAAALLAYALNKFQSHLQNI |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 141 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 18.44 % |
| % of genes from short scaffolds (< 2000 bps) | 58.16 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (85.816 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (19.149 % of family members) |
| Environment Ontology (ENVO) | Unclassified (43.972 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (38.298 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.22% β-sheet: 0.00% Coil/Unstructured: 44.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 141 Family Scaffolds |
|---|---|---|
| PF00210 | Ferritin | 4.26 |
| PF00436 | SSB | 2.84 |
| PF13392 | HNH_3 | 2.84 |
| PF13640 | 2OG-FeII_Oxy_3 | 2.84 |
| PF00476 | DNA_pol_A | 2.84 |
| PF08291 | Peptidase_M15_3 | 0.71 |
| PF14284 | PcfJ | 0.71 |
| PF06210 | DUF1003 | 0.71 |
| PF00149 | Metallophos | 0.71 |
| PF02698 | DUF218 | 0.71 |
| PF13884 | Peptidase_S74 | 0.71 |
| PF13385 | Laminin_G_3 | 0.71 |
| PF03237 | Terminase_6N | 0.71 |
| PF13439 | Glyco_transf_4 | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 141 Family Scaffolds |
|---|---|---|---|
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 2.84 |
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 2.84 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 2.84 |
| COG1434 | Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 family | Cell wall/membrane/envelope biogenesis [M] | 0.71 |
| COG2949 | Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycin | Cell wall/membrane/envelope biogenesis [M] | 0.71 |
| COG4420 | Uncharacterized membrane protein | Function unknown [S] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 85.82 % |
| All Organisms | root | All Organisms | 14.18 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 19.15% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 8.51% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.80% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 7.09% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.09% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.38% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 4.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.26% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.26% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.84% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.84% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 2.84% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 2.13% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.42% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.42% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.42% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.71% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.71% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.71% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.71% |
| Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 0.71% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.71% |
| Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.71% |
| Drinking Water Treatment Plant | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water Treatment Plant | 0.71% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.71% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.71% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.71% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.71% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.71% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.71% |
| Marine | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine | 0.71% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.71% |
| Marine Harbor | Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor | 0.71% |
| Saline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline | 0.71% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.71% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.71% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.71% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000124 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21m | Environmental | Open in IMG/M |
| 3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
| 3300004369 | Saline microbial communities from the South Caspian sea - cas-15 | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005346 | Saline sediment microbial community from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005739 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006734 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300007212 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Bottom layer) 7 sequencing projects | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011984 | Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Raw_water_201107 | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300018039 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019730 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_7-8_MG | Environmental | Open in IMG/M |
| 3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
| 3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021092 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10m | Environmental | Open in IMG/M |
| 3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300023180 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG | Environmental | Open in IMG/M |
| 3300024306 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h | Environmental | Open in IMG/M |
| 3300024354 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8d | Environmental | Open in IMG/M |
| 3300025283 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300029635 | Marine harbor viral communities from the Indian Ocean - SMH2 | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034523 | Fracking water microbial communities from deep shales in Oklahoma, United States - K-4-A | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_100176226 | 3300000116 | Marine | MFESILSTVLPIVQDILWTACAALLAYVLNKVQSNIQNI*AM |
| BS_KBA_SWE12_21mDRAFT_101184713 | 3300000124 | Marine | MFEAIASAVLPVLKDIIWAACAALLAYALNKLQSYLQVI* |
| FwDRAFT_100069941 | 3300000882 | Freshwater And Marine | MFETIASFVLPTLKDILWAACAALLAYALNKIQSHFQGI* |
| Ga0065726_119379 | 3300004369 | Saline | MFESILATVLPIVQDILWTACAALLAYVLNKVQSNIQNI* |
| Ga0069718_159249721 | 3300004481 | Sediment | MFEAFASVVLPVFKDILWTAAAALLAFALNKLQSKFQNI* |
| Ga0074242_109489783 | 3300005346 | Saline Water And Sediment | MFESILSTVLPIVQDILWTACAALLAYVLNKVQSNIQNI* |
| Ga0068876_100269097 | 3300005527 | Freshwater Lake | MFETIASIVLPVLKDILWTAAAALLAYALNKLQIKLNP* |
| Ga0068876_100623183 | 3300005527 | Freshwater Lake | MFESLFAAVLPVMKDILWTAAAALLAYALNKVQSCFN* |
| Ga0049081_100501162 | 3300005581 | Freshwater Lentic | MFESILSAVLPIVKDLLWTACAALLAYMVNKLTNQFT* |
| Ga0076948_101587315 | 3300005739 | Lake Water | MLEALTSFILPLAKDILMTAAAALLAYALNKLQAHFQSI* |
| Ga0079957_100103631 | 3300005805 | Lake | MFESILSAVLPVIQDIFWTACAAMLAYALNKIQSHFQNI* |
| Ga0098073_10372872 | 3300006734 | Marine | MFETIISSVLPVLKDLLWTAAAALLAYALNKFQSHFNTI* |
| Ga0070754_100058246 | 3300006810 | Aqueous | MFESILATVLPIVQDILWTACAALLAYVLNKVQSNIQTI* |
| Ga0070750_100546995 | 3300006916 | Aqueous | MFESILATVFPIVQDILWTACAALLAYVLNKVQSNIQTI* |
| Ga0103958_10088482 | 3300007212 | Freshwater Lake | MFEAILSSVLPVLKDLLWTAAAALLAFTLNKLQSHFQGG* |
| Ga0075463_102877991 | 3300007236 | Aqueous | ESILATVLPIVQDILWTACAALLAYVLNKVQSNIQNI* |
| Ga0099849_10427155 | 3300007539 | Aqueous | MFETIFSAVLPVLKDLLWTAAAALLAYSLNKLQSQFQSI* |
| Ga0099849_13106782 | 3300007539 | Aqueous | MFESIFSVVIPILKDLLWTACAAMLAYAANKLSNQFA* |
| Ga0099848_10367313 | 3300007541 | Aqueous | MFEAIFSSVLPILKDLLWTAAAALLAYTLNKVQSQFI* |
| Ga0099846_13438741 | 3300007542 | Aqueous | MFETIFSAVLPVLKDLLWTAAAALLAYTLNKLQSHFQNS* |
| Ga0102863_12192962 | 3300007622 | Estuarine | MFETIASIVLPVLKDILWTAAAALLAYALNKFQAHLQNI* |
| Ga0105746_11017772 | 3300007973 | Estuary Water | MFEAIASFVLPVLKDILWTAAAVLLAYALNKFQAHLQNI* |
| Ga0108970_108825905 | 3300008055 | Estuary | MFETIASIVLPVLKDILWTAAAALLAYALNKLQAHLQNI* |
| Ga0114347_11642383 | 3300008114 | Freshwater, Plankton | MFETFASMVIPVLKDFLWTAAVALLAYTLNKLQAHFA* |
| Ga0114876_10701192 | 3300008448 | Freshwater Lake | MFETIASIVLPVFKDILWTAAAALLAYALNKFQSHLQNI* |
| Ga0114876_11526993 | 3300008448 | Freshwater Lake | MFEAIASAVFPVLKDILWTAAAALLAYALNKLQFKLQNI* |
| Ga0114876_11779753 | 3300008448 | Freshwater Lake | MFEAIASAVLPVLKDILWTAAAALLAYALNKLQFKLQNI* |
| Ga0105090_101659814 | 3300009075 | Freshwater Sediment | MFEAFASAVLPVLKDILWTAAAALLAYALNKFQSKLQNI* |
| Ga0105098_100833203 | 3300009081 | Freshwater Sediment | MFEAIASFVLPVLKDILWTAAAALLAYALNKFQSHLQNI* |
| Ga0105097_100304624 | 3300009169 | Freshwater Sediment | MFEAFASVVFPVVKDILWTAAAALLAYALNKFQSKLQNI* |
| Ga0105097_106585633 | 3300009169 | Freshwater Sediment | MFEAIASFVLPVLKDILWAAAAALLAYALNKFQSHLQNI* |
| Ga0114919_103093511 | 3300009529 | Deep Subsurface | MFESILATVLPIVQDILWTACAALLAYVLNKVQSN |
| Ga0129342_10032445 | 3300010299 | Freshwater To Marine Saline Gradient | MFETIFSAVLPVLKDLLWTAAAALLAYSRNKLQSQCQSI* |
| Ga0129342_10403296 | 3300010299 | Freshwater To Marine Saline Gradient | LSMFESILSAVLPVVKDILWAACGAVLSYLINKLYSQFA* |
| Ga0129351_12516572 | 3300010300 | Freshwater To Marine Saline Gradient | MFEAIFSSVLPILKDLLWTAAAALLAYTLNKIQSQFI* |
| Ga0129333_1001041211 | 3300010354 | Freshwater To Marine Saline Gradient | MFEAILGAVIPVLKDLLWTAAAALLAYALNKLQSHFQNI* |
| Ga0129333_100874502 | 3300010354 | Freshwater To Marine Saline Gradient | MFEAILSYVLPVLKDLLWTAAAALLAYTLNKVQSHFN* |
| Ga0129333_101014353 | 3300010354 | Freshwater To Marine Saline Gradient | MFEAFASAVLPVLKDILWTAAAALLAYALNKFQIKLNS* |
| Ga0129333_104425703 | 3300010354 | Freshwater To Marine Saline Gradient | MLEALASFFLPVAKEILLTAAGALLAYTFNKLQAHFFGA* |
| Ga0129333_105005532 | 3300010354 | Freshwater To Marine Saline Gradient | MFETILSYVLPVLKDLLWTAAAALLAYTLNKIQSHFNTI* |
| Ga0129333_107953453 | 3300010354 | Freshwater To Marine Saline Gradient | IASIVLPVLKDILWTAAAALLAYALNKLQIKLNP* |
| Ga0129333_111264081 | 3300010354 | Freshwater To Marine Saline Gradient | MFDFILSNITSVVRDLLWTAAAALLAYTLNKLQSHFQNG* |
| Ga0129333_113663381 | 3300010354 | Freshwater To Marine Saline Gradient | QFNLMFESLIGTLLPVLKDLLWTAAAALLAYTLNKIQSHFNTI* |
| Ga0129336_107509971 | 3300010370 | Freshwater To Marine Saline Gradient | MFEAVLSYVLPVLKDLLWTAAAALLAYALNKFQSHFNTI* |
| Ga0133913_119379264 | 3300010885 | Freshwater Lake | MFESLLGAMLPFLKDIIWTAAAALLAYTINKIQSHFNTI* |
| Ga0119931_10150102 | 3300011984 | Drinking Water Treatment Plant | MFEAILSSVLPVLKDLLWTAAAALLAFTLNKIQSHFQQG* |
| Ga0119951_10332814 | 3300012000 | Freshwater | MFEAILSVVLPIVKDILWTAAAALLAYALNKLQFQFQNI* |
| Ga0153799_100049015 | 3300012012 | Freshwater | MFESILSAILPIVKDLLWTACAALLAYMVNKLTNQFT* |
| Ga0164293_105583072 | 3300013004 | Freshwater | MFESFISFVAPIVKDLLWTAAAALLAYALNKFQSQFN* |
| Ga0164292_102728703 | 3300013005 | Freshwater | MFEAIASFVLPVLKDILWTAAAALLAYTLNKLQSCFN* |
| (restricted) Ga0172367_103618343 | 3300013126 | Freshwater | MFDFILSTITSVIHDLLWTAAAALLAYTLNKIQSHFRQA* |
| (restricted) Ga0172367_107185462 | 3300013126 | Freshwater | MFDFILSTVTSVIHDLLWTAAAALLAYTLNKIQSHFRQA* |
| Ga0177922_112250422 | 3300013372 | Freshwater | MFEAILSSVLPIFKDLLWTAAAALLAYALNKIQSQFV* |
| Ga0119952_10254104 | 3300014050 | Freshwater | MFEAILSVVLPIVKDILWTAAAALLAYVLNKLQVQLQNI* |
| Ga0119952_10690672 | 3300014050 | Freshwater | MFEAIFSVVLPIVKDFLMTAAAALLAYGLNKLQSYFQTI* |
| Ga0181352_11686092 | 3300017747 | Freshwater Lake | MFEVILGVVLPIVKDLLWTACGALLAYIVNKLTNQFA |
| Ga0181344_11200323 | 3300017754 | Freshwater Lake | MFDFILSSITSVVRDLLWTAAAALLAYTLNKLQSHFQ |
| Ga0169931_1001017214 | 3300017788 | Freshwater | MFEAIFSSVLPLLKDLLWTAAAALLAYTLNKLQLQFN |
| Ga0169931_102298824 | 3300017788 | Freshwater | MFDFILSTVTSVIHDLLWTAAAALLAYTLNKIQSHFRQA |
| Ga0181579_105276531 | 3300018039 | Salt Marsh | NQRMFESILSTVLPVVQDILWTACAALLAYVLNKVQSNIQNI |
| Ga0181592_100315459 | 3300018421 | Salt Marsh | MFESILSTVLPVVQDILWTACAALLAYVLNKVQSNIQNI |
| Ga0181592_100376225 | 3300018421 | Salt Marsh | MFESILANVLPIVQDILWTACAALLAYVLNKVQSNIQTI |
| Ga0181592_100962421 | 3300018421 | Salt Marsh | SILSTVLPIVQDILWTACAALLAYVLNKVQSNIQNI |
| Ga0181591_100100925 | 3300018424 | Salt Marsh | MFESILATVLPIVQDILWTACAALLAYVLNKVQSNIQTI |
| Ga0194001_10320991 | 3300019730 | Sediment | TPSTNQLMFESILATVLPIVQDILWTACAALLAYVLNKVQSNIQNI |
| Ga0194023_10592451 | 3300019756 | Freshwater | MFESILATVLPIVQDILWTACAALLAYVLNKVQSNIQNI |
| Ga0211736_1035516410 | 3300020151 | Freshwater | MFEAFASAVLPILKDILWTAAAALLAFALNKLQSKFQNI |
| Ga0211726_104223951 | 3300020161 | Freshwater | MFESLLSAVFPVLKDILWTAAAALLAFALNKLQSNFQTI |
| Ga0211729_1011281615 | 3300020172 | Freshwater | MFESLFAAVLPVMKDILWTAAAALLAYALNKLQTKFQNI |
| Ga0211729_105199182 | 3300020172 | Freshwater | MFESLLSAVFPVLKDILWTAAAALLAFALNKLQSNFQII |
| Ga0211729_111144451 | 3300020172 | Freshwater | MFETFVSMVIPVFKDFLWTAAIALLAYALNKIQSHFA |
| Ga0194115_100377029 | 3300020183 | Freshwater Lake | HHSMFDFILSSITSVVHDLLWTAAAALLAYTLNKIQSHFQRV |
| Ga0194115_100774085 | 3300020183 | Freshwater Lake | MFESLLGIVLPVLKDLLWTAAVALLAYTLNKLQSHFNTI |
| Ga0194118_1000052799 | 3300020190 | Freshwater Lake | MFEAIFSSVFPLLKDLLWTAAAALLAYTLNKLQLQFN |
| Ga0194119_104147502 | 3300020220 | Freshwater Lake | HSMFDFILSSITSVVHDLLWTAAAALLAYTLNKIQSHFQRG |
| Ga0208050_10042943 | 3300020498 | Freshwater | MFETILSYVLPVLKDLLWTAAAALLAYTLNKIQSHFNTI |
| Ga0208050_10168912 | 3300020498 | Freshwater | MFDFILSSITSVVRDLLWTAAAALLAYALNKLQSHFQNG |
| Ga0208465_10039262 | 3300020570 | Freshwater | MFEAILSSVLPIFKDLLWTAAAALLAYALNKIQSQFV |
| Ga0208465_10113914 | 3300020570 | Freshwater | MFESILSAVLPIVKDLLWTACAALLAYMVNKLTNQFT |
| Ga0194122_101111041 | 3300021092 | Freshwater Lake | IMFEAIFSSVFPLLKDLLWTAAAALLAYTLNKLQLQFN |
| Ga0213921_10055136 | 3300021952 | Freshwater | MFEAIFSVVLPIVKDFLMTAAAALLAYGLNKLQSYFQTI |
| Ga0222714_1002165510 | 3300021961 | Estuarine Water | MFESLFAAVLPVIKDLLWTAAAALLAYALNKIQSQFN |
| Ga0222714_100278048 | 3300021961 | Estuarine Water | MFESILAAVLPVVKDLLWTAAAALLAYALNKLQSHFQHI |
| Ga0222713_102579803 | 3300021962 | Estuarine Water | MIEALMGTVLPFLKDLLWTAAVALLAYTINKIQSHFNTI |
| Ga0222712_101416265 | 3300021963 | Estuarine Water | MFESILAAVLPAVKDLLWTAAAALLAYALNKLQSHFQHI |
| Ga0181353_10143623 | 3300022179 | Freshwater Lake | MFDFILSSITSVVRDLLWTAAAALLAYTLNKLQSHFQNG |
| Ga0181353_10694152 | 3300022179 | Freshwater Lake | MFETIASIVLPVLKDILWTAAAALLAYALNKFQTYLQNI |
| Ga0181354_12534292 | 3300022190 | Freshwater Lake | MFEAILGAVLPIVKDLLWTACGALLAYIVNKLINQFA |
| Ga0196905_10625771 | 3300022198 | Aqueous | QLMFESILSTVLPIVQDILWTACAALLAYVLNKVQSNIQNI |
| Ga0196901_12779811 | 3300022200 | Aqueous | MFETIFSAVLPVLKDLLWTAAAALLAYSLNKLQSQFQSI |
| Ga0181351_12746392 | 3300022407 | Freshwater Lake | HHLHNQLMFEAIASFVLPVLKDILWTAAAALLAYALNKFQSHLQNI |
| Ga0214917_100142035 | 3300022752 | Freshwater | MFEAIFSAVLPIVKDILWTAAAALLAYVLNKLQVQLQNI |
| Ga0214917_100774545 | 3300022752 | Freshwater | MFEAILSVVLPIVKDILWTAAAALLAYALNKLQFQFQNI |
| Ga0214917_101524014 | 3300022752 | Freshwater | MFDAILSCVLPVLKDLLWTAAAALLAYTLNKIQSQFN |
| Ga0255751_100495788 | 3300023116 | Salt Marsh | FSTNQLMFESILSTVLPIVQDILWTACAALLAYVLNKVQSNIQNI |
| Ga0214923_104082322 | 3300023179 | Freshwater | MFHAITSAVLPVLKDFLWAAAAALLTYTLNQIQSRIQHI |
| Ga0255768_103054741 | 3300023180 | Salt Marsh | FTLQLMFESILATVLPIVQDILWTACAALLAYVLNKVQSNIQTI |
| Ga0255148_10171472 | 3300024306 | Freshwater | MFETILAAVVPVLKDIFWTAAAALLAYALNKLQAHFNTI |
| Ga0255171_10895272 | 3300024354 | Freshwater | IMFETILAAVVPVLKDIFWTAAAALLAYALNKLQAHFNTI |
| Ga0208048_100548310 | 3300025283 | Freshwater | MFDFILSSITSVVHDLLWTAAAALLAYTLNKIQSHFQRG |
| Ga0208162_10976392 | 3300025674 | Aqueous | MFESIFSVVIPILKDLLWTACAAMLAYAANKLSNQFA |
| Ga0208162_11451251 | 3300025674 | Aqueous | TLQLMFESILATVLPIVQDILWTACAALLAYVLNKVQSNIQNI |
| Ga0208009_10525571 | 3300027114 | Deep Subsurface | MFEAILGVVLPVVKDLLWTACGALLAYMVNKLTNQFS |
| Ga0209704_10342991 | 3300027693 | Freshwater Sediment | FASAVLPVLKDILWTAAAALLAYALNKFQSKLQNI |
| Ga0209492_10196142 | 3300027721 | Freshwater Sediment | MFEAFASVVFPVVKDILWTAAAALLAYALNKFQSKLQNI |
| Ga0209972_104202672 | 3300027793 | Freshwater Lake | MFETIASIVLPVLKDILWTAAAALLAYALNKLQIKLNP |
| Ga0209990_105079082 | 3300027816 | Freshwater Lake | MFESLFAAVLPVMKDILWTAAAALLAYALNKVQSCFN |
| Ga0209668_105654303 | 3300027899 | Freshwater Lake Sediment | MLEALTSFILPLAKDIFMTAAAALLAYALNKLQAHFQ |
| Ga0247723_11000542 | 3300028025 | Deep Subsurface Sediment | MFESILSAIFPIVKDLLWTACAALLAYMVNKLTNQFT |
| Ga0135217_1134341 | 3300029635 | Marine Harbor | MIEALMGTLLPFLKDLLWTAAVALLAYTINKVQSHFNTI |
| Ga0119944_10010666 | 3300029930 | Aquatic | MFEAILSSVLPVLKDLLWTAAAALLAFTLNKLQSQFQGG |
| Ga0119944_10028825 | 3300029930 | Aquatic | MFDFIFSSITSVLHDLLWTAAAALLAFTLNKIQSHFQQG |
| Ga0119944_10293182 | 3300029930 | Aquatic | MFEAILGAVLPVLKDLLWTAAAALLAYALNKLQSNFQHI |
| Ga0307380_101093003 | 3300031539 | Soil | MFEAIASAVLPVLKDIIWAACAALLAYALNKLQSYLQVI |
| Ga0307376_102461941 | 3300031578 | Soil | MFEAIASAVLPVLKDILWAACAALLAYALNKLQSYLQVI |
| Ga0315907_104819113 | 3300031758 | Freshwater | TQLMFESLFAAVLPVMKDILWTAAAALLAYALNKVQSCFN |
| Ga0315899_104353933 | 3300031784 | Freshwater | MFEAIASAVFPVLKDILWTAAAALLAYALNKLQFKLQNI |
| Ga0315909_1000469317 | 3300031857 | Freshwater | MFETFASMVIPVLKDFLWTAAVALLAYTLNKLQAHFA |
| Ga0315909_107939631 | 3300031857 | Freshwater | MFEALASVVLPFLKDLLWTAAVALLAYTLNKVQSHFNTI |
| Ga0315901_101992642 | 3300031963 | Freshwater | MFEAIASAVLPVLKDILWTAAAALLAYALNKLQFKLQNI |
| Ga0315906_100990791 | 3300032050 | Freshwater | PYTQLMFESLFAAVLPVMKDILWTAAAALLAYALNKVQSCFN |
| Ga0334980_0195691_605_724 | 3300033816 | Freshwater | MFETVVGFVAPLLKDFLWAAAAMLLTYTLNKIQSHFNTL |
| Ga0334982_0008110_5517_5636 | 3300033981 | Freshwater | MFEALTSFVLPVLKDILWTAAAALLAYTLNKIQSHFQHI |
| Ga0334979_0053431_2362_2475 | 3300033996 | Freshwater | MFESFISFVVPIVKDLLWTAAAALLAYALNKFQSQFN |
| Ga0334979_0661096_62_175 | 3300033996 | Freshwater | MFEAIASFVLPVLKDILWTAAAALLAYTLNKLQSCFN |
| Ga0334986_0000145_25410_25529 | 3300034012 | Freshwater | MFESLIGTLLPVLKDLLWTAAAALLAYTLNKIQSHFNTI |
| Ga0334986_0007349_5383_5502 | 3300034012 | Freshwater | MFEAFASAVLPVLKDILWTAAAALLAFALNKLQSKFQNI |
| Ga0334986_0334322_3_110 | 3300034012 | Freshwater | MFETIASIVLPVLKDILWTAAAALLAYALNKLQIKL |
| Ga0334998_0035952_656_775 | 3300034019 | Freshwater | MFEAIISAVLPLVKDILWTAAAALLAYALNKLQFQFQNI |
| Ga0335004_0411605_132_245 | 3300034021 | Freshwater | MFESILSAVLPIVKDLLWTACVALLAYMVNKLTNQFT |
| Ga0334987_0000828_12042_12161 | 3300034061 | Freshwater | MFEAFASAVLPVLKDILWTAAAALLAYALNKLQSKLQNI |
| Ga0334987_0129544_1749_1868 | 3300034061 | Freshwater | MFEAIASIVLPVLKDILWTAAAALLAYALNKLQAHLQNI |
| Ga0334987_0238161_968_1087 | 3300034061 | Freshwater | MFEAIASFVLPVLKDILWTAAAALLAYALNKFQSHLQNI |
| Ga0335000_0368390_100_219 | 3300034063 | Freshwater | MFETFASAVLPVLKDILWTAAAALLAYALNKLQSKFQNI |
| Ga0310127_047951_1013_1135 | 3300034072 | Fracking Water | MFEAIFSSVLPIVKDLLWTACGALLAYAINKIQSHFSNGF |
| Ga0310127_112347_250_372 | 3300034072 | Fracking Water | MFEVILGVVLPVVKDLLWTACGALLAYAINKIQSHFSNVF |
| Ga0310130_0172898_148_261 | 3300034073 | Fracking Water | MFEALFSSILPILKDLLWTAAAALLAYTLNKVQSQFI |
| Ga0335029_0307401_701_820 | 3300034102 | Freshwater | MLEAIASFVLPVLKDILWTAAAALLAYALNKFQSHLQNI |
| Ga0335029_0699598_171_290 | 3300034102 | Freshwater | MFEAIASAVFPVLKDILWTAAAAMLAYALNKLQFKLQNI |
| Ga0335036_0067596_590_709 | 3300034106 | Freshwater | MFETIASFVLPVLKDILWTAAAALLAYALNKFQTHLQNI |
| Ga0310143_20876_375_494 | 3300034523 | Fracking Water | MFEAIFSTVLPVFKDLLITAAAALLAYGLNKLQSYFQTI |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |