| Basic Information | |
|---|---|
| Family ID | F053164 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 141 |
| Average Sequence Length | 50 residues |
| Representative Sequence | ELASFIRANLGEVRLQGSDYGPHQMTGIHDLKAFWGKGAQVDVRV |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 141 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.29 % |
| % of genes from short scaffolds (< 2000 bps) | 95.04 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.291 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (13.475 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.241 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.773 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.29% β-sheet: 0.00% Coil/Unstructured: 76.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 141 Family Scaffolds |
|---|---|---|
| PF02225 | PA | 14.18 |
| PF00291 | PALP | 3.55 |
| PF13180 | PDZ_2 | 2.84 |
| PF04389 | Peptidase_M28 | 2.13 |
| PF07676 | PD40 | 0.71 |
| PF09190 | DALR_2 | 0.71 |
| PF01565 | FAD_binding_4 | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 141 Family Scaffolds |
|---|---|---|---|
| COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.29 % |
| Unclassified | root | N/A | 0.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_103986912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105368799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300000559|F14TC_101143825 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300004156|Ga0062589_102855461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300004157|Ga0062590_102833343 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300004463|Ga0063356_106092670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300004633|Ga0066395_10209652 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1025 | Open in IMG/M |
| 3300005093|Ga0062594_102279798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300005166|Ga0066674_10013431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3441 | Open in IMG/M |
| 3300005172|Ga0066683_10209435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1204 | Open in IMG/M |
| 3300005180|Ga0066685_11035071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300005184|Ga0066671_11073753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300005330|Ga0070690_100871215 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300005332|Ga0066388_104638402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 699 | Open in IMG/M |
| 3300005332|Ga0066388_106328939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300005332|Ga0066388_108061168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300005333|Ga0070677_10777076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300005334|Ga0068869_101718630 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300005355|Ga0070671_101931208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300005356|Ga0070674_100987310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
| 3300005446|Ga0066686_10795025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
| 3300005451|Ga0066681_10397484 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
| 3300005466|Ga0070685_10006598 | All Organisms → cellular organisms → Bacteria | 5922 | Open in IMG/M |
| 3300005530|Ga0070679_100487637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1177 | Open in IMG/M |
| 3300005577|Ga0068857_101347293 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300005617|Ga0068859_102631322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300005713|Ga0066905_100041222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2738 | Open in IMG/M |
| 3300005764|Ga0066903_104193339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
| 3300005764|Ga0066903_105141863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300005836|Ga0074470_11386301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300005937|Ga0081455_10384945 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 978 | Open in IMG/M |
| 3300006034|Ga0066656_10151742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1449 | Open in IMG/M |
| 3300006034|Ga0066656_11014863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300006796|Ga0066665_10562748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300006797|Ga0066659_11218015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300006844|Ga0075428_101728170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
| 3300006845|Ga0075421_100268881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2084 | Open in IMG/M |
| 3300006845|Ga0075421_100701386 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1176 | Open in IMG/M |
| 3300006846|Ga0075430_100921507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
| 3300006876|Ga0079217_10925487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300006881|Ga0068865_101202567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300006903|Ga0075426_10803952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300006914|Ga0075436_101391585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300009012|Ga0066710_103035236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
| 3300009012|Ga0066710_103491946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300009101|Ga0105247_11857008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300009137|Ga0066709_100814030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1354 | Open in IMG/M |
| 3300009137|Ga0066709_101243460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1095 | Open in IMG/M |
| 3300009137|Ga0066709_103231082 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300009147|Ga0114129_10602859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1423 | Open in IMG/M |
| 3300009147|Ga0114129_11334334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 888 | Open in IMG/M |
| 3300009156|Ga0111538_11710532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
| 3300009176|Ga0105242_12635856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300009177|Ga0105248_12014099 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300009553|Ga0105249_11946159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300010046|Ga0126384_10254219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1422 | Open in IMG/M |
| 3300010046|Ga0126384_11717424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300010047|Ga0126382_10844501 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 786 | Open in IMG/M |
| 3300010047|Ga0126382_12046234 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300010047|Ga0126382_12165528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300010048|Ga0126373_10770995 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1023 | Open in IMG/M |
| 3300010128|Ga0127486_1151192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 707 | Open in IMG/M |
| 3300010358|Ga0126370_11681615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300010358|Ga0126370_12545706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300010360|Ga0126372_12410710 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300010361|Ga0126378_13127130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300010361|Ga0126378_13173079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300010366|Ga0126379_13304206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300010399|Ga0134127_12296866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300010401|Ga0134121_12005268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300011119|Ga0105246_11223223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300011120|Ga0150983_15372047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300011420|Ga0137314_1154475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300012201|Ga0137365_10036652 | All Organisms → cellular organisms → Bacteria | 3751 | Open in IMG/M |
| 3300012211|Ga0137377_11057039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300012212|Ga0150985_112664414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1585 | Open in IMG/M |
| 3300012359|Ga0137385_10899850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300012469|Ga0150984_120285636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 981 | Open in IMG/M |
| 3300012891|Ga0157305_10125733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300012910|Ga0157308_10393414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300012948|Ga0126375_10224371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1253 | Open in IMG/M |
| 3300012971|Ga0126369_11442074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300012971|Ga0126369_12592596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300012971|Ga0126369_13433600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300013308|Ga0157375_10967504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 992 | Open in IMG/M |
| 3300014325|Ga0163163_13102347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300015372|Ga0132256_101687958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
| 3300015372|Ga0132256_102044745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
| 3300015373|Ga0132257_103962801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300015374|Ga0132255_102033356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 875 | Open in IMG/M |
| 3300016270|Ga0182036_11183456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300016294|Ga0182041_10943628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
| 3300016445|Ga0182038_11646690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300018062|Ga0187784_11194285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300018431|Ga0066655_10736854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300018431|Ga0066655_11062695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300018482|Ga0066669_10584522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 977 | Open in IMG/M |
| 3300019487|Ga0187893_10378900 | Not Available | 968 | Open in IMG/M |
| 3300019997|Ga0193711_1019877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 850 | Open in IMG/M |
| 3300020034|Ga0193753_10158700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1070 | Open in IMG/M |
| 3300021168|Ga0210406_10380772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1134 | Open in IMG/M |
| 3300021407|Ga0210383_10318432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1339 | Open in IMG/M |
| 3300021560|Ga0126371_12621656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300021560|Ga0126371_12799995 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300025901|Ga0207688_10523230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
| 3300025903|Ga0207680_10017112 | All Organisms → cellular organisms → Bacteria | 3823 | Open in IMG/M |
| 3300025921|Ga0207652_10999920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300025923|Ga0207681_11256223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300025926|Ga0207659_10343523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1237 | Open in IMG/M |
| 3300025930|Ga0207701_11014093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
| 3300025930|Ga0207701_11616286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300025940|Ga0207691_11343298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300025942|Ga0207689_11514303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300025961|Ga0207712_12117177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300025986|Ga0207658_11612802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300025986|Ga0207658_11675145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300026088|Ga0207641_11850716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300026116|Ga0207674_11651180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300026121|Ga0207683_11867150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300026324|Ga0209470_1315294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300026332|Ga0209803_1155266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 882 | Open in IMG/M |
| 3300026537|Ga0209157_1372716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300026538|Ga0209056_10387232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 877 | Open in IMG/M |
| 3300026538|Ga0209056_10438150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300026540|Ga0209376_1241441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
| 3300026550|Ga0209474_10607929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300027880|Ga0209481_10240330 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 911 | Open in IMG/M |
| 3300027909|Ga0209382_10084808 | All Organisms → cellular organisms → Bacteria | 3728 | Open in IMG/M |
| 3300027909|Ga0209382_10700599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1090 | Open in IMG/M |
| 3300028802|Ga0307503_10419041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
| 3300031170|Ga0307498_10099660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 892 | Open in IMG/M |
| 3300031912|Ga0306921_10784289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1089 | Open in IMG/M |
| 3300031941|Ga0310912_10498108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 950 | Open in IMG/M |
| 3300031941|Ga0310912_11076010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300031947|Ga0310909_10349589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1241 | Open in IMG/M |
| 3300032001|Ga0306922_10895668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 922 | Open in IMG/M |
| 3300032003|Ga0310897_10108863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1113 | Open in IMG/M |
| 3300032211|Ga0310896_10398184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300032261|Ga0306920_104263585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300033289|Ga0310914_10875086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
| 3300033412|Ga0310810_11252415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.77% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.51% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.26% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.84% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.13% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.13% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 1.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.42% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.42% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.42% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.42% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.42% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.71% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.71% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.71% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.71% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.71% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.71% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.71% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.71% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.71% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010128 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011420 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300019997 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m2 | Environmental | Open in IMG/M |
| 3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1039869121 | 3300000364 | Soil | GEIRLQGLDYGPHQMTCIHDLKAFWGRGAQVDVRA* |
| INPhiseqgaiiFebDRAFT_1053687993 | 3300000364 | Soil | DSSISKAAMKVIRKRGDELAAXIRXNLGDVRLQGLDYGPXQMTGIXDLXAFWGKGTXVDIRV* |
| F14TC_1011438253 | 3300000559 | Soil | EKAIHKRAGELAGFIRSHLGDVRLQGSDYGPHQMTGIHDLKAFWGKGAQVDVRV* |
| Ga0062589_1028554611 | 3300004156 | Soil | KIIRKRADELATFIRNNLGDVRLQGLDYGPHQMTGIHDLKAFWGKGTHVDIRV* |
| Ga0062590_1028333431 | 3300004157 | Soil | KRASELAEFIKKDLGQTRLHGLDFGPHQMTCIHDLKVFWGKGAQVDVHAV* |
| Ga0063356_1060926702 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LLFDTAAAKAVEKSVRKRSGELAAFIRTNLGEIRAHSLDYGPHQMTCIHDLKAFWGKGAQVDVRV* |
| Ga0066395_102096523 | 3300004633 | Tropical Forest Soil | VDKAIHKRAGELAHFIRASLGEVRLQGSQYGPHQMTGIHDLKVFWGKGAQVDVRA* |
| Ga0062594_1022797982 | 3300005093 | Soil | PFDPSISKSAMKIIRKRADELATFIRNNLGDVRLQGLDYGPHQMTGIHDLKAFWGKGTHVDIRV* |
| Ga0066674_100134311 | 3300005166 | Soil | DPSIPKTVEKTVRKRAGELANFIRANLGEVRLQGLDYGPHQMTGIHDLKMFWGKGVRVDVRV* |
| Ga0066683_102094353 | 3300005172 | Soil | SELAGFIRSNLGEVRLQGVDYGPHQTTGIHDLKAFWGKGAQADSRV* |
| Ga0066685_110350711 | 3300005180 | Soil | ELAGFIRSNLGEVRLQGVDYGPHQTTGIHDLKAFWGKGAQADSRV* |
| Ga0066671_110737532 | 3300005184 | Soil | VEKAIHKRAGELANFIRANLGEVRLQGSDYGPHQMTGIHDLKAFWGKGAHVDVRV* |
| Ga0070690_1008712151 | 3300005330 | Switchgrass Rhizosphere | LILFESTPKAVEKAIQKRAVALADFIRTDLGQTRLHGLDFGPHQMTCIHDLKVFWGKGAQVDVHAL* |
| Ga0066388_1046384023 | 3300005332 | Tropical Forest Soil | PKSVDKAIHKRAGELANFIRASLGEVRLQGSQYGPHQMTGIHDLKVFWGKGAQVDVRA* |
| Ga0066388_1063289391 | 3300005332 | Tropical Forest Soil | AGFIRSHLGEVRLQGSDYGPHQMTGIHDLKAFWGKGAQVDVRV* |
| Ga0066388_1080611681 | 3300005332 | Tropical Forest Soil | KRAGELANFIRASLGEVRLQGSQYGPHQMTGIHDLKVFWGKGAQVDVRA* |
| Ga0070677_107770763 | 3300005333 | Miscanthus Rhizosphere | IRANLGDVRLQGSQFGPYQMTGIHDLKAFWGKGAQVDVRV* |
| Ga0068869_1017186301 | 3300005334 | Miscanthus Rhizosphere | LAEFIKKDLGQTRLHGLDFGPHQMTCIHDLKVFWGKGAQVDVHAV* |
| Ga0070671_1019312082 | 3300005355 | Switchgrass Rhizosphere | SPAKAIEKAIHKRAAELASFIRENLGEIRQGLDYGPYQMTCIHDLKAFWGRGAQVDVRV* |
| Ga0070674_1009873103 | 3300005356 | Miscanthus Rhizosphere | IPKSVEKAIQKRAGELASFIRANLGEVRLQGSDYGPHQMTGIHDLKAFWGKGAHVDVRV* |
| Ga0066686_107950253 | 3300005446 | Soil | GFIRAHLGEVRLQGSDYGPHQMTGIHDLKAFWGKGAQVSP* |
| Ga0066681_103974841 | 3300005451 | Soil | RATELANFIRSHLGEVRLQGLDYGPHQMTGIHDLKEFWGKGAQVDIRV* |
| Ga0070685_100065984 | 3300005466 | Switchgrass Rhizosphere | LFENPPKAVEKAIRKRASALADFIRTDLGQTRLHGLDFGPHQMTCIHDLKVFWGKGAQVDVRAV* |
| Ga0070679_1004876371 | 3300005530 | Corn Rhizosphere | LFDPSVPKSVDKAIHKRAGELAAYIRSNLGEVRLQGSDYGPHQMTGIHDLKAFWGKGAQVDVRV* |
| Ga0068857_1013472933 | 3300005577 | Corn Rhizosphere | FDTAAAKAVEKSVRKRSGELAAFIRTNLGEIRAHSLDYGPHQMTCIHDLKAFWGKGAQVDVRV* |
| Ga0068859_1026313223 | 3300005617 | Switchgrass Rhizosphere | GELASFIRANLGEVRLQGSDYGPHQMTGIHDLKAFWGKGAQVDVRV* |
| Ga0066905_1000412224 | 3300005713 | Tropical Forest Soil | ASLGEVRLQGSQYGPHQMTGIHDLKVFWGKGAQVDVRA* |
| Ga0066903_1041933393 | 3300005764 | Tropical Forest Soil | VDKAIHKRAGELANFIRASLGEVRLQGSQYGPHQMTGIHDLKVFWGKGAQVDVRA* |
| Ga0066903_1051418631 | 3300005764 | Tropical Forest Soil | IRKRATALAEFIRTDLGQTRLHGLDFGPHQMTGIHDLKVFWGKGAQVDVRAV* |
| Ga0074470_113863012 | 3300005836 | Sediment (Intertidal) | EKRSSQLAAFIRSNLGQTRLHGLDYGPHQMTCIHDLKAFWGKGAQVDVRAV* |
| Ga0081455_103849453 | 3300005937 | Tabebuia Heterophylla Rhizosphere | KSVDKAIHKRAGELANFIRGNLGEVRLQGSDYGPYQMTGIHDLKAFWGKGAQVDVRV* |
| Ga0066656_101517421 | 3300006034 | Soil | RANLGEVRLQGLDYGPHQMTGIHDLKMFWGKGVRVDVRV* |
| Ga0066656_110148631 | 3300006034 | Soil | NLGEVRLQGVDYGPHQTTGIHDLKAFWGKGAQADSRV* |
| Ga0066665_105627483 | 3300006796 | Soil | LFESNIPKPVEKAIHKRAAELASFIRSHLGEVRLQGLDYGPHQMTGIHDLKVFWGKGAQVDIRV* |
| Ga0066659_112180151 | 3300006797 | Soil | SHLGEVRLQGLDYGPHQMTGIHDLKVFWGKGAQVDIRV* |
| Ga0075428_1017281701 | 3300006844 | Populus Rhizosphere | ASFIRANLGEVRLQGSDYGPHQMTGIHDLKAFWGKGAQVDVRV* |
| Ga0075421_1002688811 | 3300006845 | Populus Rhizosphere | ELANFIRSNLGDVRLQGSDYGPHQMTGIHDLKAFWGKGAQVDVRV* |
| Ga0075421_1007013861 | 3300006845 | Populus Rhizosphere | RAGELSNFIRANLGEIRLQGSDYGPHQMTGIHDLKAFWGKGAQVDVRI* |
| Ga0075430_1009215071 | 3300006846 | Populus Rhizosphere | DSSIPKSVDKAIHKRAGELANFIRANLGEVRLQGSQYGPHQMTGIHDLKVFWGKGAQVDVRA* |
| Ga0079217_109254871 | 3300006876 | Agricultural Soil | EKALRKRATDLADFIRKDLGQTRLHGLDFGPHQMTCIHDLKAFWGKGAQVDVRAI* |
| Ga0068865_1012025672 | 3300006881 | Miscanthus Rhizosphere | FETTPKPVEKALRKRAADLADFIRKDLGQTRLHGLDFGPHQMTCIHDLKAFWGRGAQVDVRAV* |
| Ga0075426_108039523 | 3300006903 | Populus Rhizosphere | AIHKRANELASFIRANLGEVRLQGSDYGPHQMTGIHDLKEFWGKGAQVDVQV* |
| Ga0075436_1013915853 | 3300006914 | Populus Rhizosphere | ELANFIRASLGEVRLQGSQYGPHQMTGIHDLKVFWGKGAQVDVRA* |
| Ga0066710_1030352361 | 3300009012 | Grasslands Soil | IAKSAERAIHKRASELAGFIRSNLGEVRLQGVDYGPHQTTGIHDLKAFWGKGAQADSRV |
| Ga0066710_1034919461 | 3300009012 | Grasslands Soil | SELAGFIRSNLGEVRLQGVDYGPHQTTGIHDLKAFWGKGAQADSRV |
| Ga0105247_118570082 | 3300009101 | Switchgrass Rhizosphere | EKAIRKRASALADFIRTDLGQTRLHGLDFGPHQMTCIHDLKVFWGKGAQVDVRAV* |
| Ga0066709_1008140303 | 3300009137 | Grasslands Soil | SFIRANLGDVRLQGSDYGPHQMTGIHDLKALWGKGAQVSL* |
| Ga0066709_1012434601 | 3300009137 | Grasslands Soil | LSSFIRSTLGEVRLQGLDYGPHQMTGIHDLKAFWGKGAQVDVRI* |
| Ga0066709_1032310821 | 3300009137 | Grasslands Soil | GELANFIRANLGEVRLQGLDYGPHQMTGIHDLKMFWGKGVQVDVRV* |
| Ga0114129_106028591 | 3300009147 | Populus Rhizosphere | ELAAFIRTHLGEIRAHSLDYGPHQMTCIHDLKAFWGKGAQVDVRV* |
| Ga0114129_113343343 | 3300009147 | Populus Rhizosphere | KAVEKTVRKRSGELAAFIRTHLGEIRAHSLDYGPHQMTCIHDLKAFWGKGAQVDVRV* |
| Ga0111538_117105321 | 3300009156 | Populus Rhizosphere | ANFIRANLGEVRLQGSQYGPHQMTGIHDLKVFWGKGAQVDVRA* |
| Ga0105242_126358563 | 3300009176 | Miscanthus Rhizosphere | KRAGELANFIRANLGDVRLQGSQFGPYQMTGIHDLKAFWGKGAQVDVRV* |
| Ga0105248_120140991 | 3300009177 | Switchgrass Rhizosphere | AATAKSVEKAIRKRATELASFIQENLGEIRLQGLDYGPHQMTCIHDLKAFWGRGAQVDVRV* |
| Ga0105249_119461592 | 3300009553 | Switchgrass Rhizosphere | DLGQTRLHGLDFGPHQMTCIHDLKVFWGKGAQVDVRAV* |
| Ga0126384_102542193 | 3300010046 | Tropical Forest Soil | RAGELANFIRASLGEVRLQGSQYGPHQMTGIHDLKVFWGKGAQVDVRA* |
| Ga0126384_117174241 | 3300010046 | Tropical Forest Soil | GELANFIRANLGEVRLQGSHYGPHQMTGIHDLKAFWGKGAQVDVRA* |
| Ga0126382_108445013 | 3300010047 | Tropical Forest Soil | DKAIHKRAGELANFIRASLGEVRLQGSQYGPHQMTGIHDLKVFWGKGAQVDVRA* |
| Ga0126382_120462343 | 3300010047 | Tropical Forest Soil | LGEVRLQGSELGPHQMTGIHDLKEFWGKGAQVDVRV* |
| Ga0126382_121655282 | 3300010047 | Tropical Forest Soil | SVDKAIHKRAGELANFIRASLGEVRLQGSQYGPHQMTGIHDLKVFWGKGAQVDVRA* |
| Ga0126373_107709951 | 3300010048 | Tropical Forest Soil | KAIHKRAGELASYIRSNLGEVRLQGSDYGPHQMTGIHDLKAFWGKGAQVDVRV* |
| Ga0127486_11511923 | 3300010128 | Grasslands Soil | DSIAKSAERAIHKRASELAGFIRSNLGEVRLQGVDYGPHQTTGIHDLKAFWGKGAQADSRV* |
| Ga0126370_116816151 | 3300010358 | Tropical Forest Soil | RATELASFIRTNLGDIRLQGLDYGPHQMTGIHDLKAFWGKGAQVDVRV* |
| Ga0126370_125457062 | 3300010358 | Tropical Forest Soil | LFDSNIPKPAEKAIHKRASELAGFIRSTLGEVRLQGLDYGPHQMTGIHDLKAFWGKGAQVDVRV* |
| Ga0126372_124107101 | 3300010360 | Tropical Forest Soil | KSVEKAIHKRAGELAAFIRSHLGEVRLQGSELGPHQMTGIHDLKEFWGKGAQVDVRV* |
| Ga0126378_131271301 | 3300010361 | Tropical Forest Soil | KAIHRRASELAGFIRSTLGEVRLQGLDYGPHQMTGIHDLKAFWGKGAQVDVRV* |
| Ga0126378_131730791 | 3300010361 | Tropical Forest Soil | LASYIRSNLGEVRLQGSDYGPHQMTGIHDLKAFWGKGAQVDVRV* |
| Ga0126379_133042062 | 3300010366 | Tropical Forest Soil | DSSIPKSVEKAIHKRAGELAAFIRSHLGEVRLQGSELGPHQMTGIHDLKEFWGKGAQVDVRV* |
| Ga0134127_122968661 | 3300010399 | Terrestrial Soil | NLGQTRLHGLDFGPHQMTCIHDLKAFWGKGAQVDVRAV* |
| Ga0134121_120052681 | 3300010401 | Terrestrial Soil | AIHKRAGELANFIRGNLGEVRLQGSDYGPHQMTGIHDLKAFWGKGAQVDVRV* |
| Ga0105246_112232231 | 3300011119 | Miscanthus Rhizosphere | KAIRKRASALADFIRTDLGQTRLHGLDFGPHQMTCIHDLKVFWGKGAQVDVRAV* |
| Ga0150983_153720472 | 3300011120 | Forest Soil | VEKAMNKRAGELAAFIRSHLGDVRLQGSELGPHQMTGIHDLKEFWGKGAQVDVRV* |
| Ga0137314_11544752 | 3300011420 | Soil | DLGQTRLHGLDFGPHQMTCIHDLKVFWGNGAQVDVRAV* |
| Ga0137365_100366525 | 3300012201 | Vadose Zone Soil | ASELAGFIRSNLGEVRLQGVDYGPHQTTGIHDLKAFWGKGAQADSRV* |
| Ga0137377_110570391 | 3300012211 | Vadose Zone Soil | NLGEVRLQGLDYGPHQMTGIHDLKMFWGKGVRVDVRV* |
| Ga0150985_1126644143 | 3300012212 | Avena Fatua Rhizosphere | NLGEIRLQGLDYGPHQMTCIHDLKAFWGRGAQVDVRA* |
| Ga0137385_108998503 | 3300012359 | Vadose Zone Soil | RKRAGELANFIRTNLGAVRLQGLDYGPHQMTGIHDLKAFWGKGVQVDVRV* |
| Ga0150984_1202856363 | 3300012469 | Avena Fatua Rhizosphere | LAGFIRSNLGEVRLQGLDYGPHQMTGIHDLKAFWGKGAQVDVRV* |
| Ga0157305_101257332 | 3300012891 | Soil | EKAVRKRAADLSEFIRRDLGQTRLHGLDFGPHQMTCIHDLKVFWGKGAQVDVRTV* |
| Ga0157308_103934143 | 3300012910 | Soil | LGEVRLQGSDYGPHQMTGIHDLKAFWGKGAQVDVRV* |
| Ga0126375_102243711 | 3300012948 | Tropical Forest Soil | SIPRSVEKAIHKRASELATFIRSNLGEVRLQGSDYGPHQMTGIHDLKAFWGKGAQVDVRA |
| Ga0126369_114420741 | 3300012971 | Tropical Forest Soil | IRIDLGQTRLHGLDFGPHQMTGIHDLKVFWGKGAQVDVRAV* |
| Ga0126369_125925961 | 3300012971 | Tropical Forest Soil | SVEKAIHKRAGELAAYIRSNLGDVRLQGSDYGPHQMTGIHDLKAFWGKGAQVDVRV* |
| Ga0126369_134336003 | 3300012971 | Tropical Forest Soil | AAELAAFIRTNLGEVRLQGSDYGPHQMTGIHDLKAFWGNGAQVDVRV* |
| Ga0157375_109675042 | 3300013308 | Miscanthus Rhizosphere | FIRGNLGEIRLQGLDYGPHQMTCIHDLKAFWGRGAQVDVRA* |
| Ga0163163_131023472 | 3300014325 | Switchgrass Rhizosphere | RGNLGEIRLQGLDYGPHQMTCIHDLKAFWGRGAQVDVRA* |
| Ga0132256_1016879581 | 3300015372 | Arabidopsis Rhizosphere | KTIHKRAADLAGFIRQNLGEIRLQGLDYGPHQMTGIHDLKAFWGKGAQVDVRV* |
| Ga0132256_1020447451 | 3300015372 | Arabidopsis Rhizosphere | STISKSAMKVIRKRADELATFIRNNLGDVRLQGLDYGPHQMTGIHDLKAFWGKGTQVDIRV* |
| Ga0132257_1039628011 | 3300015373 | Arabidopsis Rhizosphere | KRAAELAHFIKVSLGDVRLQGSDYGPHQMTGIHDLKAFWGKGAQVDVRV* |
| Ga0132255_1020333561 | 3300015374 | Arabidopsis Rhizosphere | ELASFIRANLGEVRLQGSDYGPHQMTGIHDLKAFWGKGAQVDVRV* |
| Ga0182036_111834561 | 3300016270 | Soil | IPKPAEKAIHKRASELAGFIRSTLGEVRLQGLDYGPHQMTGIHDLKAFWGKGAQVDVRL |
| Ga0182041_109436283 | 3300016294 | Soil | ELANFIRSNLGEVRLQGLDYGPHQMTGIHDLKAFWGKGAQVDTRV |
| Ga0182038_116466903 | 3300016445 | Soil | STLGEVRLQGLDYGPHQMTGIHDLKAFWGKGAQVDVRL |
| Ga0187784_111942853 | 3300018062 | Tropical Peatland | NLGDVRLQGSDYGPHQMTGIPDLKAFWGKGSHVDVRV |
| Ga0066655_107368541 | 3300018431 | Grasslands Soil | HFIKANLGEVRLQGLDYGPHQMTGIHDLKVFWGKGVQVDVRV |
| Ga0066655_110626951 | 3300018431 | Grasslands Soil | ELANFIRANLGEVRLQGGHYGPHQMTGIHDLKAFWGKGAQVDVRV |
| Ga0066669_105845221 | 3300018482 | Grasslands Soil | NLGEVRLQGVDYGPHQTTGIHDLKAFWGKGAQADSRV |
| Ga0187893_103789001 | 3300019487 | Microbial Mat On Rocks | KRANELNGFIKNYLGDIRLQGQDYGPHQMTCIHDLKAFWGKGAQVDVTV |
| Ga0193711_10198771 | 3300019997 | Soil | ELAGFIRGNLGEIRLQGLDYGPHQMTCIHDLKAFWGRGAQVDVRA |
| Ga0193753_101587001 | 3300020034 | Soil | NLGEIRLQGLDYGPHQMTCIHDLKAFWGRGAQVDVRA |
| Ga0210406_103807721 | 3300021168 | Soil | LAGFIRSHLGEVRLQGSELGPHQMTGIHDLKEFWGKGAQVDVRV |
| Ga0210383_103184323 | 3300021407 | Soil | FDTSIPKSVEKAIHKRAGELASYIRSNLGEVRLQGSDYGPHQMTGIHDLKAFWGKGAQVDVRV |
| Ga0126371_126216563 | 3300021560 | Tropical Forest Soil | RAGELANFIRASLGEVRLQGSQYGPHQMTGIHDLKVFWGKGAQVDVRA |
| Ga0126371_127999951 | 3300021560 | Tropical Forest Soil | SIPKSVEKAIHKRAGELASYIRSNLGEIRLQGSDYGPHQMTGIHDLKAFWGKGAQVDVRV |
| Ga0207688_105232301 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | ILFENPSKAVEKAIRKRASALADFIRTDLGQTRLHGLDFGPHQMTCIHDLKVFWGKGAQVDVRAV |
| Ga0207680_100171121 | 3300025903 | Switchgrass Rhizosphere | FIRGNLGEIRLQGLDYGPHQMTCIHDLKAFWGRGAQVDVRA |
| Ga0207652_109999203 | 3300025921 | Corn Rhizosphere | LFDPSVPKSVDKAIHKRAGELAAYIRSNLGEVRLQGSDYGPHQMTGIHDLKAFWGKGAQVDVRV |
| Ga0207681_112562231 | 3300025923 | Switchgrass Rhizosphere | SALADFIRTDLGQTRLHGLDFGPHQMTCIHDLKVLWGKGAQVDVRAV |
| Ga0207659_103435232 | 3300025926 | Miscanthus Rhizosphere | KAIQKRAVALADFIRTDLGQTRLHGLDFGPHQMTCIHDLKVFWGKGAQVDVHAL |
| Ga0207701_110140931 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | SVRKRSGELAAFIRTNLGEIRAHSLDYGPHQMTCIHDLKAFWGKGAQVDVRV |
| Ga0207701_116162862 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | LKPLEKLLKKKSGELAAFIKNNLGEIRLQGLDYGPHQMTGIRELKAFWGKGAQVDVGL |
| Ga0207691_113432981 | 3300025940 | Miscanthus Rhizosphere | FIRTDLGQTRLHGLDFGPHQMTCIHDLKVFWGKGAQVDVRAV |
| Ga0207689_115143031 | 3300025942 | Miscanthus Rhizosphere | LAEFIKKDLGQTRLHGLDFGPHQMTCIHDLKVFWGKGAQVDVHAV |
| Ga0207712_121171771 | 3300025961 | Switchgrass Rhizosphere | DFIRKDLGQTRLHGLDFGPHQMTCIHDLKAFWGRGAQVDVRAV |
| Ga0207658_116128022 | 3300025986 | Switchgrass Rhizosphere | EKAIRKRASALADFIRTDLGQTRLHGLDFGPHQMTCIHDLKVFWGKGAQVDVRAV |
| Ga0207658_116751451 | 3300025986 | Switchgrass Rhizosphere | FIRTDLGQTRLHGLDFGPHQMTCIHDLKVFWGKGAQVDVHAL |
| Ga0207641_118507161 | 3300026088 | Switchgrass Rhizosphere | LGEIRLQGLDYGPHQMTCIHDLKAFWGRGAQVDVRA |
| Ga0207674_116511801 | 3300026116 | Corn Rhizosphere | FDTAAAKAVEKSVRKRSGELAAFIRTNLGEIRAHSLDYGPHQMTCIHDLKAFWGKGAQVDVRV |
| Ga0207683_118671503 | 3300026121 | Miscanthus Rhizosphere | VEKAIRKRASALADFIRTDLGQTRLHGLDFGPHQMTCIHDLKVFWGKGAQVDVRAV |
| Ga0209470_13152943 | 3300026324 | Soil | RSNLGEVRLQGVDYGPHQTTGIHDLKAFWGKGAQADSRV |
| Ga0209803_11552663 | 3300026332 | Soil | KSTEKTIHKRALDLASFIRANLGDVRLQGSDYGPHQMTGIHDLKALWGKGAQVSL |
| Ga0209157_13727161 | 3300026537 | Soil | LLFDSIPKSAEKAIYKRATELGNFIRSNLGEVRLQGVDYGPHQMTGIHDLKAFWGKGAHADSRV |
| Ga0209056_103872323 | 3300026538 | Soil | RASELAGFIRSNLGEVRLQGVDYGPHQTTGIHDLKAFWGKGAPADSRV |
| Ga0209056_104381503 | 3300026538 | Soil | RASELAGFIRSNLGEVRLQGVDYGPHQTTGIHDLKAFWGKGAQADSRV |
| Ga0209376_12414413 | 3300026540 | Soil | DPSMPKHVEKAVRKRAGELAHFIKANLGEVRLQGLDYGPHQMTGIHDLKVFWGKGVQVDVRV |
| Ga0209474_106079291 | 3300026550 | Soil | AERAIHKRAAELANFIRSNLGEVRLQGVDYGPHQMTGIHDLKAFWGKGAHADSRV |
| Ga0209481_102403303 | 3300027880 | Populus Rhizosphere | SVDKAIHKRAGELANFIRASLGEVRLQGSQYGPHQMTGIHDLKVFWGKGAQVDVRA |
| Ga0209382_100848085 | 3300027909 | Populus Rhizosphere | KRASELANFIRSNLGDVRLQGSDYGPHQMTGIHDLKAFWGKGAQVDVRV |
| Ga0209382_107005991 | 3300027909 | Populus Rhizosphere | RAGELSNFIRANLGEIRLQGSDYGPHQMTGIHDLKAFWGKGAQVDVRI |
| Ga0307503_104190412 | 3300028802 | Soil | RKRATELAGFIRGNLGEIRLQGLDYGPHQMTCIHDLKAFWGRGAQVDVRA |
| Ga0307498_100996601 | 3300031170 | Soil | IRGNLGEIRLQGLDYGPHQMTCIHDLKAFWGRGAQVDVRA |
| Ga0306921_107842893 | 3300031912 | Soil | AAELATFIRSNLGEVRLQGSDYGPHQMTGIHDLKAFWGKGAQVDVRV |
| Ga0310912_104981081 | 3300031941 | Soil | SNLGEVRLQGSDYGPHQMTGIHDLKAFWGKGAQVDVRV |
| Ga0310912_110760101 | 3300031941 | Soil | LLIDSSVPKSLERAIHKRAAELANFIRSNLGEVRLQGLDYGPHQMTGIHDLKAFWGKGAQVDTRV |
| Ga0310909_103495893 | 3300031947 | Soil | FDSSIPKTVEKAIHKRAAELATFIRSNLGEVRLQGSDYGPHQMTGIHDLKAFWGKGAQVDVRV |
| Ga0306922_108956681 | 3300032001 | Soil | SIPKTVEKAIHKRAAELATFIRSNLGEVRLQGSDYGPHQMTGIHDLKAFWGKGAQVDVRV |
| Ga0310897_101088632 | 3300032003 | Soil | EKALRKRAADLADFIRKDLGQTRLHGLDFGPHQMTCIHDLKAFWGRGAQVDVRAV |
| Ga0310896_103981842 | 3300032211 | Soil | LRKRAADLADFIRKDLGQTRLHGLDFGPHQMTCIHDLKAFWGRGAQVDVRAV |
| Ga0306920_1042635852 | 3300032261 | Soil | HKRAADLANFIRSTLGEVRLQGLDYGPHQMTGIHDLKAFWGKGAQVDVRV |
| Ga0310914_108750861 | 3300033289 | Soil | LERAIHKRAAELANFIRSNLGEVRLQGLDYGPHQMTGIHDLKAFWGKGAQVDTRV |
| Ga0310810_112524153 | 3300033412 | Soil | ATFIRNNLGDVRLQGLDYGPHQMTGIHDLKAFWGKGTQVDIRV |
| ⦗Top⦘ |