| Basic Information | |
|---|---|
| Family ID | F053160 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 141 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MNNPFLFGAFALVTVVFFIHNWLMSSRQKRLEKKLEELKAQLKDR |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 141 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 87.86 % |
| % of genes near scaffold ends (potentially truncated) | 23.40 % |
| % of genes from short scaffolds (< 2000 bps) | 90.07 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.035 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (17.021 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.078 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.284 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.16% β-sheet: 0.00% Coil/Unstructured: 43.84% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 141 Family Scaffolds |
|---|---|---|
| PF01578 | Cytochrom_C_asm | 42.55 |
| PF01904 | DUF72 | 18.44 |
| PF03379 | CcmB | 4.26 |
| PF03918 | CcmH | 2.13 |
| PF01435 | Peptidase_M48 | 1.42 |
| PF00753 | Lactamase_B | 1.42 |
| PF12543 | DUF3738 | 0.71 |
| PF00912 | Transgly | 0.71 |
| PF09413 | DUF2007 | 0.71 |
| PF13620 | CarboxypepD_reg | 0.71 |
| PF00005 | ABC_tran | 0.71 |
| PF04343 | DUF488 | 0.71 |
| PF01048 | PNP_UDP_1 | 0.71 |
| PF13709 | DUF4159 | 0.71 |
| PF01928 | CYTH | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 141 Family Scaffolds |
|---|---|---|---|
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 18.44 |
| COG2386 | ABC-type transport system involved in cytochrome c biogenesis, permease component | Posttranslational modification, protein turnover, chaperones [O] | 4.26 |
| COG3088 | Cytochrome c-type biogenesis protein CcmH/NrfF | Posttranslational modification, protein turnover, chaperones [O] | 2.13 |
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.71 |
| COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.71 |
| COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.71 |
| COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.71 |
| COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 0.71 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 0.71 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.04 % |
| Unclassified | root | N/A | 4.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664022|INPgaii200_c0834359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1164 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101769901 | All Organisms → cellular organisms → Bacteria | 13483 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_104797183 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 781 | Open in IMG/M |
| 3300000550|F24TB_12421582 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
| 3300000956|JGI10216J12902_108496724 | All Organisms → cellular organisms → Bacteria | 1824 | Open in IMG/M |
| 3300003267|soilL1_10152938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1588 | Open in IMG/M |
| 3300003267|soilL1_10216373 | All Organisms → cellular organisms → Bacteria | 1496 | Open in IMG/M |
| 3300003324|soilH2_10364573 | All Organisms → cellular organisms → Bacteria | 1762 | Open in IMG/M |
| 3300004114|Ga0062593_102945056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300004139|Ga0058897_10935078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300004157|Ga0062590_102633014 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300004633|Ga0066395_10009585 | All Organisms → cellular organisms → Bacteria | 3541 | Open in IMG/M |
| 3300004633|Ga0066395_10705563 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300004643|Ga0062591_102708413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300005163|Ga0066823_10087992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300005171|Ga0066677_10437397 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300005175|Ga0066673_10791400 | Not Available | 543 | Open in IMG/M |
| 3300005180|Ga0066685_10150289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1584 | Open in IMG/M |
| 3300005186|Ga0066676_10666539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300005332|Ga0066388_100015380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 6339 | Open in IMG/M |
| 3300005332|Ga0066388_100755535 | All Organisms → cellular organisms → Bacteria | 1571 | Open in IMG/M |
| 3300005332|Ga0066388_101688496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae | 1120 | Open in IMG/M |
| 3300005332|Ga0066388_102244150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 986 | Open in IMG/M |
| 3300005332|Ga0066388_102437625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 950 | Open in IMG/M |
| 3300005332|Ga0066388_105062890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300005332|Ga0066388_107146700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300005338|Ga0068868_101560433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300005365|Ga0070688_100694596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 787 | Open in IMG/M |
| 3300005440|Ga0070705_100750519 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
| 3300005459|Ga0068867_101056385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
| 3300005545|Ga0070695_101827497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300005549|Ga0070704_101988500 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300005558|Ga0066698_10736855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300005598|Ga0066706_10800537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
| 3300005713|Ga0066905_100335199 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300005764|Ga0066903_100095665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3979 | Open in IMG/M |
| 3300005764|Ga0066903_102926649 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300005764|Ga0066903_105987023 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300006796|Ga0066665_11336740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300006796|Ga0066665_11487291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300006844|Ga0075428_100663025 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300006844|Ga0075428_101130657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
| 3300006845|Ga0075421_100012158 | All Organisms → cellular organisms → Bacteria | 10677 | Open in IMG/M |
| 3300006846|Ga0075430_100611818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 899 | Open in IMG/M |
| 3300006854|Ga0075425_101841758 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300006854|Ga0075425_101955836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300006865|Ga0073934_10360720 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300006904|Ga0075424_101341110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300006914|Ga0075436_101529619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300006969|Ga0075419_10406707 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 933 | Open in IMG/M |
| 3300009012|Ga0066710_100714184 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
| 3300009012|Ga0066710_101026988 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300009012|Ga0066710_101191962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1180 | Open in IMG/M |
| 3300009012|Ga0066710_101398224 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300009137|Ga0066709_100377968 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1957 | Open in IMG/M |
| 3300009137|Ga0066709_101689600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 899 | Open in IMG/M |
| 3300009137|Ga0066709_103386888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300009147|Ga0114129_10577258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1459 | Open in IMG/M |
| 3300009147|Ga0114129_10907550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1116 | Open in IMG/M |
| 3300009147|Ga0114129_11904355 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300009444|Ga0114945_10218064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1110 | Open in IMG/M |
| 3300009444|Ga0114945_10631923 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300009609|Ga0105347_1035465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1754 | Open in IMG/M |
| 3300009792|Ga0126374_10334656 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1031 | Open in IMG/M |
| 3300009792|Ga0126374_11080381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300010043|Ga0126380_11533891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300010046|Ga0126384_10621755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 948 | Open in IMG/M |
| 3300010047|Ga0126382_10110326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1800 | Open in IMG/M |
| 3300010358|Ga0126370_12045628 | Not Available | 561 | Open in IMG/M |
| 3300010358|Ga0126370_12401578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300010359|Ga0126376_12729851 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300010360|Ga0126372_13038966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300010362|Ga0126377_10105583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2577 | Open in IMG/M |
| 3300010362|Ga0126377_10504480 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300010362|Ga0126377_11606661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300010362|Ga0126377_12737289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300010362|Ga0126377_13379618 | Not Available | 516 | Open in IMG/M |
| 3300010366|Ga0126379_10966638 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300010366|Ga0126379_13167724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300010376|Ga0126381_105070053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300010397|Ga0134124_11984184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300010398|Ga0126383_11706022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| 3300010398|Ga0126383_12400611 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300010400|Ga0134122_11097563 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300010401|Ga0134121_10688885 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300010401|Ga0134121_11339821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
| 3300010401|Ga0134121_11444734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300010401|Ga0134121_12644880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300010403|Ga0134123_11970008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300010403|Ga0134123_13134938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300011119|Ga0105246_11032371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
| 3300011120|Ga0150983_12204973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300011120|Ga0150983_15519494 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300011120|Ga0150983_16499276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
| 3300011439|Ga0137432_1180126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300011441|Ga0137452_1294252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300012167|Ga0137319_1007523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2345 | Open in IMG/M |
| 3300012189|Ga0137388_11577029 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300012189|Ga0137388_11722380 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300012202|Ga0137363_11610083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300012206|Ga0137380_10939977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
| 3300012351|Ga0137386_10357883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1050 | Open in IMG/M |
| 3300012362|Ga0137361_10772000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 876 | Open in IMG/M |
| 3300012917|Ga0137395_10685003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300012948|Ga0126375_10296153 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300012948|Ga0126375_10337958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1063 | Open in IMG/M |
| 3300012948|Ga0126375_11951601 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300012971|Ga0126369_12634813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300013297|Ga0157378_12034318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300015371|Ga0132258_10067240 | All Organisms → cellular organisms → Bacteria | 8293 | Open in IMG/M |
| 3300015371|Ga0132258_10103314 | All Organisms → cellular organisms → Bacteria | 6722 | Open in IMG/M |
| 3300015371|Ga0132258_10947829 | All Organisms → cellular organisms → Bacteria | 2174 | Open in IMG/M |
| 3300015371|Ga0132258_11377602 | All Organisms → cellular organisms → Bacteria | 1782 | Open in IMG/M |
| 3300015371|Ga0132258_11741989 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1571 | Open in IMG/M |
| 3300015371|Ga0132258_13391259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1094 | Open in IMG/M |
| 3300015371|Ga0132258_13892017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1015 | Open in IMG/M |
| 3300015372|Ga0132256_101276767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
| 3300015374|Ga0132255_101250138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1119 | Open in IMG/M |
| 3300016294|Ga0182041_11063141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
| 3300018089|Ga0187774_10587264 | Not Available | 718 | Open in IMG/M |
| 3300018468|Ga0066662_10380716 | Not Available | 1230 | Open in IMG/M |
| 3300018482|Ga0066669_11239557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300019487|Ga0187893_10843207 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300021170|Ga0210400_10847237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
| 3300021560|Ga0126371_13057549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300025899|Ga0207642_10987411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300025922|Ga0207646_10990944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
| 3300026089|Ga0207648_10067347 | All Organisms → cellular organisms → Bacteria | 3122 | Open in IMG/M |
| 3300026475|Ga0257147_1022348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 889 | Open in IMG/M |
| 3300027895|Ga0209624_10816104 | Not Available | 612 | Open in IMG/M |
| 3300027903|Ga0209488_10886553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300027909|Ga0209382_10130924 | All Organisms → cellular organisms → Bacteria | 2919 | Open in IMG/M |
| 3300027909|Ga0209382_10227652 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2125 | Open in IMG/M |
| 3300027909|Ga0209382_11270701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
| 3300027909|Ga0209382_11521343 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300031820|Ga0307473_10879613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300031910|Ga0306923_12310718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300031941|Ga0310912_11027348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300031954|Ga0306926_11481552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
| 3300032421|Ga0310812_10579108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 17.02% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.35% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 9.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.09% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.38% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 6.38% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.67% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.55% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.13% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 2.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.13% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.13% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 1.42% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.71% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.71% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.71% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.71% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
| 3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
| 3300012167 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT333_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPgaii200_08343593 | 2228664022 | Soil | MNNPFLFGAFALVTVVFFIHNWLMSSRQKRLEKKLEELKAQLKDR |
| INPhiseqgaiiFebDRAFT_1017699018 | 3300000364 | Soil | MNNPFLFGAFALVTVVFFIHNWLMSSRQKRLEKKLEELKAQLKDRV* |
| INPhiseqgaiiFebDRAFT_1047971832 | 3300000364 | Soil | MNSQYLFGAFALVALVFFIHNLMMSSRQARLEKKLEELKSQLKDRM* |
| F24TB_124215822 | 3300000550 | Soil | MTNSYLFGAFALVAIVFFIHNWRLSSRQARLEKKLEELKAQLKDRNIR* |
| JGI10216J12902_1084967243 | 3300000956 | Soil | MNNPFLFGAFALVTVVFFVHNWLMSSRQKRLEKKLEELKAQLKDRV* |
| soilL1_101529381 | 3300003267 | Sugarcane Root And Bulk Soil | MNNSYLFGAFTLVAIVFFIHSWVMSSRQARLEKKLEELKNQVKDRV* |
| soilL1_102163732 | 3300003267 | Sugarcane Root And Bulk Soil | MNNLSYLFGAFTLVTLVFVIHSWMMSSKQSRLEKKLDELREQVKDKQRSL* |
| soilH2_103645734 | 3300003324 | Sugarcane Root And Bulk Soil | MNNLSYLFGAFALVTIVFFIHNWMMSSRQARLEKKLEELKAQLKDRTPQ* |
| Ga0062593_1029450562 | 3300004114 | Soil | MTNQYLFGAFLLVTIVLFIHSWRMSSRQARLEKKLEELKRQVKDS* |
| Ga0058897_109350782 | 3300004139 | Forest Soil | MNNNSYLFGAFALVTIVFFIHNWAMSSRQHRLEKKLEELKAQLKDKI* |
| Ga0062590_1026330142 | 3300004157 | Soil | MNNLSYLFGAFTLVTIVFLIHGWMMSSRQTRLEKKLEELREQVKDRRL* |
| Ga0066395_100095857 | 3300004633 | Tropical Forest Soil | MTNSYLFGAFALVAIVFFIHNWILSSRQARLEKKLEELKSQVKDRNIR* |
| Ga0066395_107055632 | 3300004633 | Tropical Forest Soil | MNNPFLFGAFALVTVVFFIHNWLMSSRQKRLEKKLEELKAQIKDRP* |
| Ga0062591_1027084132 | 3300004643 | Soil | LFGAFTLVTIVFLIHGWMMSSRQTRLEKKLEELREQVKDRRL* |
| Ga0066823_100879921 | 3300005163 | Soil | MSNQYLFGAFALVAIVFFIHNWLLSSRQARLEKRLEEMKNQLKDRS* |
| Ga0066677_104373972 | 3300005171 | Soil | MSNPYLFGAFALVSVVFFIHNWILSSRQNKLEKKLEDLKAQLKDRI* |
| Ga0066673_107914003 | 3300005175 | Soil | MNNNSYLFGAFALVTIVFFIHNWGMSARQRRLEKKLDELKAQLKDRN* |
| Ga0066685_101502893 | 3300005180 | Soil | MNNQYLFGAFTLVAIVFFIHNWVMSSRQARLEKKLEELKNQLKDRP* |
| Ga0066676_106665391 | 3300005186 | Soil | MNNKYLFGAFALVAIVFFIHNWMMSSRQKRLETKLEELKSQLRDRP* |
| Ga0066388_1000153803 | 3300005332 | Tropical Forest Soil | MNNSYLFGAFALVTIVFFIHSWILSSRQVRLEKKVEELKSQLKDKT* |
| Ga0066388_1007555352 | 3300005332 | Tropical Forest Soil | MTNSYLFGAFALVTIVFFIHNWLLSSRQARLEKKLEELKAQLKDKTR* |
| Ga0066388_1016884963 | 3300005332 | Tropical Forest Soil | MTNSYLFGAFALVAFVFFIHNWSLSSRQARLEKKLDELKSQLKDKNVV* |
| Ga0066388_1022441502 | 3300005332 | Tropical Forest Soil | MTNSYLFGAFALVAIVFFIHNWLLSSRQARLEKKLEELKSQAKDR* |
| Ga0066388_1024376251 | 3300005332 | Tropical Forest Soil | PWRMTNSYLFGAFALVAIVFFVHNWLLSSRQARLEKNLEELKSQLKDKR* |
| Ga0066388_1050628901 | 3300005332 | Tropical Forest Soil | MTNSYLFGAFALVAFVFFIHNWILSSRQARLEKKLEQLKSQVKDRNIS* |
| Ga0066388_1071467002 | 3300005332 | Tropical Forest Soil | MNNPFLFGAFALVTVVFFIHNWLMSSRQKRLEKKLEELKAQLKDRP* |
| Ga0068868_1015604331 | 3300005338 | Miscanthus Rhizosphere | MNTKYLFAAFALVAIVFFIHNWMMSSRQKRLETKLEELKSQLRD |
| Ga0070688_1006945961 | 3300005365 | Switchgrass Rhizosphere | MTNQYLFGAFLLVTIVLFIHSWRMSSRQARLEKKLEELKRQVKDS |
| Ga0070705_1007505192 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MNNQYLFGAFALVAIVFFIHNWMMSSRQKRLETKLEELKSQLRDRP* |
| Ga0068867_1010563852 | 3300005459 | Miscanthus Rhizosphere | MNNRFLFAAFALVTIVFFIHNWAMSSRQRRLERKLEELKDQLKGRELRQ* |
| Ga0070695_1018274972 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MNNSSYLFGAFALVSVVFFIHNWLMSSRQARLEKKLEELRRQFKDRM* |
| Ga0070704_1019885002 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MNSRFLFGAFALVTIVFFIHNWAMSSRQRRLEKKLDDLKNQLKDRT* |
| Ga0066698_107368552 | 3300005558 | Soil | MNNQYLFGAFTLVAIVFFIHNWVMSSRQARLEKKLEELKNQLKDRV* |
| Ga0066706_108005372 | 3300005598 | Soil | MNNSRFLFGAFALVTIVFFIHNWAMSSRQRRLEKKLDELKNQLKDRT* |
| Ga0066905_1003351992 | 3300005713 | Tropical Forest Soil | MTNSYLFGAFALVAIVFFIHNWLLSSRQARLEKKLEELKVHLKDKTR* |
| Ga0066903_1000956651 | 3300005764 | Tropical Forest Soil | MNNPFLFGAFALVTVVFFIHNWLMSSRQKRLEKKLKKLKAQIKDRP* |
| Ga0066903_1029266492 | 3300005764 | Tropical Forest Soil | MTNSYLFGAFALVAIVFFIHNWSLSSRQARLEKKLEELKSQLKDRNVV* |
| Ga0066903_1059870233 | 3300005764 | Tropical Forest Soil | MSNPFLFAAFALVAAVFLIHNWLMSSRQKRLEKKLDELKAQLTDRR* |
| Ga0066665_113367402 | 3300006796 | Soil | LFGAFTLVAIVFFIHNWVMSSRQARLEKKLEELKNQLKDRV* |
| Ga0066665_114872911 | 3300006796 | Soil | MNRNFLFGAFALASLVFFIHNWLMSARQKRLEKKLDELKSQLKDQM* |
| Ga0075428_1006630252 | 3300006844 | Populus Rhizosphere | MNNLSYLFAAFALVTLVFFIHAWMMSSRQSRLEKKLEELKAQLRDRNAGM* |
| Ga0075428_1011306572 | 3300006844 | Populus Rhizosphere | MTNSYLFGAFALVAIVFFIHNWLMSSRQARLEKKLEELKAQVKDR* |
| Ga0075421_1000121582 | 3300006845 | Populus Rhizosphere | MNNLSYLFGAFALVTLVFFLHSWLMSSRQARLERKLEELKAQIKEREPRI* |
| Ga0075430_1006118183 | 3300006846 | Populus Rhizosphere | MNNLSYLFAAFALVTLVFFIHAWMMSARQSRLEKKLEELKA |
| Ga0075425_1018417582 | 3300006854 | Populus Rhizosphere | MNNSYLFGAFALVTIVFFIHSWILSSRQVRLEKKLEELKSQLKDRPL* |
| Ga0075425_1019558362 | 3300006854 | Populus Rhizosphere | MNSQYLFGAFALVALVFFIHNLLMSSRQARLEKKLEELKSQLKDRL* |
| Ga0073934_103607202 | 3300006865 | Hot Spring Sediment | MNNLSYLFGAFALVAVVFLIHGWMMSSRQARLERKLDQLRAQISDKDRM* |
| Ga0075424_1013411102 | 3300006904 | Populus Rhizosphere | MNNTKFLFAAFALVAAVFLIHNWLMSSRQRRLEKKLEELKDQIDHRK* |
| Ga0075436_1015296192 | 3300006914 | Populus Rhizosphere | MSNPFLFGAFALVSLVFFIQNWRMSSRQSRLEKKLDELKAQLKDRL* |
| Ga0075419_104067072 | 3300006969 | Populus Rhizosphere | MTNSYLFGAFALVAIVFFIHNWLLSSRQARLEKKLEELKSQVRDR* |
| Ga0066710_1007141842 | 3300009012 | Grasslands Soil | MSNPYLFGAFALVSVVFFIHNWILSSRQARLEKKLEELKAQLKDRL |
| Ga0066710_1010269882 | 3300009012 | Grasslands Soil | MNNQYLFGAFTLVAIVFFIHNWVMSSRQARLEKKLEELKNQLKDRV |
| Ga0066710_1011919623 | 3300009012 | Grasslands Soil | MNNPFLFGAFALVTIVFFIHNWLMSSRQRDLEKKLDQLKDQLKDSRIESNRRPSM |
| Ga0066710_1013982242 | 3300009012 | Grasslands Soil | MNNKYLFGAFALVAIVFFIHNWMMSSRQKRLETKLEELKSQLRDRP |
| Ga0066709_1003779681 | 3300009137 | Grasslands Soil | MNNPFLFGAFALVTIVFFIHNWLMSSRQRDLEKKLDQLKDQLKDSRIESNRRPSM* |
| Ga0066709_1016896002 | 3300009137 | Grasslands Soil | MNNRFLFGAFALVAVVFFIHNWLLSSRQSRLERKLEELKNQVKDQM* |
| Ga0066709_1033868882 | 3300009137 | Grasslands Soil | MSNPYLFGAFALVSVVFFIHNWILSSRQARLEKKLEELKAQLKDRL* |
| Ga0114129_105772582 | 3300009147 | Populus Rhizosphere | MTNSYLFGAFAFVAIVFFIHNWLISSRQARLEKKLEELKSQVRDR* |
| Ga0114129_109075502 | 3300009147 | Populus Rhizosphere | MSNPYLFAAFALVAVVFFIHNWMLGSRQTRLEKKLDELKNQRKH* |
| Ga0114129_119043551 | 3300009147 | Populus Rhizosphere | MTNSYLFGAFALVTVVFFIHNWLLSSRQARLEKKLEELKSQLKDKL* |
| Ga0114945_102180643 | 3300009444 | Thermal Springs | MNRYFLFGAYAVVSIVFFIYAWLMGTRQKRLEKKLDELKEQVKERR* |
| Ga0114945_106319232 | 3300009444 | Thermal Springs | MSNTSFLFAAFALVTVVFFIHNWMMSSRQRQLEKKIEELKAQLKDRNAG* |
| Ga0105347_10354653 | 3300009609 | Soil | MNNLQYLFGAFTLVTVVFFIHSLLMSSRQARLEKRVEELKAQLKDRN* |
| Ga0126374_103346561 | 3300009792 | Tropical Forest Soil | KKSTTSRRLCWRMNNLSYLFGAFALVTLVFFIHSWLMSSRQARLEKKLAELKEQLKDKL* |
| Ga0126374_110803812 | 3300009792 | Tropical Forest Soil | MTNSYLFGAFALVAIVFFVHNWLLSSRQARLEKKLEELKSQLKDKR* |
| Ga0126380_115338911 | 3300010043 | Tropical Forest Soil | MTNSYLFGAFALVTIVFFIHNWLLSSKQARLEKKLEELKAQLKDKTR* |
| Ga0126384_106217552 | 3300010046 | Tropical Forest Soil | MTNSYLFGAFALVAIVFFIHNWLLSSRQARLEKKLEELKAQLKDKTR* |
| Ga0126382_101103262 | 3300010047 | Tropical Forest Soil | MNNPFLFGAFALVTVVFFIHNWLMSSRQKRLEKKLEELKAQLKDRA* |
| Ga0126370_120456281 | 3300010358 | Tropical Forest Soil | MNSQYLFGAFALVALVFFIHNLMMSSRQARLEKKLEELKSQLKDHL* |
| Ga0126370_124015782 | 3300010358 | Tropical Forest Soil | MSNPFLFGAFALVSVVFFIHNWIMSSRQSRLEKKLEELKSQLKDRT* |
| Ga0126376_127298511 | 3300010359 | Tropical Forest Soil | MTNSYLFGAFALVAIVFFIHNWSLSSRQARLEKKLDELKSQLKDKNLF |
| Ga0126372_130389662 | 3300010360 | Tropical Forest Soil | MNNPFLFGAFALVTVVFFIHNWLMSSRQKRLEKKLEELKAQLKD |
| Ga0126377_101055835 | 3300010362 | Tropical Forest Soil | MTNSYLFGAFALVAFVFFIHNWILSSRQARLEKKLEELKSQVKDRNIR* |
| Ga0126377_105044802 | 3300010362 | Tropical Forest Soil | MNSVFAAFSVVFIAIFIYSWLMTSRQKRLEKKLDELKAQLKDR* |
| Ga0126377_116066611 | 3300010362 | Tropical Forest Soil | MSNPFLFAAFALVAAVFLVHNWLMSSRQKRLEKKLDELKAQL |
| Ga0126377_127372892 | 3300010362 | Tropical Forest Soil | MNNLSYLFGAFALVTLVFFIHSWLMSSRQARLEKKLAELKEQLKDKL* |
| Ga0126377_133796181 | 3300010362 | Tropical Forest Soil | RMSKLSYLFGAFALVTIVFFIHSWLMSSRQARLEKKLEELKNQLKDRM* |
| Ga0126379_109666382 | 3300010366 | Tropical Forest Soil | MNNPFLFGAFALVTVVFFIHNWLMSSRQRRLEKKLEELKAQLKDRP* |
| Ga0126379_131677242 | 3300010366 | Tropical Forest Soil | MNNLSYLFGAFTLVTIVFLIHSWLMSSKQARLEKKLEELKSQMNSPK* |
| Ga0126381_1050700532 | 3300010376 | Tropical Forest Soil | MTNSYLFGAFALVAIVFFIHNWLLSSRQARLEKKLEELKSQLKDKVR* |
| Ga0134124_119841841 | 3300010397 | Terrestrial Soil | MNSQYLFGAFALVALVFFIHNLLMSSRQARLEKKLEELKSQLQDQKHL* |
| Ga0126383_117060221 | 3300010398 | Tropical Forest Soil | LFGAFALVTLVFFIHSWLMSSRQARLEKKLAELKEQLKDKL* |
| Ga0126383_124006112 | 3300010398 | Tropical Forest Soil | MTNSYLFGAFALVAIVFFIHSWSLSSRQARLEKKLDELKSQLKDKNLF* |
| Ga0134122_110975632 | 3300010400 | Terrestrial Soil | MSNPYLFGAFALVAIVFFIHNWMMSSRQARLEKKLEELKGQFKDRM* |
| Ga0134121_106888852 | 3300010401 | Terrestrial Soil | MSNPYLFGAFALVSVVFFIHNWILSSRQNKLEKKLEELKAQLKDRI* |
| Ga0134121_113398211 | 3300010401 | Terrestrial Soil | RSRWHMNSRFLFGAFALVTIVFFIHNWAMSSRQRRLEKKLDELKNQLKDRP* |
| Ga0134121_114447342 | 3300010401 | Terrestrial Soil | MNNQYLFGAFALVALVFFIHSWLLSSRQARLEKKLEELRNQLKD |
| Ga0134121_126448801 | 3300010401 | Terrestrial Soil | MNSQYLFGAFALVALVFFIHNLMMSSRQARLEKKLEELKSQLQDQKHL* |
| Ga0134123_119700081 | 3300010403 | Terrestrial Soil | MNNLSYLFGAFALVTLVFFIHGWIMSSRQARLEKKLEQLKEQLKDR |
| Ga0134123_131349382 | 3300010403 | Terrestrial Soil | MSNPYLFGAFALVAIVFFIHNWMMSSRQARLEKKLEELKAQLKDRNPL* |
| Ga0105246_110323712 | 3300011119 | Miscanthus Rhizosphere | MNNRFLFGAFLLVTIVFFIHNWAMSSRQRRLERKLEELKDQLKERT* |
| Ga0150983_122049733 | 3300011120 | Forest Soil | MNNYSYLFGAFALVTIVFFIHNWAMSSRQRSLERKLEELKAQLKDKI* |
| Ga0150983_155194942 | 3300011120 | Forest Soil | MSNPYLFGAFALVTLVFFIHNWLMSSRQSRLEKKLDELKAQLKDRL* |
| Ga0150983_164992762 | 3300011120 | Forest Soil | MNNNSYLFGAFALVTIVFFIHNWAMSSRQSRLEKKL |
| Ga0137432_11801262 | 3300011439 | Soil | MNNLQYLFGAFTLVTVVFFIHSLLMSSRQARLEKRVE |
| Ga0137452_12942521 | 3300011441 | Soil | MNNLSYLFGAFTLVTLVFFIHGWLMSSRQARLEKKLEELQ |
| Ga0137319_10075232 | 3300012167 | Soil | MNNLQYLFGAFTLVTVVFFIHSLLMGSRQARLEKRVEELKAQLKDRN* |
| Ga0137388_115770291 | 3300012189 | Vadose Zone Soil | MSNPFLFGAFALVTLVFFIHNWLMSSRQSRLEKKLE |
| Ga0137388_117223801 | 3300012189 | Vadose Zone Soil | MNNPFLFGAFALVTIVFFIHNWLMSSRQRDLEKKLDQLKDQLKDRSDR* |
| Ga0137363_116100831 | 3300012202 | Vadose Zone Soil | MSNPYLFGAFALVTLVFFIHNWLMSSRQSRLEKKLDELKAQLKDRP* |
| Ga0137380_109399771 | 3300012206 | Vadose Zone Soil | MSNPFLFGAFALVTVVFFVHNWLMSSRQRKLEKKLEQLKDQLKDRNAG* |
| Ga0137386_103578831 | 3300012351 | Vadose Zone Soil | MSNPFLFGAFALVTIVFFIHNWLMSSRQRDLEKKLDQLKDQLKDSRIESNRRPSM* |
| Ga0137361_107720001 | 3300012362 | Vadose Zone Soil | FGAFALVTIVFFIHNWLMSSRQRDLEKKLDQLKDQLKDSRIESNRRPSM* |
| Ga0137395_106850032 | 3300012917 | Vadose Zone Soil | MNNQYLFGAFALVAIVFFIHNWMMSSRQKRLETKLEELKSQLRDQP* |
| Ga0126375_102961531 | 3300012948 | Tropical Forest Soil | MNNTKFLFAAFALVAVVFFVHNWLMGARQKRLEKKLDELKDRLKTEKH* |
| Ga0126375_103379581 | 3300012948 | Tropical Forest Soil | MSNQYLFGAFALVALVFFIHNWLLSSRQARLEKRLEEMKNQLKDRA* |
| Ga0126375_119516012 | 3300012948 | Tropical Forest Soil | MNNTKFLFAAFALVAAVFLIHNWLMSSRQRRLEKKLEELKDQLDHRK* |
| Ga0126369_126348131 | 3300012971 | Tropical Forest Soil | MSNPFLFGAFALVSVVFFIHNWIMSSRQNRLEKKLEELKAQLKDRT* |
| Ga0157378_120343182 | 3300013297 | Miscanthus Rhizosphere | MSNQYLFGAFALVALVFFIHNWVLSSRQARLEKRLEQMKSQLKDRF* |
| Ga0132258_1006724011 | 3300015371 | Arabidopsis Rhizosphere | MNNQYLFGAFALVTIVFFIHSWLMSSRQARLEKKLEELKGQLPDRDGRR* |
| Ga0132258_101033144 | 3300015371 | Arabidopsis Rhizosphere | MSNQYLFGAFALVAIVFFIHNWVVGSRQARLEKKLEELKAQLKDRQHS* |
| Ga0132258_109478291 | 3300015371 | Arabidopsis Rhizosphere | MNNTKFLFAAFALVAAVFLIHNWLMSSRQRRLEKKLEELKDQLGQRK* |
| Ga0132258_113776023 | 3300015371 | Arabidopsis Rhizosphere | MNNLSYLFGAFALVTIVFFIHNWMMSSRQARLEKKLEELKAQLKDRNPL* |
| Ga0132258_117419893 | 3300015371 | Arabidopsis Rhizosphere | MNNPFLFGAFALVTVVFFFHNWLMSSRQKRLEKKLEELKAQLKDRV* |
| Ga0132258_133912592 | 3300015371 | Arabidopsis Rhizosphere | MSNQYLFGAFALVALVFFIHNWLLSSRQARLEKRLEEMKNQLKDRT* |
| Ga0132258_138920172 | 3300015371 | Arabidopsis Rhizosphere | MNNLSYLFGAFTLVTIVFFIHNWMMSSKQARLEKKLEELKAQLKDRN* |
| Ga0132256_1012767672 | 3300015372 | Arabidopsis Rhizosphere | MSNQYLFGAFALVAIVFFIHNWVVGSRQARLEKKLEELKAQL |
| Ga0132255_1012501382 | 3300015374 | Arabidopsis Rhizosphere | VFAAFALVTIVFLIHGWMMSSRQARLEKKLEELREQVKDRRL* |
| Ga0132255_1013303451 | 3300015374 | Arabidopsis Rhizosphere | AFLLVTIVLFIHSWRMSSRQARLEKKLEELKRQGKES* |
| Ga0182041_110631412 | 3300016294 | Soil | MSNPFLFGAFALVTLVFFIHNWLMSTRQSRLEKKLDELK |
| Ga0187774_105872642 | 3300018089 | Tropical Peatland | MSNPFLFGAFALVSVVFFIHNWVMSARQSRLEKKLDELKSQLKGHSANS |
| Ga0066662_103807163 | 3300018468 | Grasslands Soil | MRNPFLLGAFALVSVIFFIHNWVMSAGQGKVEKKLDELKAPLKDRL |
| Ga0066669_112395572 | 3300018482 | Grasslands Soil | MNNSRFLFGAFALVTIVFFIHNWAMSSRQRRLEKKLDELKNQLKDRT |
| Ga0187893_108432071 | 3300019487 | Microbial Mat On Rocks | YLFAAFALVTVVFVIHGWLMSSRQTRLEKKLDELKAQMKDKL |
| Ga0210400_108472372 | 3300021170 | Soil | MSNPFLFGAFALVTLVFFIHNWLMSSRQSRLEKKLDELKAQLKDRP |
| Ga0126371_130575491 | 3300021560 | Tropical Forest Soil | MSNPFLFGAFALVSVVFFIHNWIMSARQNRLEKKLDELK |
| Ga0207642_109874111 | 3300025899 | Miscanthus Rhizosphere | MSNQYLFGAFALVALVFFIHNWVLSSRQARLEKRLEQMKSQLKDRF |
| Ga0207646_109909441 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MNSRFLFGAFALVTIVFFIHNWAMSSRQRRLEKKLDDLKNQL |
| Ga0207648_100673476 | 3300026089 | Miscanthus Rhizosphere | MNNRFLFAAFALVTIVFFIHNWAMSSRQRRLERKLEELKDQLKGRELRQ |
| Ga0257147_10223482 | 3300026475 | Soil | MNSQYLFGAFALVALVFFIHNWMMSSREARLEKKLEELKAQLKDQKGL |
| Ga0209624_108161043 | 3300027895 | Forest Soil | MNNNSYLFGAFALVTIVFFIHNWAMSSRQRRLEKKLDELKAQLKDKI |
| Ga0209488_108865532 | 3300027903 | Vadose Zone Soil | MNNNSYLFGAFALVTIVFFIHNWGMSARQRRLEKKLDELKAQLKDR |
| Ga0209382_101309243 | 3300027909 | Populus Rhizosphere | MTNSYLFGAFALVAIVFFIHNWLMSSRQARLEKKLEELKAQVKDR |
| Ga0209382_102276522 | 3300027909 | Populus Rhizosphere | MNNLSYLFGAFALVTLVFFLHSWLMSSRQARLERKLEELKAQIKEREPRI |
| Ga0209382_112707012 | 3300027909 | Populus Rhizosphere | MNNPFLFGAFALVTVVFFIHNWLMSSRQKRLEKKLEELKAQLKDRV |
| Ga0209382_115213432 | 3300027909 | Populus Rhizosphere | MNNLSYLFAAFALVTLVFFIHAWMMSSRQSRLEKKLEELKAQLRDRNAGM |
| Ga0307473_108796131 | 3300031820 | Hardwood Forest Soil | MSNPFLFGAFALVSLVFFIQNWRMSSRQSRLEKKLDELKTQLKDRL |
| Ga0306923_123107182 | 3300031910 | Soil | MSNPFLFGAFALVTLVFFIHNWLMSTRQSRLEKKLDELKAQLKDRV |
| Ga0310912_110273481 | 3300031941 | Soil | MSNPFLFGAFALVTLVFFIHNWLMSTRQSRLEKKLD |
| Ga0306926_114815522 | 3300031954 | Soil | MNSQYLFGAFALVALVFFIHNLMMSSRQAHLEKKLEELKSQLKDRM |
| Ga0310812_105791082 | 3300032421 | Soil | MNSQYLFGAFALVALVFFIHNLLMSSRQARLEKKLEELKSQLKDQGR |
| ⦗Top⦘ |