NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F053148

Metagenome / Metatranscriptome Family F053148

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F053148
Family Type Metagenome / Metatranscriptome
Number of Sequences 141
Average Sequence Length 99 residues
Representative Sequence MEAPHLVKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVAAACQVPRGSVVYLISKGHELYLASQRKDIVP
Number of Associated Samples 125
Number of Associated Scaffolds 141

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 11.35 %
% of genes near scaffold ends (potentially truncated) 26.24 %
% of genes from short scaffolds (< 2000 bps) 67.38 %
Associated GOLD sequencing projects 118
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (88.652 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine
(14.894 % of family members)
Environment Ontology (ENVO) Unclassified
(36.879 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(34.752 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 18.37%    β-sheet: 19.39%    Coil/Unstructured: 62.24%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 141 Family Scaffolds
PF00356LacI 17.73
PF08706D5_N 6.38
PF10108DNA_pol_B_exo2 3.55
PF03237Terminase_6N 2.13
PF03288Pox_D5 0.71
PF01464SLT 0.71

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 141 Family Scaffolds
COG3378DNA primase, phage- or plasmid-associatedMobilome: prophages, transposons [X] 0.71


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.58 %
UnclassifiedrootN/A1.42 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000882|FwDRAFT_10029989All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2662Open in IMG/M
3300000883|EsDRAFT_10304643All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1678Open in IMG/M
3300001213|JGIcombinedJ13530_107663712All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage824Open in IMG/M
3300003277|JGI25908J49247_10019053All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2058Open in IMG/M
3300003499|JGI25930J51415_1010790All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1835Open in IMG/M
3300005527|Ga0068876_10434107All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage729Open in IMG/M
3300005581|Ga0049081_10088431All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1159Open in IMG/M
3300005758|Ga0078117_1001760All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8339Open in IMG/M
3300005805|Ga0079957_1076547All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1909Open in IMG/M
3300005832|Ga0074469_10526825All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage856Open in IMG/M
3300005940|Ga0073913_10081717All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage546Open in IMG/M
3300005941|Ga0070743_10048796All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1445Open in IMG/M
3300005942|Ga0070742_10061162All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1025Open in IMG/M
3300005943|Ga0073926_10045856All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage840Open in IMG/M
3300005955|Ga0073922_1047614All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage544Open in IMG/M
3300006014|Ga0073919_1000919All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3253Open in IMG/M
3300006802|Ga0070749_10034405All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3139Open in IMG/M
3300006802|Ga0070749_10368400All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage796Open in IMG/M
3300006863|Ga0075459_1001114All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4303Open in IMG/M
3300006875|Ga0075473_10005689All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4923Open in IMG/M
3300007169|Ga0102976_1085722All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2787Open in IMG/M
3300007171|Ga0102977_1193438All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2197Open in IMG/M
3300007544|Ga0102861_1003258All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3608Open in IMG/M
3300007544|Ga0102861_1024165All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1522Open in IMG/M
3300007545|Ga0102873_1011833All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2695Open in IMG/M
3300007557|Ga0102821_1078090All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage848Open in IMG/M
3300007590|Ga0102917_1045164All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1548Open in IMG/M
3300007597|Ga0102919_1024397All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1857Open in IMG/M
3300007603|Ga0102921_1287568All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage586Open in IMG/M
3300007632|Ga0102894_1132049All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage660Open in IMG/M
3300007670|Ga0102862_1003217All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3344Open in IMG/M
3300007692|Ga0102823_1160170All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage599Open in IMG/M
3300007734|Ga0104986_1853All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage36910Open in IMG/M
3300007864|Ga0105749_1013015All Organisms → cellular organisms → Bacteria1423Open in IMG/M
3300007973|Ga0105746_1102888All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage939Open in IMG/M
3300007974|Ga0105747_1033101All Organisms → cellular organisms → Bacteria1469Open in IMG/M
3300007974|Ga0105747_1056832All Organisms → cellular organisms → Bacteria1163Open in IMG/M
3300007992|Ga0105748_10262072All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage728Open in IMG/M
3300008055|Ga0108970_10035336All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3196Open in IMG/M
3300008107|Ga0114340_1006701All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6000Open in IMG/M
3300008107|Ga0114340_1193249All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage694Open in IMG/M
3300008110|Ga0114343_1124308All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage859Open in IMG/M
3300008261|Ga0114336_1026298All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3292Open in IMG/M
3300008267|Ga0114364_1068049All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1208Open in IMG/M
3300008450|Ga0114880_1014400All Organisms → cellular organisms → Bacteria3811Open in IMG/M
3300008450|Ga0114880_1088185All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1224Open in IMG/M
3300008996|Ga0102831_1308701All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage523Open in IMG/M
3300009051|Ga0102864_1132283All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage682Open in IMG/M
3300009081|Ga0105098_10020604All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2518Open in IMG/M
3300009085|Ga0105103_10036984All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2440Open in IMG/M
3300009086|Ga0102812_10269622All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage926Open in IMG/M
3300009155|Ga0114968_10035179All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3327Open in IMG/M
3300009158|Ga0114977_10097525All Organisms → cellular organisms → Bacteria1786Open in IMG/M
3300009159|Ga0114978_10069341All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2376Open in IMG/M
3300009161|Ga0114966_10008431All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8368Open in IMG/M
3300009165|Ga0105102_10071922All Organisms → cellular organisms → Bacteria1569Open in IMG/M
3300009168|Ga0105104_10350903All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage816Open in IMG/M
3300010354|Ga0129333_10487610All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1082Open in IMG/M
3300011339|Ga0153700_10425All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage20896Open in IMG/M
3300017747|Ga0181352_1032555All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1569Open in IMG/M
3300017747|Ga0181352_1056329All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1133Open in IMG/M
3300017754|Ga0181344_1149229All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage667Open in IMG/M
3300017766|Ga0181343_1043732All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1330Open in IMG/M
3300017766|Ga0181343_1095019All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage848Open in IMG/M
3300017780|Ga0181346_1262807All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage598Open in IMG/M
3300017785|Ga0181355_1038773All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2044Open in IMG/M
3300018420|Ga0181563_10289429All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage962Open in IMG/M
3300019781|Ga0181360_104050All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1247Open in IMG/M
3300019784|Ga0181359_1046805All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1671Open in IMG/M
3300020172|Ga0211729_11449700All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1052Open in IMG/M
3300020548|Ga0208856_1005733All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2415Open in IMG/M
3300020551|Ga0208360_1027731All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage741Open in IMG/M
3300021961|Ga0222714_10013659All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6721Open in IMG/M
3300021961|Ga0222714_10177819All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1248Open in IMG/M
3300021961|Ga0222714_10410698All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage713Open in IMG/M
3300021962|Ga0222713_10761955Not Available544Open in IMG/M
3300021963|Ga0222712_10168259All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1463Open in IMG/M
3300022190|Ga0181354_1084935All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1041Open in IMG/M
3300022407|Ga0181351_1078522All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1321Open in IMG/M
3300022752|Ga0214917_10001519All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage29683Open in IMG/M
3300024343|Ga0244777_10020061All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4219Open in IMG/M
3300024346|Ga0244775_10141531All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2032Open in IMG/M
3300024346|Ga0244775_10383359All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1157Open in IMG/M
3300024346|Ga0244775_10737787All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage791Open in IMG/M
3300024346|Ga0244775_10882706All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage711Open in IMG/M
3300024348|Ga0244776_10282973All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1140Open in IMG/M
3300024549|Ga0256308_1041669All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage995Open in IMG/M
3300024560|Ga0256306_1022731All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1562Open in IMG/M
3300024563|Ga0255236_1066797All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage830Open in IMG/M
3300024567|Ga0256307_1035144All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1202Open in IMG/M
3300024569|Ga0255243_1023025All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1616Open in IMG/M
3300024856|Ga0256304_1006964All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2345Open in IMG/M
3300025732|Ga0208784_1000496All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage18970Open in IMG/M
3300025753|Ga0255235_1019860All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1014Open in IMG/M
3300026567|Ga0256303_1013268All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1796Open in IMG/M
3300026902|Ga0209851_1013069All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage855Open in IMG/M
3300027126|Ga0255098_1006232All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2364Open in IMG/M
3300027205|Ga0208926_1020056All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1008Open in IMG/M
3300027210|Ga0208802_1008307All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1404Open in IMG/M
3300027214|Ga0208306_1012160All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1632Open in IMG/M
3300027261|Ga0208933_1011169All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1439Open in IMG/M
3300027547|Ga0209864_1016140All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage858Open in IMG/M
3300027597|Ga0255088_1011998All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2188Open in IMG/M
3300027721|Ga0209492_1024722All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2073Open in IMG/M
3300027736|Ga0209190_1000482All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage29092Open in IMG/M
3300027746|Ga0209597_1031223All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2800Open in IMG/M
3300027751|Ga0208304_10008194All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4457Open in IMG/M
3300027757|Ga0208671_10041058All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1727Open in IMG/M
3300027763|Ga0209088_10219387All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage804Open in IMG/M
3300027808|Ga0209354_10246516All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage718Open in IMG/M
3300027972|Ga0209079_10150271All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage798Open in IMG/M
3300029349|Ga0238435_101212All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4997Open in IMG/M
3300031758|Ga0315907_11063414All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage578Open in IMG/M
3300031784|Ga0315899_11266235All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300031787|Ga0315900_10013507All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage9945Open in IMG/M
3300031951|Ga0315904_10005813All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage17029Open in IMG/M
3300031951|Ga0315904_10389387All Organisms → Viruses → Predicted Viral1267Open in IMG/M
3300031951|Ga0315904_11439102Not Available511Open in IMG/M
3300031963|Ga0315901_10260154All Organisms → Viruses → Predicted Viral1461Open in IMG/M
3300032116|Ga0315903_10768928All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage708Open in IMG/M
3300032256|Ga0315271_10572640All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage963Open in IMG/M
3300033482|Ga0316627_102070134All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage592Open in IMG/M
3300033816|Ga0334980_0000113All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage39140Open in IMG/M
3300033978|Ga0334977_0144784All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1235Open in IMG/M
3300033978|Ga0334977_0411169All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage630Open in IMG/M
3300033979|Ga0334978_0034130All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2665Open in IMG/M
3300033979|Ga0334978_0319266All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300033980|Ga0334981_0101538All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1424Open in IMG/M
3300033993|Ga0334994_0113783All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1571Open in IMG/M
3300033995|Ga0335003_0230966All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage867Open in IMG/M
3300034018|Ga0334985_0001752All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage17312Open in IMG/M
3300034061|Ga0334987_0718264All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300034093|Ga0335012_0178283All Organisms → cellular organisms → Bacteria1139Open in IMG/M
3300034104|Ga0335031_0027647All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4143Open in IMG/M
3300034106|Ga0335036_0473797All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage786Open in IMG/M
3300034107|Ga0335037_0356272All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage793Open in IMG/M
3300034118|Ga0335053_0395288All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage840Open in IMG/M
3300034119|Ga0335054_0778629All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300034121|Ga0335058_0564747All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage640Open in IMG/M
3300034200|Ga0335065_0031364All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3745Open in IMG/M
3300034523|Ga0310143_00759All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage14344Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine14.89%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater13.48%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake10.64%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater7.09%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater5.67%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake4.96%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment4.26%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine4.26%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand4.26%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton3.55%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous3.55%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water3.55%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water3.55%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.13%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.13%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.71%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.71%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.71%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.71%
Lake WaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water0.71%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.71%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.71%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.71%
Freshwater And MarineEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine0.71%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.71%
Freshwater And MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Freshwater And Marine0.71%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.71%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.71%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.71%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.71%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.71%
EstuaryHost-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary0.71%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000882Freshwater microbial communities from the Columbia RiverEnvironmentalOpen in IMG/M
3300000883Estuary microbial communities from the Columbia River - 5 PSUEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300003277Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300003499Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DNEnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005758Cyanobacteria communities in tropical freswater systems - freshwater lake in SingaporeEnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300005832Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBBEnvironmentalOpen in IMG/M
3300005940Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14EnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300005943Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14EnvironmentalOpen in IMG/M
3300005955Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14EnvironmentalOpen in IMG/M
3300006014Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_25-Nov-14EnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006863Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007169Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projectsEnvironmentalOpen in IMG/M
3300007171Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projectsEnvironmentalOpen in IMG/M
3300007544Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3EnvironmentalOpen in IMG/M
3300007545Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3EnvironmentalOpen in IMG/M
3300007557Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715EnvironmentalOpen in IMG/M
3300007590Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02EnvironmentalOpen in IMG/M
3300007597Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02EnvironmentalOpen in IMG/M
3300007603Estuarine microbial communities from the Columbia River estuary - metaG 1568-02EnvironmentalOpen in IMG/M
3300007632Estuarine microbial communities from the Columbia River estuary - metaG 1554A-3EnvironmentalOpen in IMG/M
3300007670Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3EnvironmentalOpen in IMG/M
3300007692Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743EnvironmentalOpen in IMG/M
3300007734Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015JanEnvironmentalOpen in IMG/M
3300007864Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0umEnvironmentalOpen in IMG/M
3300007973Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2umEnvironmentalOpen in IMG/M
3300007974Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2umEnvironmentalOpen in IMG/M
3300007992Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2umEnvironmentalOpen in IMG/M
3300008055Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393Host-AssociatedOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008261Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NAEnvironmentalOpen in IMG/M
3300008267Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTREnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300008996Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747EnvironmentalOpen in IMG/M
3300009051Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02EnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009161Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaGEnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300011339Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - HannamEnvironmentalOpen in IMG/M
3300017747Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.NEnvironmentalOpen in IMG/M
3300017754Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.DEnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019781Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM15.S.DEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020548Freshwater microbial communities from Lake Mendota, WI - 13JUL2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020551Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes)EnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300024549Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024560Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024563Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024567Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024569Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024856Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025753Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026567Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026902Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_14-Oct-14 (SPAdes)EnvironmentalOpen in IMG/M
3300027126Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8dEnvironmentalOpen in IMG/M
3300027205Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027210Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027214Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027261Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027547Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 (SPAdes)EnvironmentalOpen in IMG/M
3300027597Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8dEnvironmentalOpen in IMG/M
3300027721Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027736Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027746Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027751Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes)EnvironmentalOpen in IMG/M
3300027757Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes)EnvironmentalOpen in IMG/M
3300027763Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027972Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300029349Freshwater microbial communities from Iron Gate Dam, Klamath Basin, California, USA - IR103EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033816Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005EnvironmentalOpen in IMG/M
3300033978Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002EnvironmentalOpen in IMG/M
3300033979Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003EnvironmentalOpen in IMG/M
3300033980Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007EnvironmentalOpen in IMG/M
3300033993Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037EnvironmentalOpen in IMG/M
3300033995Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056EnvironmentalOpen in IMG/M
3300034018Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034093Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034107Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133EnvironmentalOpen in IMG/M
3300034118Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165EnvironmentalOpen in IMG/M
3300034119Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166EnvironmentalOpen in IMG/M
3300034121Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174EnvironmentalOpen in IMG/M
3300034200Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190EnvironmentalOpen in IMG/M
3300034523Fracking water microbial communities from deep shales in Oklahoma, United States - K-4-AEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FwDRAFT_1002998933300000882Freshwater And MarineMITTNTTKLLMEAPRLIKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVAAACQVPRGSVVYLISKGHELYLASQRKDIEP*
EsDRAFT_1030464323300000883Freshwater And MarineMEAPRLIKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVAAACQVPRGSVVYLISKGHELYLASQRKDIEP*
JGIcombinedJ13530_10766371213300001213WetlandMEAPHLVKIGVQRGWLSYPKDMAFKADGTPDPVIQVEPELTEQRHTPDLARKAYVLRDRGLSLNDVAAACQVPRGSVVYLISKGHELFLASQRKDIVP*
JGI25908J49247_1001905323300003277Freshwater LakeMEAPRLIKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVAAACQVPRGSVVYLITKGHELYLASQRKDIEP*
JGI25930J51415_101079033300003499Freshwater LakeMEAPHLVKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVAAACQVPRGSVVYLISKGHELFLASQRKDIEV*
Ga0068876_1043410723300005527Freshwater LakeMEAPHLVKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVAAACQVPRGSVVYLISKGHELFLASQRKDIEP*
Ga0049081_1008843123300005581Freshwater LenticMEAPHLVKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVAAACQVPRGSVVYLISKGHELFLASQRKDIVP*
Ga0078117_100176023300005758Lake WaterMEAPNLVKIGIERGWLSYPKGMKFHPDGTPDPVMHAVEEVAGERNTPEMARKAYYLRERGLSLNDVAAACQVPRGSVVYLISKGHEMYLAQQREKDIEP*
Ga0079957_107654733300005805LakeMEAPHLVKIGVQRGWLSYPKDMAFKEDGTPAPVIQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVATACQVPRGSVVYLITKGHELYLASQRKDIEP*
Ga0074469_1052682523300005832Sediment (Intertidal)MDAPRLIKIGVQRGWLSYPKDMAFKEDGTPSPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVAAACQVPRGSVVYLITKGHELYLANQRKDIEP*
Ga0073913_1008171713300005940SandVMITTNTTKLLMEAPRLIKIGVQRGWLSYPKDMAFKEDGTPSPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVAAACQVPRGSVVYLISKGHELYLASQRKDIEP*
Ga0070743_1004879613300005941EstuarineVKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVAAACQVPRGSVVYLISKGHEL
Ga0070742_1006116223300005942EstuarineMEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIETEPEVTEQRHTPDMARKAYFLRDRGLSLNEVATACQVPRGSVVYLISKGHELFLASQRKDIVP*
Ga0073926_1004585613300005943SandRHITVMIVTNTTKLLMEAPHLVKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVAAACQVPRGSVVYLISKGHELYLASQRKDIVP*
Ga0073922_104761423300005955SandMEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIETEPEFTEQRHTPEMARKAYDLRDRGLSLNDVATACQVPRGSVVYLISKGHELFLASQRKDIVP*
Ga0073919_100091933300006014SandMMEAPRLIKIGVQRGWLSYPKNMAFKEDGTPAPVMHDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVAAACQVPRGSVVYLITKGHELYLASQRKDIEP*
Ga0070749_1003440543300006802AqueousMIVTNTTKLLMEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIEAFDEVTEQRHTPDLARKAYYLRDRGLSLNEVAAACQVPRGSVVYLISKGHELVLASQRKDIGP*
Ga0070749_1036840023300006802AqueousMITTNTTKLLMDAPRLIKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDLSRKAYDLRDRGLSLNDVAAACQVPRGSVVYLISKGHELYLASQRKDIEP*
Ga0075459_100111423300006863AqueousMEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIEAFDEVTEQRHTPDLARKAYYLRDRGLSLNEVAAACQVPRGSVVYLISKGHELFLVSQRKDIEP*
Ga0075473_1000568953300006875AqueousMEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIEAFDEVTEQRHTPDLARKAYYLRDRGLSLNEVAAACQVPRGSVVYLISKGHELFLASQRKDIEP*
Ga0102976_108572223300007169Freshwater LakeMIVTNTTKLLMEAPNLVKIGIERGWLSYPKGMKFHPDGTPDPVMHAVEEVAGERNTPEMARKAYYLRERGLSLNDVAAACQVPRGSVVYLISKGHEMYLAQQREKDIEP*
Ga0102977_119343833300007171Freshwater LakeMTVTNTTKLLMEAPNLVKIGIERGWLSYPKGMKFHPDGTPDPVMHAVEEVAGERNTPEMARKAYYLRERGLSLNDVAAACQVPRGSVVYLISKGHEMYLAQQREKDIEP*
Ga0102861_100325823300007544EstuarineMEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIETEPEFTEQRHTPDLARKAYFLRDRGLSLNEVAAACQVPRGSVVYLISKGHELYLATQRKDIVP*
Ga0102861_102416523300007544EstuarineMDAPRLIKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVAAACQVPRGSVVYLISKGHELYLASQRKDIEP*
Ga0102873_101183323300007545EstuarineMIVTNTTKLLMEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIETEPEFTEQRHTPDLARKAYFLRDRGLSLNEVAAACQVPRGSVVYLISKGHELFLVSQRKDIVP*
Ga0102821_107809013300007557EstuarineMEAPHLVKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVAAACQVPRGSVVYLISKGHELYLASQRKDIVP*
Ga0102917_104516423300007590EstuarineMIVTNTTKLLMEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIETEPEFTEQRHTPDLARKAYFLRDRGLSLNEVAAACQVPRGSVVYLISKGHELFLASQRKDIVP*
Ga0102919_102439733300007597EstuarineMEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIEAEPEFTEQRHTPDLARKAYFLRDRGLSLNEVAAACQVPRGSVVYLISKGHELFLVSQRKDIVP*
Ga0102921_128756823300007603EstuarineEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIEAEPEFTEQRHTPDLARKAYFLRDRGLSLNEVAAACQVPRGSVVYLISKGHELFLASQRKDIVP*
Ga0102894_113204923300007632EstuarineMEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIETEPEVTEQRHTPDLARKAYFLRDRGLSLNEVAAACQVPRGSVVYLISKGHELFLASQRKDIVP*
Ga0102862_100321723300007670EstuarineMDAPRLIKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVAAACQVPRGSVVYLITKGHELYLASQRKDIEP*
Ga0102823_116017023300007692EstuarineMEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIETEPEVTEQRHTPDMARKAYFLRDRGLSLNEVATACQVPRGSVVYLISKGHELYLASQRKDTVP*
Ga0104986_185323300007734FreshwaterMEAPHLVKIGVQRGWLSYPKDMAFKADGTPDPVIEAEPEFTEQRHTPDLARKAYVLRDRGLSLNDVAAACQVPRGSVVYLISKGHELFLASQRKDIVP*
Ga0105749_101301533300007864Estuary WaterMITTNTTKLLMDAPRLIKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVAAACQVPRGSVVYL
Ga0105746_110288823300007973Estuary WaterMIVTNTTKLLMEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIETEPEFTEQRHTPDLARKAYILRDRGLSLNEVAAACQVPRGSVVYLISKGHELFLASQRKDIVP*
Ga0105747_103310113300007974Estuary WaterMITTNTTKLLMDAPRLIKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVAAACQVPRGSVVYLISKGHELYLASQRKDIEP*
Ga0105747_105683223300007974Estuary WaterMEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIETEPEFTEQRHTPDLARKAYFLRDRGLSLNEVAAACQVPRGSVVYLISKG
Ga0105748_1026207223300007992Estuary WaterMEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIETEPEFTEQRHTPDLARKAYFLRDRGLSLNEVAAACQVPRGSVVYLISKGHELFLVSQRKDIVP*
Ga0108970_1003533633300008055EstuaryMDAPRLIKIGVQRGWLSYPKDMAFKEDGTPAPVMHDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVAAACQVPRGSVVYLITKGHELYLASQRKDIEP*
Ga0114340_100670123300008107Freshwater, PlanktonMEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIETFDEVTEQRHTPDLARKAYYLRDRGLSLNEVAAACQVPRGSVVYLISKGHELFLASQRKDIEP*
Ga0114340_119324923300008107Freshwater, PlanktonMTVTNTTKLLSEAPYLVKIGVQRGWLSYPKDMAFKEDGTPDPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVATACQVPRGSVVYLITKGHELYLASQRKDIEP*
Ga0114343_112430813300008110Freshwater, PlanktonMIVTNTTKLLMEAPHLVKIGMQRGWLSYPKDMAFKADGTPDPVIEAFDEVTEQRHTPDLARKAYYLRDRGLSLNEVAAACQVPRGSVVYLISKGHELFLASQRKDIEP*
Ga0114336_102629843300008261Freshwater, PlanktonMEAPHLVKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVATACQVPRGSVVYLISKGHELFLASQRKDIEP*
Ga0114364_106804923300008267Freshwater, PlanktonMTVTNTTKLLSEAPYLVKIGVQRGWLSYPKDMAFRPDGTPDPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVAVACQVPRGSVVYLITKGHELYLASQRKDIEP*
Ga0114880_101440043300008450Freshwater LakeMEAPRLIKIGVQRGWLSYPKDMAFKEDGTPTPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVAAACQVPRGSVVYLITKGHELYLASQRKDIEP*
Ga0114880_108818523300008450Freshwater LakeMEAPHLVKIGVQRGWLSYPKDMAFKDDGTPAPVMQDEPEFTEQRHTPDMARKAYDLRDRGLSLNDVATACQVPRGSVVYLISKGHELYLASQRKDIVP*
Ga0102831_130870113300008996EstuarineMEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIETEPEFTEQRHTPDLARKAYFLRDRGLSLNEVAAACQVPRGSVVYLISKGHELFLVSQ
Ga0102864_113228323300009051EstuarineMIVTNTTKLLMEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIETEPEFTEQRHTPDLARKAYILRDRGLSLNEVAAACQVPRGSVVYLISKGHELFLASQRKDIVPGTQPRQKPHRWQIHSFQQSNR
Ga0105098_1002060433300009081Freshwater SedimentMEAPHLVKIGVQRGWLSYPKDMAFKDDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVATACQVPRGSVVYLITKGHELYLASQRKDIEP*
Ga0105103_1003698423300009085Freshwater SedimentMEAPHLVKLGVQRGWLSYPKDMAFKDDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVATACQVPRGSVVYLITKGHELYLASQRKDIEP*
Ga0102812_1026962213300009086EstuarineKLLMEAPHLVKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVAAACQVPRGSVVYLISKGHELYLASQRKDIVP*
Ga0114968_1003517933300009155Freshwater LakeMITTNTTKLLMEAPRLIKIGVQRGWLSYPKNMAFKEDGTPAPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVAAACQVPRGSVVYLITKGHELYLASQRKDIEP*
Ga0114977_1009752513300009158Freshwater LakeMITTNTTKLLMEAPRLIKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVAAACQVPRGSVVYLITKGHELYLASQRKDIEP*
Ga0114978_1006934133300009159Freshwater LakeMEAPRLIKIGVQRGWLSYPKDMAFNEDGTPAPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVAAACQVPRGSVVYLITKGHELYLASQRKDIEP*
Ga0114966_10008431113300009161Freshwater LakeMEAPRLIKIGVQRGWLSYPKNMAFKEDGTPAPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVAAACQVPRGSVVYLITKGHELYLASQRKDIEP*
Ga0105102_1007192233300009165Freshwater SedimentMEAPHLVKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVATACQVPRGSVVYLITKGHELYLASQRKDIEP*
Ga0105104_1035090323300009168Freshwater SedimentMEAPHLVKVGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVATACQVPRGSVVYLITKGHELYLASQRKDIEP*
Ga0129333_1048761023300010354Freshwater To Marine Saline GradientMEAPHLVKIGVQRGWLSYPKNMAFKEDGTPDPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVAAACQVPRGSVVYLISKGHELFLASQRKDIEP*
Ga0153700_10425243300011339FreshwaterVKIGVQRGWLSYPKDMAFKEDGTPDPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVATACQVPRGSVVYLITKGHELYLASQRKDIEP*
Ga0181352_103255533300017747Freshwater LakeMITTNTTKLLMEAPRLIKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVAAACQVPRGSVVYLISKGHELYLASQRKDIEP
Ga0181352_105632923300017747Freshwater LakeMTVTNTTKLLSEAPYLVKIGVQRGWLSYPKGMAFKADGTPDPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVATACQVPRGSVVYLITKGHE
Ga0181344_114922923300017754Freshwater LakeMEAPHLVKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVATACQVPRGSVVYLITKGHELYLSSQRKDIEP
Ga0181343_104373223300017766Freshwater LakeVKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVATACQVPRGSVVYLGSKGHELCPASQRKDVVP
Ga0181343_109501913300017766Freshwater LakeRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVATACQVPRGSVVYLITKGHELYLSSQRKDIEP
Ga0181346_126280713300017780Freshwater LakeTTKLLMEAPHLVKVGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVATACQVPRGSVVYLITKGHELYLASQRKDIEP
Ga0181355_103877333300017785Freshwater LakeVKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVATACQVPRGSVVYLISKGHELYLASQRKDIVP
Ga0181563_1028942933300018420Salt MarshMIISNTTKLLMEAPQLVKMGVERGWLSYPQNMAFKEDGTPDPVMQVEPEVTDQRHTPEMARKAYDLRDRGLSLNDVATACQVPRGSVVYLISKGHELYLANQRKDIEP
Ga0181360_10405023300019781Freshwater LakeMEAPRLIKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVAAACQVPRGSVVYLITKGHELYLASQRKDIEP
Ga0181359_104680533300019784Freshwater LakeMEAPHLVKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVAAACQVPRGSVVYLISKGHELFLASQRKDIEV
Ga0211729_1144970023300020172FreshwaterMITTNTTKLLMEAPRLIKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVAAACQVPRGSVVYLITKGHELYLASQRKDIEP
Ga0208856_100573333300020548FreshwaterVKVGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVATACQVPRGSVVYLITKGHELYLSSQRKDIEP
Ga0208360_102773113300020551FreshwaterRHITAMIITNTTKLLMEAPHLVKIGVQRGWMSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVATACQVPRGSVVYLITKGHELYLSSQRKDIEP
Ga0222714_1001365933300021961Estuarine WaterMEAPHLVKIGVQRGWLSYPKDMAFKADGTPDPVIQVEPELTEQRHTPDLARKAYVLRDRGLSLNDVAAACQVPRGSVVYLISKGHELFLASQRKDIVP
Ga0222714_1017781913300021961Estuarine WaterVKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPEMARKAYDLRDRGLSLNDVAAACQVPRGSVVYLISKGHELFLASQRKDIVP
Ga0222714_1041069823300021961Estuarine WaterRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVATACQVPRGSVVYLISKGHELYLASQRKDIVP
Ga0222713_1076195513300021962Estuarine WaterMIVTNTTKLLMEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIETEPEFTEQRHTPEMARKAYDLRDRGLSLNDVAAACQVPRGSVVYLI
Ga0222712_1016825923300021963Estuarine WaterMIVTNTTKLLMEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIETEPEFTEQRHTPEMARKAYDLRDRGLSLNDVATACQVPRGSVVYLISKGHELFLASQRKDIVP
Ga0181354_108493523300022190Freshwater LakeVKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVAAACQVPRGSVVYLISKGHELFLASQRKDIEV
Ga0181351_107852233300022407Freshwater LakeKLSYPKDMAFKNDGTPDPVIQVEPEFTEQRHTPDMARKAYDLRDRGLSLNDVATACQVPRGSVVYLISKGHELFLASQRKDIVP
Ga0214917_10001519153300022752FreshwaterMMEAPQLVKIGVQRGWLSYPEGMAFKKDGTPDPVIQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVAKVCQVPRGSVVYLITKGHELYLANQRKNIEP
Ga0244777_1002006143300024343EstuarineMEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIETEPEFTEQRHTPDLARKAYFLRDRGLSLNEVAAACQVPRGSVVYLISKGHELFLVSQRKDIVP
Ga0244775_1014153123300024346EstuarineMEAPHLVKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVAAACQVPRGSVVYLISKGHELYLASQRKDIVP
Ga0244775_1038335923300024346EstuarineMEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIETEPEVTEQRHTPDMARKAYFLRDRGLSLNEVATACQVPRGSVVYLISKGHELFLASQRKDIVP
Ga0244775_1073778713300024346EstuarineMIVTNTTKLLMEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIETEPEFTEQRHTPDLARKAYFLRDRGLSLNEVAAACQVPRGSVVYLISKGHELFLASQRKDIVP
Ga0244775_1088270623300024346EstuarineMIVTNTTKLLMEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIETFDEVTEQRHTPDLARKAYYLRDRGLSLNEVAAACQVPRGSVVYLISKGHELFLVSQRKDIEP
Ga0244776_1028297333300024348EstuarineMIVTNTTKLLMEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIETEPEFTEQRHTPDLARKAYFLRDRGLSLNEVAAACQVPRGSVVYLISKGHELFLVSQRKDIVP
Ga0256308_104166923300024549FreshwaterKLLMEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIETEPEVTEQRHTPDMARKAYFLRDRGLSLNEVAAACQVPRGSVVYLISKGHELYLATQRKDIVP
Ga0256306_102273133300024560FreshwaterMEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIETEPEVTEQRHTPDMARKAYFLRDRGLSLNEVAAACQVPRGSVVYLISKGHELYLATQRKDIVP
Ga0255236_106679713300024563FreshwaterPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIETEPEVTEQRHTPDMARKAYFLRDRGLSLNEVAAACQVPRGSVVYLISKGHELYLATQRKDIVP
Ga0256307_103514413300024567FreshwaterTTKLLMEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIETEPEVTEQRHTPDMARKAYFLRDRGLSLNEVAAACQVPRGSVVYLISKGHELYLATQRKDIVP
Ga0255243_102302513300024569FreshwaterLLMEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIETEPEVTEQRHTPDMARKAYFLRDRGLSLNEVAAACQVPRGSVVYLISKGHELYLATQRKDIVP
Ga0256304_100696433300024856FreshwaterMIVTNTTKLLMEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIETEPEVTEQRHTPDMARKAYFLRDRGLSLNEVAAACQVPRGSVVYLISKGHELYLATQRKDIVP
Ga0208784_1000496143300025732AqueousMEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIEAFDEVTEQRHTPDLARKAYYLRDRGLSLNEVAAACQVPRGSVVYLISKGHELFLASQRKDIEP
Ga0255235_101986023300025753FreshwaterHLVKIGLQRGWLSYPKDMAFKADGTPDPVIETEPEVTEQRHTPDMARKAYFLRDRGLSLNEVAAACQVPRGSVVYLISKGHELYLATQRKDIVP
Ga0256303_101326813300026567FreshwaterHITVMIVTNTTKLLMEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIETEPEVTEQRHTPDMARKAYFLRDRGLSLNEVAAACQVPRGSVVYLISKGHELYLATQRKDIVP
Ga0209851_101306933300026902SandMIVTNTTKLLMEAPHLVKIGVQRGWLSYPKDMAFKADGTPDPVIETEPEFTEQRHTPDLARKAYFLRDRGLSLNEVAAACQVPRGSVVYLISKGHELFLASQRKDIVP
Ga0255098_100623223300027126FreshwaterMEAPHLVKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVATACQVPRGSVVYLISKGHELYLASQRKDIVP
Ga0208926_102005623300027205EstuarineMDAPRLIKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVAAACQVPRGSVVYLISKGHELYLASQRKDIEP
Ga0208802_100830723300027210EstuarineMDAPRLIKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVAAACQVPRGSVVYLITKGHELYLASQRKDIEP
Ga0208306_101216033300027214EstuarineMITTNTTKLLMDAPRLIKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVAAACQVPRGSVVYLISKGHELYLASQRKDIEP
Ga0208933_101116913300027261EstuarineMIVTNTTKLLMEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIETEPEFTEQRHTPDLARKAYFLRDRGLSLNEVAAACQVPRGSVVYLISKGHELFL
Ga0209864_101614023300027547SandMEAPHLVKIGVQRGWLSYPKDMAFKEDGTPSPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVAAACQVPRGSVVYLISKGHELYLASQRKDIEP
Ga0255088_101199823300027597FreshwaterMIVTNTTKLLMEAPHLVKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVAAACQVPRGSVVYLISKGHELYLASQRKDIVP
Ga0209492_102472223300027721Freshwater SedimentMEAPHLVKIGVQRGWLSYPKDMAFKDDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVATACQVPRGSVVYLITKGHELYLASQRKDIEP
Ga0209190_1000482273300027736Freshwater LakeMEAPRLIKIGVQRGWLSYPKNMAFKEDGTPAPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVAAACQVPRGSVVYLITKGHELYLASQRKDIEP
Ga0209597_103122333300027746Freshwater LakeMITTNTTKLLMDAPRLIKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVAAACQVPRGSVVYLITKGHELYLASQRKDIEP
Ga0208304_1000819433300027751EstuarineMIVTNTTKLLMEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIETEPEVTEQRHTPDMARKAYFLRDRGLSLNEVATACQVPRGSVVYLISKGHELFLASQRKDIVP
Ga0208671_1004105823300027757EstuarineVKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVAAACQVPRGSVVYLISKGHELYLASQRKDIVP
Ga0209088_1021938723300027763Freshwater LakeMEAPRLIKIGVQRGWLSYPKDMAFNEDGTPAPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVAAACQVPRGSVVYLITKGHELYLASQRKDIEP
Ga0209354_1024651623300027808Freshwater LakeMNAPQLVKIGVQRGWLSYPEGMAFKKDGTPDPVMQDEPEVTERRHTPDMARKAYDLRDRGLSLNNVAKVCQVPRGSVVYLINKGHELYLASQRKGIEL
Ga0209079_1015027113300027972Freshwater SedimentHLVKVGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVATACQVPRGSVVYLITKGHELYLASQRKDIEP
Ga0238435_10121243300029349FreshwaterMEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIETEPEFTEQRHTPDLARKAYILRDRGLSLNEVAAACQVPRGSVVYLISKGHELFLASQRKDIVP
Ga0315907_1106341423300031758FreshwaterMEAPHLVKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVAAACQVPRGSVVYLISKGHELYL
Ga0315899_1126623523300031784FreshwaterMTVTNTTKLLSEAPYLVKIGVQRGWLSYPKDMAFKEDGTPDPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVATACQVPRGSVVYLITK
Ga0315900_1001350723300031787FreshwaterVKIGVQRGWLSYPKDMAFKEDGTPDPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVATACQVPRGSVVYLITKGHELYLASQRKDIEP
Ga0315904_1000581373300031951FreshwaterMTVTNTTKLLSEAPYLVKIGVQRGWLSYPKDMAFKEDGTPDPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVATACQVPRGSVVYLITKGHELYLASQRKDIEP
Ga0315904_1038938733300031951FreshwaterLMEAPHLVKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVATACHVPRGSVVYLISKGHELYLASQRKDIVP
Ga0315904_1143910213300031951FreshwaterMEAPHLVKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVAAACQVPRGSVVYLISKGH
Ga0315901_1026015413300031963FreshwaterTKLLMEAPHLVKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVATACHVPRGSVVYLISKGHELYLASQRKDIVP
Ga0315903_1076892823300032116FreshwaterMEAPHLVKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVAAACQVPRGSVVYLISKGHELFLASQRKDIVP
Ga0315271_1057264023300032256SedimentMEAPRLIKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVAAACQVPRGSVVYLISKGHELYLASQRKDIEP
Ga0316627_10207013423300033482SoilMIVTNTTKLLMEAPHLVKIGLQRGWLSYPKDMAFKADGTPDPVIEAFDEVTEQRHTPDLARKAYYLRDRGLSLNEVAAACQVPRGSVVYLISKGHELFLVSQRKDIEP
Ga0334980_0000113_35782_361083300033816FreshwaterMTVTNTTKLLSEAPYLVKIGVQRGWLSYPKGMAFKEDGTPDPVMQDEPEVIEQRHTPDLARKAYDLRDRGLSLNDVATACQVPRGSVVYLITKGHELYLASQRKDIEP
Ga0334977_0144784_595_8913300033978FreshwaterMEAPHLVKVGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVATACQVPRGSVVYLITKGHELYLASQRKDIEP
Ga0334977_0411169_71_3943300033978FreshwaterMITNTTKLLMDAPRLIKIGLQRGWLSYPKSMAFKADGTPDPVMQDESEVTEQRHTPDLARKAYDLRDRGLSLNDVAKACQVPRGSVVYLITKGHELYLASQRKDIEP
Ga0334978_0034130_1598_18943300033979FreshwaterMEAPHLVKIGVQRGWLSYPKNMAFKEDGTPDPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVAAACQVPRGSVVYLISKGHELFLASQRKDIEP
Ga0334978_0319266_3_2813300033979FreshwaterMITNTTKLLMDAPRLIKIGLQRGWLSFPKSMAFKADGTPDPVMQDESEVTEQRHTPDLARKAYDLRDRGLSLNDVAKACQVPRGSVVYLITKG
Ga0334981_0101538_439_7353300033980FreshwaterMEAPHLVKLGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVATACQVPRGSVVYLITKGHELYLASQRKDIEP
Ga0334994_0113783_938_12343300033993FreshwaterMEAPHLVKVGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVATACQVPRGSVVYLITKGHELYLSSQRKDIEP
Ga0335003_0230966_239_5653300033995FreshwaterMITTNTTKLLMEAPRLIKIGVQRGWLSYPKNMAFKEDGTPAPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVAAACQVPRGSVVYLITKGHELYLASQRKDIEP
Ga0334985_0001752_9048_93743300034018FreshwaterMIVTNTTKLLMEAPHLVKIGVQRGWLSYPKDMAFKEDGTPDPVIQVEPEFTEQRHTPDLARKAYILRDRGLSLNDVATACQVPRGSVVYLISKGHELYLASQRKDIEP
Ga0334987_0718264_3_2543300034061FreshwaterMEAPHLVKVGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVATACQVPRGSVVYLITKG
Ga0335012_0178283_849_11393300034093FreshwaterMEAPRLIKIGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVAAACQVPRGSVVYLITKGHELYLASQRKDIE
Ga0335031_0027647_459_7853300034104FreshwaterMTVTNTTKLLSEAPYLVKIGVQRGWLSYPKGMAFKEDGTPDPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVATACQVPRGSVVYLITKGHELYLASQRKDIEP
Ga0335036_0473797_520_7863300034106FreshwaterVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVATACQVPRGSVVYLITKGHELYLASQRKDIEP
Ga0335037_0356272_477_7733300034107FreshwaterMEAPRLIKIGVQRGWLSYHKDMAFKEDGTPAPVMQDEPEVTEQRHTPDLARKAYDLRDRGLSLNDVAAACQVPRGSVVYLITKGHELYLASQRKDIEP
Ga0335053_0395288_2_2953300034118FreshwaterMEAPHLVKIGVQRGWLSYPKDMAFKADGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVATACQVPRGSVVYLITKGHELYLASQRKDIEP
Ga0335054_0778629_242_5053300034119FreshwaterMEAPHLVKVGVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVATACQVPRGSVVYLITKGHELY
Ga0335058_0564747_20_2863300034121FreshwaterVQRGWLSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVATACQVPRGSVVYLISKGHELYLASQRKDIEP
Ga0335065_0031364_1400_16963300034200FreshwaterMEAPHLVKIGVQRGWMSYPKDMAFKEDGTPAPVMQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVATACQVPRGSVVYLISKGHELYLATQRKDIVP
Ga0310143_00759_3486_37823300034523Fracking WaterMEAPHLVKIGVQRGWLSYPKDMAFKEDGTPAPVIQDEPEVTEQRHTPDMARKAYDLRDRGLSLNDVATACQVPRGSVVYLITKGHELYLASQRKDIEP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.