| Basic Information | |
|---|---|
| Family ID | F053034 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 141 |
| Average Sequence Length | 53 residues |
| Representative Sequence | LAEAQGLGLPVVGHPWGDGCSRLLDPPGFFEFAAPAVVDDDGLQEYGLLEV |
| Number of Associated Samples | 78 |
| Number of Associated Scaffolds | 141 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 3.17 % |
| % of genes near scaffold ends (potentially truncated) | 38.30 % |
| % of genes from short scaffolds (< 2000 bps) | 89.36 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.14 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (65.957 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (75.886 % of family members) |
| Environment Ontology (ENVO) | Unclassified (88.652 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (85.106 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 141 Family Scaffolds |
|---|---|---|
| PF03732 | Retrotrans_gag | 4.26 |
| PF13456 | RVT_3 | 0.71 |
| PF13385 | Laminin_G_3 | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 65.96 % |
| All Organisms | root | All Organisms | 34.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005467|Ga0070706_101846987 | Not Available | 549 | Open in IMG/M |
| 3300009092|Ga0105250_10339158 | Not Available | 656 | Open in IMG/M |
| 3300009092|Ga0105250_10491092 | Not Available | 556 | Open in IMG/M |
| 3300009973|Ga0105136_105192 | Not Available | 722 | Open in IMG/M |
| 3300009976|Ga0105128_120070 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 519 | Open in IMG/M |
| 3300009990|Ga0105132_109458 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 802 | Open in IMG/M |
| 3300009990|Ga0105132_114476 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 715 | Open in IMG/M |
| 3300009992|Ga0105120_1010424 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 902 | Open in IMG/M |
| 3300009992|Ga0105120_1052690 | Not Available | 517 | Open in IMG/M |
| 3300009995|Ga0105139_1032486 | Not Available | 849 | Open in IMG/M |
| 3300009995|Ga0105139_1089913 | Not Available | 585 | Open in IMG/M |
| 3300009995|Ga0105139_1122102 | Not Available | 506 | Open in IMG/M |
| 3300010396|Ga0134126_11390454 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 776 | Open in IMG/M |
| 3300010396|Ga0134126_12076774 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 621 | Open in IMG/M |
| 3300010396|Ga0134126_12564765 | Not Available | 554 | Open in IMG/M |
| 3300010399|Ga0134127_12294360 | Not Available | 619 | Open in IMG/M |
| 3300010400|Ga0134122_11281688 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 739 | Open in IMG/M |
| 3300010403|Ga0134123_12407673 | Not Available | 591 | Open in IMG/M |
| 3300014326|Ga0157380_12782524 | Not Available | 556 | Open in IMG/M |
| 3300014968|Ga0157379_11655714 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 626 | Open in IMG/M |
| 3300014968|Ga0157379_12222256 | Not Available | 545 | Open in IMG/M |
| 3300014968|Ga0157379_12235520 | Not Available | 544 | Open in IMG/M |
| 3300015270|Ga0182183_1021942 | Not Available | 787 | Open in IMG/M |
| 3300015270|Ga0182183_1026069 | Not Available | 749 | Open in IMG/M |
| 3300015278|Ga0182099_1025514 | Not Available | 676 | Open in IMG/M |
| 3300015284|Ga0182101_1016804 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 886 | Open in IMG/M |
| 3300015284|Ga0182101_1023384 | Not Available | 806 | Open in IMG/M |
| 3300015290|Ga0182105_1058202 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 627 | Open in IMG/M |
| 3300015290|Ga0182105_1091993 | Not Available | 535 | Open in IMG/M |
| 3300015293|Ga0182103_1019231 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 843 | Open in IMG/M |
| 3300015293|Ga0182103_1087437 | Not Available | 534 | Open in IMG/M |
| 3300015297|Ga0182104_1071826 | Not Available | 607 | Open in IMG/M |
| 3300015297|Ga0182104_1086457 | Not Available | 569 | Open in IMG/M |
| 3300015297|Ga0182104_1113920 | Not Available | 513 | Open in IMG/M |
| 3300015301|Ga0182184_1060658 | Not Available | 600 | Open in IMG/M |
| 3300015306|Ga0182180_1060051 | Not Available | 593 | Open in IMG/M |
| 3300015306|Ga0182180_1064556 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 578 | Open in IMG/M |
| 3300015309|Ga0182098_1104821 | Not Available | 541 | Open in IMG/M |
| 3300015309|Ga0182098_1106833 | Not Available | 537 | Open in IMG/M |
| 3300015309|Ga0182098_1113752 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 525 | Open in IMG/M |
| 3300015310|Ga0182162_1054582 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 690 | Open in IMG/M |
| 3300015310|Ga0182162_1115180 | Not Available | 526 | Open in IMG/M |
| 3300015311|Ga0182182_1047944 | Not Available | 700 | Open in IMG/M |
| 3300015311|Ga0182182_1092950 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 556 | Open in IMG/M |
| 3300015313|Ga0182164_1022668 | Not Available | 948 | Open in IMG/M |
| 3300015313|Ga0182164_1094214 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 583 | Open in IMG/M |
| 3300015315|Ga0182120_1080620 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 622 | Open in IMG/M |
| 3300015316|Ga0182121_1037057 | Not Available | 848 | Open in IMG/M |
| 3300015316|Ga0182121_1065339 | Not Available | 694 | Open in IMG/M |
| 3300015316|Ga0182121_1084760 | Not Available | 628 | Open in IMG/M |
| 3300015316|Ga0182121_1085811 | Not Available | 625 | Open in IMG/M |
| 3300015317|Ga0182136_1123821 | Not Available | 530 | Open in IMG/M |
| 3300015319|Ga0182130_1109091 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 549 | Open in IMG/M |
| 3300015319|Ga0182130_1120358 | Not Available | 529 | Open in IMG/M |
| 3300015324|Ga0182134_1075869 | Not Available | 652 | Open in IMG/M |
| 3300015325|Ga0182148_1061988 | Not Available | 692 | Open in IMG/M |
| 3300015325|Ga0182148_1122561 | Not Available | 539 | Open in IMG/M |
| 3300015326|Ga0182166_1044337 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 772 | Open in IMG/M |
| 3300015326|Ga0182166_1055889 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 714 | Open in IMG/M |
| 3300015327|Ga0182114_1055154 | Not Available | 769 | Open in IMG/M |
| 3300015327|Ga0182114_1106931 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 599 | Open in IMG/M |
| 3300015329|Ga0182135_1046924 | Not Available | 787 | Open in IMG/M |
| 3300015330|Ga0182152_1025332 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 967 | Open in IMG/M |
| 3300015330|Ga0182152_1082300 | Not Available | 646 | Open in IMG/M |
| 3300015331|Ga0182131_1026485 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 954 | Open in IMG/M |
| 3300015332|Ga0182117_1046358 | Not Available | 846 | Open in IMG/M |
| 3300015333|Ga0182147_1118292 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 585 | Open in IMG/M |
| 3300015333|Ga0182147_1169704 | Not Available | 502 | Open in IMG/M |
| 3300015334|Ga0182132_1066245 | Not Available | 735 | Open in IMG/M |
| 3300015334|Ga0182132_1092643 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 646 | Open in IMG/M |
| 3300015334|Ga0182132_1124363 | Not Available | 574 | Open in IMG/M |
| 3300015334|Ga0182132_1165036 | Not Available | 508 | Open in IMG/M |
| 3300015335|Ga0182116_1139993 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 562 | Open in IMG/M |
| 3300015336|Ga0182150_1088158 | Not Available | 648 | Open in IMG/M |
| 3300015336|Ga0182150_1095064 | Not Available | 630 | Open in IMG/M |
| 3300015336|Ga0182150_1149469 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 526 | Open in IMG/M |
| 3300015337|Ga0182151_1031078 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 931 | Open in IMG/M |
| 3300015337|Ga0182151_1034497 | Not Available | 900 | Open in IMG/M |
| 3300015337|Ga0182151_1147509 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 529 | Open in IMG/M |
| 3300015338|Ga0182137_1076529 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 719 | Open in IMG/M |
| 3300015338|Ga0182137_1126927 | Not Available | 585 | Open in IMG/M |
| 3300015338|Ga0182137_1132925 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 573 | Open in IMG/M |
| 3300015338|Ga0182137_1135876 | Not Available | 567 | Open in IMG/M |
| 3300015339|Ga0182149_1158818 | Not Available | 523 | Open in IMG/M |
| 3300015340|Ga0182133_1173497 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 526 | Open in IMG/M |
| 3300015340|Ga0182133_1182089 | Not Available | 514 | Open in IMG/M |
| 3300015348|Ga0182115_1214576 | Not Available | 616 | Open in IMG/M |
| 3300015348|Ga0182115_1216837 | Not Available | 612 | Open in IMG/M |
| 3300015348|Ga0182115_1254380 | Not Available | 558 | Open in IMG/M |
| 3300015348|Ga0182115_1295766 | Not Available | 511 | Open in IMG/M |
| 3300015349|Ga0182185_1145705 | Not Available | 703 | Open in IMG/M |
| 3300015349|Ga0182185_1222480 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 573 | Open in IMG/M |
| 3300015352|Ga0182169_1044549 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 1310 | Open in IMG/M |
| 3300015352|Ga0182169_1096031 | Not Available | 945 | Open in IMG/M |
| 3300015352|Ga0182169_1121965 | Not Available | 843 | Open in IMG/M |
| 3300015352|Ga0182169_1296016 | Not Available | 522 | Open in IMG/M |
| 3300015353|Ga0182179_1144346 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 739 | Open in IMG/M |
| 3300015353|Ga0182179_1292247 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 529 | Open in IMG/M |
| 3300017408|Ga0182197_1149051 | Not Available | 506 | Open in IMG/M |
| 3300017412|Ga0182199_1066648 | Not Available | 772 | Open in IMG/M |
| 3300017412|Ga0182199_1113814 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 634 | Open in IMG/M |
| 3300017414|Ga0182195_1056123 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 852 | Open in IMG/M |
| 3300017414|Ga0182195_1094538 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 706 | Open in IMG/M |
| 3300017414|Ga0182195_1139071 | Not Available | 609 | Open in IMG/M |
| 3300017414|Ga0182195_1182281 | Not Available | 545 | Open in IMG/M |
| 3300017421|Ga0182213_1173801 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 610 | Open in IMG/M |
| 3300017422|Ga0182201_1076788 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 627 | Open in IMG/M |
| 3300017432|Ga0182196_1143758 | Not Available | 518 | Open in IMG/M |
| 3300017439|Ga0182200_1029093 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 903 | Open in IMG/M |
| 3300017440|Ga0182214_1157435 | Not Available | 507 | Open in IMG/M |
| 3300017445|Ga0182198_1017140 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 1198 | Open in IMG/M |
| 3300017446|Ga0182217_1072992 | Not Available | 800 | Open in IMG/M |
| 3300017447|Ga0182215_1132572 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 569 | Open in IMG/M |
| 3300017693|Ga0182216_1187042 | Not Available | 541 | Open in IMG/M |
| 3300026035|Ga0207703_11347028 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 686 | Open in IMG/M |
| 3300028054|Ga0268306_1034482 | Not Available | 506 | Open in IMG/M |
| 3300028064|Ga0268340_1076178 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 528 | Open in IMG/M |
| 3300028143|Ga0268348_1016727 | Not Available | 579 | Open in IMG/M |
| 3300028154|Ga0268341_1017481 | Not Available | 608 | Open in IMG/M |
| 3300028248|Ga0268312_1020538 | Not Available | 616 | Open in IMG/M |
| 3300028476|Ga0268329_1026602 | Not Available | 521 | Open in IMG/M |
| 3300028526|Ga0268339_1004347 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 779 | Open in IMG/M |
| 3300032490|Ga0214495_1053206 | Not Available | 944 | Open in IMG/M |
| 3300032490|Ga0214495_1084329 | Not Available | 738 | Open in IMG/M |
| 3300032502|Ga0214490_1110806 | Not Available | 626 | Open in IMG/M |
| 3300032758|Ga0314746_1012098 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1696 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 75.89% |
| Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 7.09% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 5.67% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009973 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaG | Host-Associated | Open in IMG/M |
| 3300009976 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG | Host-Associated | Open in IMG/M |
| 3300009990 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG | Host-Associated | Open in IMG/M |
| 3300009992 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG | Host-Associated | Open in IMG/M |
| 3300009995 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015270 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015278 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015306 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015316 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017408 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017421 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017446 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017447 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017694 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028049 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028054 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028064 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028143 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028154 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028248 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028476 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028526 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300032469 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032490 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032502 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032758 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070706_1018469871 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LAEAKGLGLSVVGHPWVDGCLQLPDPPGFFDFAAPTVIGDDGLQEYNLLEV* |
| Ga0105250_103391581 | 3300009092 | Switchgrass Rhizosphere | LDEAQGLGLLVVGHPWGDGCSRLLDPLDFFDFAAPAVVDDDGLQEYGLLEV* |
| Ga0105250_104910922 | 3300009092 | Switchgrass Rhizosphere | LAEAQELGLLVVGHPWVDGCLQLSDPPSFFDFVAAAVVGDDGLQEYDLLEV* |
| Ga0105136_1051922 | 3300009973 | Switchgrass Associated | LAEAQGLGLPVVGHHWVDECLQLPDPPGLFGFATPTVIDDDGLQEYDLLEV* |
| Ga0105128_1200701 | 3300009976 | Switchgrass Associated | LLVVGHPWVDGYLQLPDPFDFFDFAAPAVVDDGGLREFGLPEV* |
| Ga0105132_1094582 | 3300009990 | Switchgrass Associated | LAEAQGLGLPAVGHPWGDGCSRLLDPLDFFEFAAPAVVVDGDLQEYGLPKV* |
| Ga0105132_1144761 | 3300009990 | Switchgrass Associated | LAEAQGLGLLAVVHPWGDGCSRLHDPLDFFDFAAVAVVGDDVLREYGLLEV* |
| Ga0105120_10104241 | 3300009992 | Switchgrass Associated | LVEAQELGLPVAGHPWGDESLRLPGPPGFFDFAAPAVVDDDGLQEYDLLEV* |
| Ga0105120_10526902 | 3300009992 | Switchgrass Associated | VVPAVVCCCCDLAEAQGLGLPVVGHPWVDECLQLPDPPGFFGFAAPTIVDDDGL* |
| Ga0105139_10324863 | 3300009995 | Switchgrass Associated | LAEAQGLGLPVVGHPWGDGCSRLPDPLDSFGFAAPAVVDDCGLWEYDLPEV* |
| Ga0105139_10731412 | 3300009995 | Switchgrass Associated | MRPLWNWLPLPYCSRGCCCDLAEAQELGLLVVGHPWVDGCLQLSDPPSFFDFVAAAVVGDDGL* |
| Ga0105139_10899131 | 3300009995 | Switchgrass Associated | LAEAQGPGLPTVGHPWGDGCSRHLDPLDFFEFVAPVVVVDGDLKEYGLPEV* |
| Ga0105139_11221022 | 3300009995 | Switchgrass Associated | RGCCDLAEAQELGLPLVGHPWVDGWLRLPDPPGFFDFAAAAVVRDDGLQEYDLLEV* |
| Ga0134126_113904541 | 3300010396 | Terrestrial Soil | LVEAQELGLPVASHPWGDESLRLPVPLGFFDFADLAVV |
| Ga0134126_114599462 | 3300010396 | Terrestrial Soil | VRPLWNQLLPPGFGRDCCCGLVEAQELGLPVASHPWGDESLRLPVPLGFFDFAAPAIVVDDGLRGCDLLEV* |
| Ga0134126_120767741 | 3300010396 | Terrestrial Soil | LVGAQELCLPVVGHPWGDGCLRLLDPLDFFDFAAPAIVDDDGLQEYGLLEV* |
| Ga0134126_125647652 | 3300010396 | Terrestrial Soil | LAKAQGLGLPVVGHHWVDECLQLPDPPGFFGFAAPTIVDDDGL* |
| Ga0134127_122943601 | 3300010399 | Terrestrial Soil | DSVEAQELDLLEVGQPWGNGCLRLLDPLDFSSFAALAVVVSDNLRGYSLLEV* |
| Ga0134122_112816882 | 3300010400 | Terrestrial Soil | LAEAQELGLQVVGHPWGDGCSQLLDPLDFFGFAAPAVVDAGGLRWYGLPEV* |
| Ga0134123_124076732 | 3300010403 | Terrestrial Soil | LEVVGHPWGDGYSQPLDPLGFFGSATPAAVGAGGLRECGLPEVLLS* |
| Ga0157380_127825242 | 3300014326 | Switchgrass Rhizosphere | LAEAQGLGLLVVGRPWGDGCSRLSDPLDFFDFAAPAVVDDGGLREFGLPEV* |
| Ga0157379_116557142 | 3300014968 | Switchgrass Rhizosphere | LAEAQGLGLLVVGRPWGDGCSRLLDPLDFFGFAAPVVVDAGDLQGYGFLEVRLLQ* |
| Ga0157379_122222562 | 3300014968 | Switchgrass Rhizosphere | LAEAQELGLPVVGHPWVDGYLQLPDPPGFFDFAAPTVVGDDGLQECDLLEV* |
| Ga0157379_122355202 | 3300014968 | Switchgrass Rhizosphere | LAEAQELGLLAVGHHWGDDCSQLPNPLDFFDFAAPAVVDAGGLRGYGLPEV* |
| Ga0182183_10219422 | 3300015270 | Switchgrass Phyllosphere | CCCCGSAEAQELSLVVVGHPWGVGCLRLFDPLGFFGFAAPAVVDDDGLWGYDLLGV* |
| Ga0182183_10260693 | 3300015270 | Switchgrass Phyllosphere | LPVAGHPWVDGCLRLPDPPGSFDFATSAVVGDGGLWEYGLLEV* |
| Ga0182099_10255141 | 3300015278 | Switchgrass Phyllosphere | SFCCCDLAEAQGLGLLVVGHPWVDGCLRLPDPPGSFDFDAPAVVGDGGLWEYGLLEV* |
| Ga0182101_10168042 | 3300015284 | Switchgrass Phyllosphere | LAEAQGPGLLAVGHPWGDGCSRLLDPLDFFEFVAPAVVVDGDLQEYGLPEV* |
| Ga0182101_10233842 | 3300015284 | Switchgrass Phyllosphere | LAEAQGLGLPVVGHPWVDECLQLPDRPGFFGFAAPTVVGDDGLQECDLLEV* |
| Ga0182105_10582022 | 3300015290 | Switchgrass Phyllosphere | LAEAQELGLPVVGHPWVDGYLQLPDPLDFFDFAALAIVDDGGLREFGLPEV* |
| Ga0182105_10919932 | 3300015290 | Switchgrass Phyllosphere | LAEAQELGLPVVGHPWVDGYLQLPDPPGFFDFATPTVVGDDGLQECDLLEV* |
| Ga0182103_10192312 | 3300015293 | Switchgrass Phyllosphere | MAEAQGLGLLVVGHPWGDGCSRLLDPLDFFGFAAPVVVDAGGLRGYGLPKV* |
| Ga0182103_10874371 | 3300015293 | Switchgrass Phyllosphere | GCCCGLAEAQELGLLVVGHPWGDDYSQLPGLPDSFAFAIPAVVDDCGLREYGSPEV* |
| Ga0182104_10718262 | 3300015297 | Switchgrass Phyllosphere | LAKAQGLGLPVVGHHWVDECLQLPDPPGFFDFAAAAVVRDDGLQEYDLLEV* |
| Ga0182104_10864572 | 3300015297 | Switchgrass Phyllosphere | LAEAQGLGLPAVGHPWGDGCSRLLDPLDFFEFAAPAVVVDGDHQEYGLPEV* |
| Ga0182104_11139202 | 3300015297 | Switchgrass Phyllosphere | GSCCGLAEAQELGLLVVGHLWGDDDSQLPGLPDSFAFAIPAVVDDCGLREYGSPEV* |
| Ga0182184_10606582 | 3300015301 | Switchgrass Phyllosphere | AQGLGLPVVGHPWGDGCSRLPDPLDSFGFAAPAVVDDCGLREYDLPEV* |
| Ga0182180_10600511 | 3300015306 | Switchgrass Phyllosphere | GCCCSLAEAQGLGLLVVGHPWGDGCSRPLDLLCFFGFAAPVVVDAGGLRGYGLLEV* |
| Ga0182180_10645561 | 3300015306 | Switchgrass Phyllosphere | LAEAQELGLLAVGHPWGDDCSQLPNPLDFFGFAAPAVVDAGGLRGYGLPEV* |
| Ga0182098_11048212 | 3300015309 | Switchgrass Phyllosphere | LVEAQELSLLVVGHPWGDDCSQLPGLLDSFGFAAPAVVDDCGLREYGSPEV* |
| Ga0182098_11068331 | 3300015309 | Switchgrass Phyllosphere | LAEAQELGLPVVGHPWVDGYLQLPGPLDFFDFAAPFVVDDGGLREFGLPEI* |
| Ga0182098_11137521 | 3300015309 | Switchgrass Phyllosphere | LVGAQELGLPAVGHPWGDDCSQLPDPLDFFEFAAPAVVDDGGLREYGFPEV* |
| Ga0182162_10545822 | 3300015310 | Switchgrass Phyllosphere | LAEAQGLGLSAVGHPWVDEYLQLPDPPGFFGFAAPTVVDDYGLQECDLLEV* |
| Ga0182162_11151801 | 3300015310 | Switchgrass Phyllosphere | LAEAKELDLPVVGHPWGDGYLRLLDSLGFFDFDAPAVVVGDVLWGYDLLEV* |
| Ga0182182_10479441 | 3300015311 | Switchgrass Phyllosphere | PPYFTRGCCCCDLAEAHGLGLLVVGHLWVDGCLQLSDPPGSFDFAAPANIGDGGLPEYGLLEV* |
| Ga0182182_10929502 | 3300015311 | Switchgrass Phyllosphere | LVEAQELGLLVAGHSWGDESLRLSDPPGFFDFADLAVVVDDGLQEYGLLEV* |
| Ga0182164_10226682 | 3300015313 | Switchgrass Phyllosphere | GLAEAQGLGLLVVGHPWGDGCLRPPDLHGFSGFAAPVVVNAGGLRGYGLLVARLLQ* |
| Ga0182164_10942142 | 3300015313 | Switchgrass Phyllosphere | LAEAQGLGLLVVGHPWGDGCSRLPDPLDSFGFAAPAVVDDCGLWEYDLPEV* |
| Ga0182120_10806201 | 3300015315 | Switchgrass Phyllosphere | LAGAQELGLPVVGHPWVDGYLQLPDPPGFFDFAAPTVVGDDGLQEYDLLEV* |
| Ga0182121_10370571 | 3300015316 | Switchgrass Phyllosphere | SCCCDLVEAQGLGLPVAGHPWGDESLRLHGPPSSFDFADLAVVDDGGLREFGLPEI* |
| Ga0182121_10653392 | 3300015316 | Switchgrass Phyllosphere | PLPYCSRGCCCDLAEAQELGLLVVGHPWVDGCLQLSDPPSFFDFVAAAVVGDDGLQEYDLLEV* |
| Ga0182121_10847602 | 3300015316 | Switchgrass Phyllosphere | LAEAQELGLPVVGHPWVDGYLQLPDPLDFFDFAAPAVVDDGGLREFGLPEV* |
| Ga0182121_10858111 | 3300015316 | Switchgrass Phyllosphere | ELGLLVVGHPWDGDYSQLPGLPDSFSFAAPAVVDDYGLREYGSPEV* |
| Ga0182136_11238211 | 3300015317 | Switchgrass Phyllosphere | GCCCGLVEAQGLGLLEVGLPWGDGCLQLPDPPGFFDFAAPAVVDDDGLQEYDWLGV* |
| Ga0182130_11090911 | 3300015319 | Switchgrass Phyllosphere | LAEGLGLGLPVVGHPWGDGCSRLPDPLDFFDFADPAVVDNDGLRECGLLEVLLLQWLSTGCH |
| Ga0182130_11203581 | 3300015319 | Switchgrass Phyllosphere | LAKAQELGLLAVGHPWGDDYSQLPDPLDFFGFAAPVVVDAGGFRGYGLPEV* |
| Ga0182165_11106082 | 3300015320 | Switchgrass Phyllosphere | VRPLWNQQLLPCCARGYYCGLVEAQELGLPVAGHPWGYESLRLPGPLGFFDFVALAAVVGDGLRGYGLLEV* |
| Ga0182134_10758692 | 3300015324 | Switchgrass Phyllosphere | CCNLAEAQGLGLLVVGHPWGDGCSRLLDPLGFFGFVAPIVVDAGGLRGYGLPEV* |
| Ga0182148_10619881 | 3300015325 | Switchgrass Phyllosphere | LVEVQELGLPVVGHPWGNGCLRLLGPSGFFDFVAPAVVDDDGLQEYDL |
| Ga0182148_11225612 | 3300015325 | Switchgrass Phyllosphere | LAEAQGPGLPTVGHPWGDGCSRHLDPLDFFEFVAPVVVVDGDLQEYGLPEV* |
| Ga0182166_10443372 | 3300015326 | Switchgrass Phyllosphere | LAEAQELGLLVVGHPWVDGYLQLPDPPGFFDFAAPTVVGDDGLQECDLLEV* |
| Ga0182166_10558891 | 3300015326 | Switchgrass Phyllosphere | LAEAQELGLLAVGHPWGDDCSQLPDPLDFFGFAAPVVVDAGGLRGYGLPEV* |
| Ga0182114_10551542 | 3300015327 | Switchgrass Phyllosphere | VRGYCCCSLAEAQGLGLPVVGHPWGDGCLQLPDLPDSFDFAAPAVVDDYGLGEYGLPEV* |
| Ga0182114_10834062 | 3300015327 | Switchgrass Phyllosphere | ELGLLVVGHPWGDGCLQLPDPLGFFGFATPAVANSDDIRGYNLLEV* |
| Ga0182114_11069311 | 3300015327 | Switchgrass Phyllosphere | LAEAQGFGLPVVGHPWVDECLQLPDPPGLFGFATPTVVDDDGL* |
| Ga0182135_10469242 | 3300015329 | Switchgrass Phyllosphere | LAEAQGLGLLVVGHPWGDGCSRLHDFLDFFGFAAPVVVDEGGLQGYGFLEVRLLQ* |
| Ga0182152_10253322 | 3300015330 | Switchgrass Phyllosphere | LAEAQGPGLPAVGHPWGDGCSRLLDPLDFFEFVAPAVVVDGDLQEYGLPEV* |
| Ga0182152_10823001 | 3300015330 | Switchgrass Phyllosphere | SCCNLAEAQGLGSLVVGHPWVDGCLRLPEPTGFFDFATPAVVDDDGLQEYDLLEV* |
| Ga0182131_10264851 | 3300015331 | Switchgrass Phyllosphere | LAKAQELGLPVDGHPWGDESLRFPGLLGSFDFADLAVVDDDGLQEYGLLVV* |
| Ga0182117_10463582 | 3300015332 | Switchgrass Phyllosphere | EVQELGLLVVDHPWGDGCLRLLNPLDFFDFGAPAVVDDDGLQEYGLLEV* |
| Ga0182147_11182922 | 3300015333 | Switchgrass Phyllosphere | VVGHPWGNDCSQLPGLLDSFGFAAPVVVDDCGLREYGSPEV* |
| Ga0182147_11697041 | 3300015333 | Switchgrass Phyllosphere | SDLVEAQGLGLPVVGHPWGDESLRLHGPPSSFDFADLAVVDDDGLQEYGLLEV* |
| Ga0182132_10662454 | 3300015334 | Switchgrass Phyllosphere | CCCGLAEAQELGLLAVGHPWGDDCSQLPDPLDFFGFDAPAVVDAGGLWGYGLPEV* |
| Ga0182132_10926431 | 3300015334 | Switchgrass Phyllosphere | LVEAQGLGLPVVGHPWGDGCSRLPDPLDFFEFVAPAVVVDGDLQEYGLPEV* |
| Ga0182132_11243632 | 3300015334 | Switchgrass Phyllosphere | LAEAQELGLLVVGHPWVDGYLQLPDPPGFFNFAAPTVVGDDGL* |
| Ga0182132_11650361 | 3300015334 | Switchgrass Phyllosphere | AEAQGFGLPVVGHPWVDECLRLPDPPGFFDFAAPTVVGDDGLQEYDLLEV* |
| Ga0182116_11399931 | 3300015335 | Switchgrass Phyllosphere | LAEAQGLGLPVVGHPWVDECLRFPDPPGFFDFAAPAIVEDDGLQEYDLLEV* |
| Ga0182150_10881582 | 3300015336 | Switchgrass Phyllosphere | QELGLLVVDHPWVDECLQLLGFFGFAAPTVVDDDGLRGYDLLEV* |
| Ga0182150_10950642 | 3300015336 | Switchgrass Phyllosphere | LAEAQELGLLAVGHPWGDDYSQLPDPLDFFGFATPAVVDADGLRGYGLPEV* |
| Ga0182150_11494692 | 3300015336 | Switchgrass Phyllosphere | LAEAQELGLPVVGHPWVDGYLQLPDPLDFFDFAAPTIVDDGGLQEFGLPEV* |
| Ga0182150_11574621 | 3300015336 | Switchgrass Phyllosphere | PVRPLWNRLPLPYCSRGCCCDLAKAQELGLVVVGHPWVDGCLRLPDPPSFFDFAAAAVVGDDGLQEYDLLEV* |
| Ga0182151_10310782 | 3300015337 | Switchgrass Phyllosphere | LAEAQELGLPVVGHPWVDGYLQLPDPPGFFDFAAPTVVGDDGLQEYDLLEV* |
| Ga0182151_10344972 | 3300015337 | Switchgrass Phyllosphere | LAEAQEPGLPAVGHPWSDGCSWLLDPLDFFEFVAPAVVVNGDLQEYGLPEV* |
| Ga0182151_11475091 | 3300015337 | Switchgrass Phyllosphere | LVEAQELGLPVVGHPWVDGCLRLPYPSGFFDFAAVPIVVDDDLQEYDLLEV* |
| Ga0182137_10765292 | 3300015338 | Switchgrass Phyllosphere | LAEAQGLGLPVVGHPWGDGCLRLLDPLDFFDFAAPAAGDNDGL* |
| Ga0182137_11269272 | 3300015338 | Switchgrass Phyllosphere | DLVEAQELGLPVASHPWGDESLRFPSPLGYFDFADLAVVDDDGLQEYGLLVV* |
| Ga0182137_11329251 | 3300015338 | Switchgrass Phyllosphere | LAEGQELELLVVGHLWGDDYSQLPDPLDFFEFVAPVVVVDGDLKEYGLPEV* |
| Ga0182137_11358761 | 3300015338 | Switchgrass Phyllosphere | LAEVQGLGLPMVGHPWGDGCSRLLDPLDFFGFTAPVVVDAGGLRGHDLHEV* |
| Ga0182149_11588182 | 3300015339 | Switchgrass Phyllosphere | LVEARELGLPVVGHPWGDGSLRLPDPLSFFDFVALAVVVGDGLWVYGLLEV* |
| Ga0182133_11734972 | 3300015340 | Switchgrass Phyllosphere | LADAQELGLPVVGHPWVDGYLQLPDPLDFFDFAALAIVDDGGLRDFG |
| Ga0182133_11820891 | 3300015340 | Switchgrass Phyllosphere | QGFDLLVVGHPWGDGCSRLLDPLDFFGFAAPAAVDAGGHQGYGLPE* |
| Ga0182115_12145762 | 3300015348 | Switchgrass Phyllosphere | YCCCGLAEAQGLGLPVVGHPWGDGCSRLPDPLDSFGFAAPAVVDDCGLREYDLPEV* |
| Ga0182115_12168372 | 3300015348 | Switchgrass Phyllosphere | LAEAQGFGLPVVGHPWVDECLQLPDPPGLFGFTAPTVVDDDGL* |
| Ga0182115_12543801 | 3300015348 | Switchgrass Phyllosphere | CGSVEAQELDLLLVGHPWGDGCLRLLDFYGFATQAVVDGDDLWGCGLLEV* |
| Ga0182115_12957662 | 3300015348 | Switchgrass Phyllosphere | LAEVQELGLLVVGHPYGDDCSQPPDLLDFFGFAAPAVVDDCGLQECDLPEV* |
| Ga0182185_11457052 | 3300015349 | Switchgrass Phyllosphere | RGCCCCDLAEAQELGLPVVGHPWVDGYLQLPDPLDFFDFATPAVVDNGGLREFGLPEV* |
| Ga0182185_12224802 | 3300015349 | Switchgrass Phyllosphere | LVEAQELGLLVAGHSWGDESLRLSDPPGFFDFAEIAVVVDDGLQEYGLLDV* |
| Ga0182169_10445492 | 3300015352 | Switchgrass Phyllosphere | LVEAQELGLLVVGHPWGDGCLRLLDPLDLFGFGALAVADDDDLQGVRLA* |
| Ga0182169_10960312 | 3300015352 | Switchgrass Phyllosphere | LAEAQGLGLPVVGHPWGDGCSRLLDPPGFFEFAAPAVVDDDGLQEYGLLEV* |
| Ga0182169_11219652 | 3300015352 | Switchgrass Phyllosphere | GCCCDAAEAQWLVLLVVGHPWGGGCSQPLDLLDFFGFAAHVVVGAGGL* |
| Ga0182169_12960161 | 3300015352 | Switchgrass Phyllosphere | VVSHPWVDGYLQLPDPPGFFDFAAPTVVGDDGPQEYDLLEV* |
| Ga0182179_11443462 | 3300015353 | Switchgrass Phyllosphere | LVEAQELGLLVAGHSWGDESLRLSDPPGFFDFADLAVVVDDGLQ |
| Ga0182179_12151872 | 3300015353 | Switchgrass Phyllosphere | ARGCCCDLVEVQELGLPVASHPWGDESLRLPGLSGSFDFADLAVDDDDGLQEYDLLEV* |
| Ga0182179_12922471 | 3300015353 | Switchgrass Phyllosphere | LVEAQELGLPVASHPWGDESLRLPVPLGFFDFADLAVVDDDGL* |
| Ga0182167_12591092 | 3300015354 | Switchgrass Phyllosphere | MRPRWNQLPLPCCARGCCCGSAEAQGFGLPVAGHPWVDGCLRLPDPPGSFDFATSAVVGDGGLWEYGLLEV* |
| Ga0182197_11490511 | 3300017408 | Switchgrass Phyllosphere | VEAQELGLLVVDHPWGDGCLRLLDPLDFFDFGAPAIVDDDGLQEYGLLEV |
| Ga0182199_10666481 | 3300017412 | Switchgrass Phyllosphere | PPCYARGCCCCDLAKAQGLGLQAVGHPCGDGCSRLPDPLDFFDFAAPTIVDDGGLQENGLPEV |
| Ga0182199_11138142 | 3300017412 | Switchgrass Phyllosphere | LAEAQELGLPVVGHPWVDGYLQLPGPLDFFDFAAPFVVDDGGLREFGLPEI |
| Ga0182195_10561233 | 3300017414 | Switchgrass Phyllosphere | LAEAQGLGLLVVGHPWGDGCSRPLDSLGFFGFAAPIVVDEGGLQGYGFLEVRLLQ |
| Ga0182195_10945382 | 3300017414 | Switchgrass Phyllosphere | LAEAQGLGLLVVGRPWGDGCSRLLDPLDFFGFAAPVVVDAGGLRGYGLPEV |
| Ga0182195_11390712 | 3300017414 | Switchgrass Phyllosphere | PLWSRLLPSCCARGCCSDLVEVQELGLSVAGHPWGYESLRLPGPLSFFDFVALAAVVGDGLRGYGLLEV |
| Ga0182195_11822811 | 3300017414 | Switchgrass Phyllosphere | LAEVQGVGLPVVGQPWVDECLQLPDRPGFFGFAAPTVVDDDGLYEYNLLEV |
| Ga0182213_11351932 | 3300017421 | Switchgrass Phyllosphere | VRPIWNRLPLPCYAHGCCCCDLVEAQELGLPVVGHPWVDGCLRLPDPPGFFDFAAAAVVGDDGLQEYDLVEV |
| Ga0182213_11738011 | 3300017421 | Switchgrass Phyllosphere | LAKAQELGLPVDGHPWVDDCLRLPDPPGFFDFAAAAVVRDDGLQEYDLLEV |
| Ga0182201_10767882 | 3300017422 | Switchgrass Phyllosphere | LAEAQELGLLAVGHPWGDDCSQLPDPLDFFGFAAPAVVDADGLRGYSLPEV |
| Ga0182196_11437581 | 3300017432 | Switchgrass Phyllosphere | LAEAQELGLPVVGHPWVDGYLQLPDPLDFFDFAAPTIVDDGGLQEFGLPEV |
| Ga0182200_10290933 | 3300017439 | Switchgrass Phyllosphere | VEAQELDLLEVGQPWGNGCLRLLDPLDFSSFAALAVVVSDNLRGYGLLEV |
| Ga0182214_11574351 | 3300017440 | Switchgrass Phyllosphere | AQELGLLVADHPWGDECLQLPDPLGFFGFAAPAVVDDDAVRGYDLLEV |
| Ga0182198_10171403 | 3300017445 | Switchgrass Phyllosphere | LAEAQGLGLLVVGHPWGDGYSRLLDPLDFFGFAAPVVVDASGLWGCGLPEV |
| Ga0182198_11786081 | 3300017445 | Switchgrass Phyllosphere | LLPCCARGLALMMFCKLGLPVAGHPWGSGSLRLPGPPGSFNFVDLAVVDDDGLQEYGLLE |
| Ga0182217_10729922 | 3300017446 | Switchgrass Phyllosphere | CCDLAEAQGLGLPVVGHPWVDGCLRLPGPPGFFDFAAPAVVGDDGLQEYGLLEV |
| Ga0182215_11118031 | 3300017447 | Switchgrass Phyllosphere | LWNRLLPPCCARDCYCDLVEAQELGLPVVGHPWGDGCLRLLDSLDFFDFATPVVVDDDGLQEYSLLEV |
| Ga0182215_11325722 | 3300017447 | Switchgrass Phyllosphere | LAEAQGLGLPVVGHSWVDECLRLPDPPGFFDFAAPAVVDDDGLQEYDLLKV |
| Ga0182216_11066811 | 3300017693 | Switchgrass Phyllosphere | MRPLWNRLLLPCCARGCYCDLVEAQELGLQVAGHPWGDESLRLPGPPGSFDFATPAVFDDDGLQEYGLLEV |
| Ga0182216_11870422 | 3300017693 | Switchgrass Phyllosphere | VVAIWLRPQGLGLPVVSHPWVDECLQLPDPPGFFCFAAPTIVDDDGLQEYDLLEV |
| Ga0182211_11596512 | 3300017694 | Switchgrass Phyllosphere | RLPPPCYARGCCCCDLAESQGLDLLAVGHPCVDGCSRLPDPLDFFDFAAPAVVDDGGLQKYGLLEV |
| Ga0207703_113470282 | 3300026035 | Switchgrass Rhizosphere | PCCSRGYCYCGLAVAQGLGLLVVGRPWGDGCLRLLDPLDFFEFAAPAVVVDGDLQEYGLPKV |
| Ga0207641_118201361 | 3300026088 | Switchgrass Rhizosphere | CARGCCCGLVEAQELGLLVAGHPWGDGSLQLPGPPGSFDFADLAVGDDDGLQGYGLLDVLLLR |
| Ga0268322_10206112 | 3300028049 | Phyllosphere | MRPLWSRLLLPCCGRGCCCDLAEAHELDLPVVGHPWGDESLRLPGPLSFFDFVAPAVGDGLREYGLLEV |
| Ga0268306_10344821 | 3300028054 | Phyllosphere | LLVVGHPWGDDCSQLPGLLDSFGFTALAVVDDCGLREYSSPEV |
| Ga0268340_10761782 | 3300028064 | Phyllosphere | LAKAQGLGLPVVGHHWVDECLQLPDPPGFFGFAAPTVIDDDGLQEYDLLEV |
| Ga0268348_10167272 | 3300028143 | Phyllosphere | GCCCCGLAEAQGLGLLEVGHPWGDGCSRLLDPLDFFGSAAPAVVDAGGLRGYGLPEV |
| Ga0268341_10174812 | 3300028154 | Phyllosphere | MESATSSCYSRGCCCDLAGAQELGLPVVGHPWVNGCLRLPDPPGFFDFAAATVVGDDGLQEYDLLEV |
| Ga0268312_10205383 | 3300028248 | Phyllosphere | DCCCDSVEAQELGLLVVGHPWGDGCLRLLDTLDFFGFGAPAVVDDDGLRGYDLLEV |
| Ga0268329_10266021 | 3300028476 | Phyllosphere | PLPYCSRGCCCDLAEAQELGLLVVGHPWVDGCLQLSDPPSFFDFVAAAVVGDDGLQEYDLLEV |
| Ga0268339_10043471 | 3300028526 | Phyllosphere | LAEAQELGLPVVGHPWVDGYLQLPDPPDFFDFATPIVVSDDGLQECDLLEV |
| Ga0214491_10253512 | 3300032469 | Switchgrass Phyllosphere | PVRPLWNRLPLPCYARGCCCCDLVEAQELGLPVVGHPWVDGCLRLPDPPGFFDFAAAAVVVDNGLQGYELLEI |
| Ga0214495_10532062 | 3300032490 | Switchgrass Phyllosphere | QGVGLPVVGQPWVDECLQLPDPPGFFGFAAPAVVDNDGLQEYDLLEV |
| Ga0214495_10843291 | 3300032490 | Switchgrass Phyllosphere | RGCGCDLAEAQGLGSPVVGHPWVDECLRLPDPLGFFGFAPPTVVDDDGLQEYDLFEV |
| Ga0214490_11108062 | 3300032502 | Switchgrass Phyllosphere | LVEAQELGLPVAGHPWGDESLRLPGPLGFFDFADLAVVDDDGLQEYGLLVV |
| Ga0314746_10120982 | 3300032758 | Switchgrass Phyllosphere | LAKAQELGLPVVGHLWVDGYLQLPDPPGFFDFAAPTVVGDDGLQKCDLLEV |
| ⦗Top⦘ |