NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F052916

Metagenome Family F052916

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F052916
Family Type Metagenome
Number of Sequences 142
Average Sequence Length 49 residues
Representative Sequence MSGAFPPKVVAAGEGKTVMLFGVRFGYKVVSGDSGGRLAVLEVEIP
Number of Associated Samples 121
Number of Associated Scaffolds 142

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 87.23 %
% of genes near scaffold ends (potentially truncated) 96.48 %
% of genes from short scaffolds (< 2000 bps) 92.25 %
Associated GOLD sequencing projects 118
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (74.648 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(28.873 % of family members)
Environment Ontology (ENVO) Unclassified
(24.648 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(39.437 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 27.03%    Coil/Unstructured: 72.97%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 142 Family Scaffolds
PF14534DUF4440 31.69
PF13474SnoaL_3 6.34
PF02585PIG-L 3.52
PF00072Response_reg 2.11
PF13561adh_short_C2 2.11
PF13424TPR_12 2.11
PF00144Beta-lactamase 1.41
PF02899Phage_int_SAM_1 1.41
PF00155Aminotran_1_2 1.41
PF00196GerE 1.41
PF00106adh_short 1.41
PF00326Peptidase_S9 0.70
PF12867DinB_2 0.70
PF14525AraC_binding_2 0.70
PF07690MFS_1 0.70
PF12697Abhydrolase_6 0.70
PF11706zf-CGNR 0.70
PF01872RibD_C 0.70
PF14329DUF4386 0.70
PF02371Transposase_20 0.70
PF03454MoeA_C 0.70
PF00440TetR_N 0.70
PF01042Ribonuc_L-PSP 0.70
PF05598DUF772 0.70
PF12695Abhydrolase_5 0.70
PF01557FAA_hydrolase 0.70
PF13191AAA_16 0.70

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 142 Family Scaffolds
COG2120N-acetylglucosaminyl deacetylase, LmbE familyCarbohydrate transport and metabolism [G] 3.52
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 1.41
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 1.41
COG2367Beta-lactamase class ADefense mechanisms [V] 1.41
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 1.41
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 1.41
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 0.70
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.70
COG0303Molybdopterin Mo-transferase (molybdopterin biosynthesis)Coenzyme transport and metabolism [H] 0.70
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.70
COG3547TransposaseMobilome: prophages, transposons [X] 0.70


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms74.65 %
UnclassifiedrootN/A25.35 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_120917332All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300005166|Ga0066674_10395153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria642Open in IMG/M
3300005177|Ga0066690_10676212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia686Open in IMG/M
3300005186|Ga0066676_10542007All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300005187|Ga0066675_10712796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia754Open in IMG/M
3300005332|Ga0066388_106582778Not Available585Open in IMG/M
3300005335|Ga0070666_11115849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia586Open in IMG/M
3300005436|Ga0070713_100046383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3565Open in IMG/M
3300005436|Ga0070713_102084894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia550Open in IMG/M
3300005467|Ga0070706_100163195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2080Open in IMG/M
3300005518|Ga0070699_100831901All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii845Open in IMG/M
3300005553|Ga0066695_10104958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1735Open in IMG/M
3300005764|Ga0066903_103222881Not Available882Open in IMG/M
3300005764|Ga0066903_104298934Not Available761Open in IMG/M
3300005764|Ga0066903_104443690All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300005764|Ga0066903_106338111Not Available617Open in IMG/M
3300005764|Ga0066903_107947868Not Available544Open in IMG/M
3300005764|Ga0066903_108243277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia533Open in IMG/M
3300005840|Ga0068870_10269519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1063Open in IMG/M
3300005894|Ga0075270_1041463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia659Open in IMG/M
3300006049|Ga0075417_10060876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1652Open in IMG/M
3300006163|Ga0070715_10117550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1263Open in IMG/M
3300006163|Ga0070715_10141625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1168Open in IMG/M
3300006173|Ga0070716_100021519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3399Open in IMG/M
3300006173|Ga0070716_100208783All Organisms → cellular organisms → Bacteria1303Open in IMG/M
3300006175|Ga0070712_100307813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1284Open in IMG/M
3300006175|Ga0070712_101422881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia605Open in IMG/M
3300006880|Ga0075429_101901667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes missouriensis516Open in IMG/M
3300010043|Ga0126380_12191974Not Available510Open in IMG/M
3300010047|Ga0126382_12033110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia548Open in IMG/M
3300010048|Ga0126373_13113243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia517Open in IMG/M
3300010359|Ga0126376_12592945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia555Open in IMG/M
3300010360|Ga0126372_10059791All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2642Open in IMG/M
3300010360|Ga0126372_10739679Not Available966Open in IMG/M
3300010361|Ga0126378_10672379All Organisms → cellular organisms → Bacteria1148Open in IMG/M
3300010361|Ga0126378_10928061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi976Open in IMG/M
3300010361|Ga0126378_12337014Not Available610Open in IMG/M
3300010366|Ga0126379_10353727Not Available1500Open in IMG/M
3300010366|Ga0126379_12597198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium604Open in IMG/M
3300010376|Ga0126381_103890283Not Available582Open in IMG/M
3300010397|Ga0134124_10686728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1012Open in IMG/M
3300011003|Ga0138514_100087346All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300012209|Ga0137379_11198176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria666Open in IMG/M
3300012351|Ga0137386_10400524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia988Open in IMG/M
3300012358|Ga0137368_10778733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia594Open in IMG/M
3300012359|Ga0137385_10141383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2120Open in IMG/M
3300012359|Ga0137385_10658217Not Available877Open in IMG/M
3300012487|Ga0157321_1012903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia673Open in IMG/M
3300012506|Ga0157324_1027852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia621Open in IMG/M
3300012683|Ga0137398_10786731All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia664Open in IMG/M
3300012915|Ga0157302_10454173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia542Open in IMG/M
3300012960|Ga0164301_11477397All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia559Open in IMG/M
3300012977|Ga0134087_10322044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia731Open in IMG/M
3300013100|Ga0157373_10344740All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1062Open in IMG/M
3300013104|Ga0157370_10599779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1008Open in IMG/M
3300016294|Ga0182041_10519007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1036Open in IMG/M
3300016387|Ga0182040_11836671Not Available519Open in IMG/M
3300016404|Ga0182037_11751866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria554Open in IMG/M
3300016422|Ga0182039_11964990Not Available538Open in IMG/M
3300018431|Ga0066655_11066735Not Available563Open in IMG/M
3300018476|Ga0190274_11141919Not Available860Open in IMG/M
3300020002|Ga0193730_1037035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1414Open in IMG/M
3300020022|Ga0193733_1161778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia599Open in IMG/M
3300020579|Ga0210407_10234285All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1429Open in IMG/M
3300020582|Ga0210395_10132033All Organisms → cellular organisms → Bacteria1858Open in IMG/M
3300021168|Ga0210406_11178961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia559Open in IMG/M
3300021171|Ga0210405_11086945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia599Open in IMG/M
3300021180|Ga0210396_11719266Not Available509Open in IMG/M
3300021402|Ga0210385_10566940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii864Open in IMG/M
3300021478|Ga0210402_10960146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria781Open in IMG/M
3300021479|Ga0210410_10197424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1802Open in IMG/M
3300021559|Ga0210409_10435769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1170Open in IMG/M
3300021560|Ga0126371_10191890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2134Open in IMG/M
3300024232|Ga0247664_1176201All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia506Open in IMG/M
3300024254|Ga0247661_1087058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia587Open in IMG/M
3300024325|Ga0247678_1076920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia556Open in IMG/M
3300025898|Ga0207692_10557588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria733Open in IMG/M
3300025905|Ga0207685_10566176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia606Open in IMG/M
3300025908|Ga0207643_10265050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1061Open in IMG/M
3300025917|Ga0207660_10396960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1110Open in IMG/M
3300025928|Ga0207700_11043477All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia731Open in IMG/M
3300025929|Ga0207664_11068220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria722Open in IMG/M
3300025932|Ga0207690_11104482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia661Open in IMG/M
3300025933|Ga0207706_10565990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia978Open in IMG/M
3300025934|Ga0207686_10444592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia996Open in IMG/M
3300025935|Ga0207709_10463440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia982Open in IMG/M
3300026088|Ga0207641_11637782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia645Open in IMG/M
3300026550|Ga0209474_10539098All Organisms → cellular organisms → Bacteria → Terrabacteria group592Open in IMG/M
3300026805|Ga0207507_105717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia505Open in IMG/M
3300027119|Ga0209522_1023967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia726Open in IMG/M
3300027575|Ga0209525_1108695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium653Open in IMG/M
3300027853|Ga0209274_10662117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria539Open in IMG/M
3300027874|Ga0209465_10080230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1588Open in IMG/M
3300028906|Ga0308309_10465280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1090Open in IMG/M
3300030510|Ga0268243_1030537All Organisms → cellular organisms → Bacteria1107Open in IMG/M
3300031545|Ga0318541_10158349Not Available1245Open in IMG/M
3300031549|Ga0318571_10224042All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300031640|Ga0318555_10262872Not Available933Open in IMG/M
3300031681|Ga0318572_10263423Not Available1015Open in IMG/M
3300031731|Ga0307405_10140175All Organisms → cellular organisms → Bacteria1684Open in IMG/M
3300031736|Ga0318501_10382096Not Available759Open in IMG/M
3300031740|Ga0307468_101341156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia654Open in IMG/M
3300031744|Ga0306918_10772418Not Available751Open in IMG/M
3300031744|Ga0306918_11189571Not Available589Open in IMG/M
3300031751|Ga0318494_10615161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria635Open in IMG/M
3300031751|Ga0318494_10765719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia565Open in IMG/M
3300031751|Ga0318494_10958460Not Available502Open in IMG/M
3300031765|Ga0318554_10246812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1017Open in IMG/M
3300031793|Ga0318548_10364901Not Available709Open in IMG/M
3300031795|Ga0318557_10236403Not Available836Open in IMG/M
3300031796|Ga0318576_10072797Not Available1531Open in IMG/M
3300031799|Ga0318565_10155068Not Available1111Open in IMG/M
3300031821|Ga0318567_10760392Not Available549Open in IMG/M
3300031831|Ga0318564_10251274Not Available784Open in IMG/M
3300031846|Ga0318512_10009254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium3736Open in IMG/M
3300031846|Ga0318512_10116312Not Available1269Open in IMG/M
3300031860|Ga0318495_10173500Not Available972Open in IMG/M
3300031860|Ga0318495_10182592Not Available945Open in IMG/M
3300031893|Ga0318536_10629412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia536Open in IMG/M
3300031896|Ga0318551_10514906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria687Open in IMG/M
3300031897|Ga0318520_10092930All Organisms → cellular organisms → Bacteria1680Open in IMG/M
3300031901|Ga0307406_10644921All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. S2-4878Open in IMG/M
3300031941|Ga0310912_11167539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia587Open in IMG/M
3300031946|Ga0310910_10055751All Organisms → cellular organisms → Bacteria2802Open in IMG/M
3300031996|Ga0308176_10530282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1200Open in IMG/M
3300032009|Ga0318563_10412395All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria731Open in IMG/M
3300032065|Ga0318513_10367583Not Available701Open in IMG/M
3300032066|Ga0318514_10467244All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300032089|Ga0318525_10410852Not Available694Open in IMG/M
3300032091|Ga0318577_10204019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria946Open in IMG/M
3300032126|Ga0307415_100366288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1219Open in IMG/M
3300032180|Ga0307471_101918815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia741Open in IMG/M
3300032205|Ga0307472_101013915Not Available779Open in IMG/M
3300032770|Ga0335085_10665509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1162Open in IMG/M
3300032783|Ga0335079_12295425All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia512Open in IMG/M
3300032805|Ga0335078_10210980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2685Open in IMG/M
3300032805|Ga0335078_12568080All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia523Open in IMG/M
3300032895|Ga0335074_10425520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1424Open in IMG/M
3300032955|Ga0335076_10183933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1996Open in IMG/M
3300033134|Ga0335073_10043549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6053Open in IMG/M
3300033475|Ga0310811_11306529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia576Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil28.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.15%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere9.15%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil5.63%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.93%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.23%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.11%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.11%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.41%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.41%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.41%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.41%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.41%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.41%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.41%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.70%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.70%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.70%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.70%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.70%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.70%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.70%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.70%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.70%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.70%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005894Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_203EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012487Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510Host-AssociatedOpen in IMG/M
3300012506Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610Host-AssociatedOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024232Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05EnvironmentalOpen in IMG/M
3300024254Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02EnvironmentalOpen in IMG/M
3300024325Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026805Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK01-A (SPAdes)EnvironmentalOpen in IMG/M
3300027119Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027575Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030510Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2)EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_12091733213300000956SoilMSVPPVPKLVAPGEGKTVMLFGVRFEYKVVSADSGGGMAMMEVEIPAGTLVKPH
Ga0066674_1039515323300005166SoilMTGAFSPKVVAPGEGTTVKLFGVRFGYKVVSADSGGALAAMEVEIPAGTLV
Ga0066690_1067621223300005177SoilVSGAFPPKVVAADEGKTVMLFGVRFGYKVVSGDSGGRLAVLEVEIP
Ga0066676_1054200713300005186SoilMSGAFPPKVVAAGEGKTVMLFGVRFGYKVVSGDSGGRLAVLEVEIPPKTLVKP
Ga0066675_1071279613300005187SoilMSGTFPPKVVAAGEGKTVMLFGVRFGYKVVSGDSGGRLAVLEV
Ga0066388_10658277813300005332Tropical Forest SoilMTEAFSPKLVAPGEGKIVMLFSVRFSYKVVSTDCDGSLAILEVDIPARTLVKP
Ga0070666_1111584923300005335Switchgrass RhizosphereVSEPFPPRVVAAGEGKTVMLFGVRFGYKVVSGDSGGRLAVLEVEI
Ga0070713_10004638313300005436Corn, Switchgrass And Miscanthus RhizosphereVSGAFPPKVVRAGEGKTVMLFGVRFGYKVVSGDSGGRLAVLEVEIPAGTLVKPH
Ga0070713_10208489413300005436Corn, Switchgrass And Miscanthus RhizosphereMTGAFSPKAVAPGGGATVKLFGVRFTYKVVSDDCGGTLAVMDVDIPAGTLVKPHSHAREDEF
Ga0070706_10016319513300005467Corn, Switchgrass And Miscanthus RhizosphereMTGAFSPKMVAPGQGKTVLLFGVRFGYKIVSADCGASLAALEVEIPARTLVK
Ga0070699_10083190123300005518Corn, Switchgrass And Miscanthus RhizosphereMTGAFSPKAVAPGGGATVKLFGVRFTYKVVSDDCGGTLAVMEVDIPAG
Ga0066695_1010495813300005553SoilVSGAFPPKVMGAGEGKTVMLFGVRFGYKVVSGDSGG
Ga0066903_10322288143300005764Tropical Forest SoilMTGAFTPKLVAPGEGKTVMLFGVRFSYKVVSADSGGSLAVLEVEIPAKTLVKPHKHA
Ga0066903_10429893423300005764Tropical Forest SoilMTTAFSPRMVAPGEGKTVMLFGVRFSYKVESAHSG
Ga0066903_10444369013300005764Tropical Forest SoilMAGAITPRLVAPGEGKTVMLFGVRFSYKVVSADSGGSLAVLEVEIPAKTLVKPH
Ga0066903_10633811123300005764Tropical Forest SoilMTMAFSPRMVAPGEGKTVMLFGVRFSYKVESAHSGGS
Ga0066903_10794786823300005764Tropical Forest SoilMSTAFSPRMVAPGEGKTVMLFGVRFSYKVESAHSGGSLAVL
Ga0066903_10824327713300005764Tropical Forest SoilMTEAFSPKLVAPDEGRTVRLMGVRFGYKVVSGDSGG
Ga0068870_1026951943300005840Miscanthus RhizosphereMSGAFPPKVVAAGEGKTVMLFGVRFGYKVVSGDSGGRLAVLEVEIPP
Ga0075270_104146323300005894Rice Paddy SoilMAPAVSPKVVAPGEGKTVKLFGVRFSYKVESADSGASLAAMEVEIPPG
Ga0075417_1006087643300006049Populus RhizosphereMTEAFIPKLVTPGQGKTVMLFGVRFSYKVVSADTGGSLAVLEVTIPPGTLVKPHNHSRED
Ga0070715_1011755013300006163Corn, Switchgrass And Miscanthus RhizosphereMTTAFSPRMVAPEEGKTVMLFGVRFSYKVESTHSGGSLAVLEVQIPSKTLVK
Ga0070715_1014162523300006163Corn, Switchgrass And Miscanthus RhizosphereVRGAFPPKVVGAGEGKTVMLFGVRFGYKVVSGDSGGRLAVLEVEIPAGTLVKL*
Ga0070716_10002151913300006173Corn, Switchgrass And Miscanthus RhizosphereVSGAFPPKVVGAGEGKTAMLFGVRFGYKVVSGDSGGRLAVLEVEIPAGTL
Ga0070716_10020878313300006173Corn, Switchgrass And Miscanthus RhizosphereMSGAFPPKVVAAGEGKTVMLFGVRFGYKVVSGDSGGRLAVLEV
Ga0070712_10030781333300006175Corn, Switchgrass And Miscanthus RhizosphereVSGAFPPKVVGAGEGKTVMLFGVRFGYKVVSGDSGGRLAVLEVEIPAGTLVK
Ga0070712_10142288113300006175Corn, Switchgrass And Miscanthus RhizosphereMTGAFSPKAVAPGGGATVKLFGVRFTYKVVSDDCGGT
Ga0075429_10190166713300006880Populus RhizosphereMTEAFIPKLVTPGQGKTVMLFGVRFSYKVVSADTGGSLAVLEVTIPPGTLVKPH
Ga0126380_1219197413300010043Tropical Forest SoilMTGAFTSKLVAPGEGTTVMLFSIRFSYKVVSADSGGSLAVLEVEIPAKTLVKPH
Ga0126382_1203311023300010047Tropical Forest SoilVSGAFPPKVVAAGEGKAVMLFGVRFGYKVVSGDSGGRLAVLEVEIPPRTLVKPHSHARE
Ga0126373_1311324323300010048Tropical Forest SoilMTGAFPARVVAAGEGKTVMLFGVRFGYKIVSGDSGGKLAVLEVEIPAGTLV
Ga0126376_1259294523300010359Tropical Forest SoilMTEAFPPKVVAPGEGKTVMLFGVRFGYKVVSEDSAGRLAVLEVEIPARTLVKP
Ga0126372_1005979153300010360Tropical Forest SoilMSGAFPPKVVAAGEGKTVMLFGVRFGYKVVSGDSGGRLAVLEVEIPPRTLV
Ga0126372_1073967923300010360Tropical Forest SoilMTGAFTPKLVAPGEGKTVMLFGVRFSYKVVSADSGGSLAVLEVEIPAKTLVKPH
Ga0126378_1067237943300010361Tropical Forest SoilMTGAFTPKLVAPGEGKTVMLFGVRFSYKVVSADSGGSLAVLEVEIPAKTLVKPHNHSRE
Ga0126378_1092806123300010361Tropical Forest SoilMAGPFTPRLVAPGEGKTVMLFGVRFSYKVVSADSGGSLAVLEVEIPAK
Ga0126378_1233701413300010361Tropical Forest SoilMMTGAFSPKVVAPGEGTTVKLFGVRFGYKVVSADSGGALAVME
Ga0126379_1035372743300010366Tropical Forest SoilMTGAFTPKLLAPGEGKTVMLFGVRFSYKVVSADSGGSLAV
Ga0126379_1259719813300010366Tropical Forest SoilMMTGAFSPKVVAPGEGTTVKLFGVRFGYKVVSADSGGALAVMEVEI
Ga0126381_10389028313300010376Tropical Forest SoilMTEAFSPKLVEPGDGKIVMLFGVRFNYKVVSTDCDVSLAILEVDIPP
Ga0134124_1068672813300010397Terrestrial SoilVSEPFPPRVVAAGEGKTVMLFGVRFGYKVVSGDSGGRLAVLEVEIPPRTLVKPHS
Ga0138514_10008734623300011003SoilVTTPLTPKLLAPGEGASVMLFGVRFDYKLRSADSGGSLAVLEVEIPGKTLVKPHNH
Ga0137379_1119817613300012209Vadose Zone SoilMTAVFSPKMVAPGEGKTVMLFGVRFSYKVESADCGGSLVVLGVEIPARTFVKPHNHSR
Ga0137386_1040052413300012351Vadose Zone SoilVSGAFPPKVVGAGEGKTVMLFGVRFGYKVVSGDSGGR
Ga0137368_1077873323300012358Vadose Zone SoilMSVVPRPKLVAPGEGKTVRLFGVRFDYKVESADSGGTLAVLEVEIPAKTLVKPHNHAR
Ga0137385_1014138343300012359Vadose Zone SoilMPTSTPPTPKLVAPGEGKTVKLFGVRFRYKVESADSGGSLAVLE
Ga0137385_1065821723300012359Vadose Zone SoilMPKLVAPGDGKTVMLFGVRFEYKVVTADSGGGLAMMEVEIPAGTLVKPHN
Ga0137385_1076996113300012359Vadose Zone SoilMPTPTPPTPKLVAPGEGKTVKLFGVRFRYKVESADSGGSLAVLE
Ga0157321_101290323300012487Arabidopsis RhizosphereMSGAFPPKVVAAGEGKTVMLFGVRFGYKVVSGDSDGRLAVLEVEIPPRT
Ga0157324_102785213300012506Arabidopsis RhizosphereMSGAFPPKVVAAGEGKTVMLFGVRFGYKVVSGDSDGRLAVLEVEIPPRTLVKPHSH
Ga0137398_1078673113300012683Vadose Zone SoilVSGAFPPKVVGAGEGKTVMLFGVRFGYKVVSGDSGGKLAVLEV
Ga0157302_1045417313300012915SoilVSEPFPPRVVAAGEGKTVMLFGVRFGCKVVSGDSG
Ga0164301_1147739713300012960SoilMSGAFPPKVVAAGEGKTVMLFGVRFGYKVVSGDSGGRLAVLEVEIPPRTLVKPHSHAREDEF
Ga0134087_1032204413300012977Grasslands SoilVSGAFPPKVVAADEGKTVMLFGVRFGYKVVSGDSGGRLAVLEVEIPPKTLVKPHSHARE
Ga0157373_1034474013300013100Corn RhizosphereMSGAFPPKVVAAGEGKTVMLFGVRFGYKVVSGDSGGRLAVLEVEIPPRTLVKPH
Ga0157370_1059977933300013104Corn RhizosphereVSGAYPPKVVGAGEGKTVMLFGVRFGYKVVSADSGGR
Ga0182041_1051900723300016294SoilMAADIASPFSPKVVAPGEGKTVMLFGVRFSYKVETADSGGTLAVLEVEIPAHTLVKPHN
Ga0182040_1183667113300016387SoilMTTAFSPRMLAPGEGKTVMLFGVRFSYKVESSHSGGSLAVLEVQIPAKTLVK
Ga0182037_1175186613300016404SoilMPAAFSHKAVAPGEGKTVLLFGVRFSYKIVSADSAGQLAILEVEIP
Ga0182039_1196499013300016422SoilMTTAFSPRMVAPGEGKTVMLFGVRFSYKVESAHSGGSLTVLEVQIPAKTLVKPHNHSRE
Ga0066655_1106673523300018431Grasslands SoilMTEAFIPKLVTPGQGKTVMLFGVRFSYKVVSADTGGSLAVLEVRIP
Ga0190274_1114191923300018476SoilMLTPSSLSPKVVAPGEGKTVELFRVRFDYKVESADSGGNLAVLEIE
Ga0193730_103703543300020002SoilVSGAFPPKVVAAGEGKTVMLFGVRFGYKVVSGDSGGRLAVLE
Ga0193733_116177823300020022SoilMSGAFPPKLVAGGEGKTVMLFGVRFGYKVVSGDSGGRLAVLEVEIPPRTLVKP
Ga0210407_1023428513300020579SoilVTAGIPPKVVAAGEGKTVMLFGVRFGYKVVSGDSGGRLAVLEVEIPAGTLVKPRGTAHAVWNAGSTP
Ga0210395_1013203333300020582SoilVSGAFPPKVVAVSEGKTVMLFGVRFGYKVVSGDSGGRLAVL
Ga0210406_1117896113300021168SoilVTAGIPPKVVAAGEGKTVMLFGVRFGYKVVSGDSGGRLA
Ga0210405_1108694513300021171SoilVTAGIPPKVVAAGEGKTVMLFGVRFGYKVVSGDSG
Ga0210396_1171926623300021180SoilMTADPASPFSPKVTAPGAGKTVMLFGVRFCYKVETADSGGTLAVMEVEIPAHTLVK
Ga0210385_1056694013300021402SoilMTPVPSPKVVAPGAGKTVMLFGVRFSYMIESADSGGSLAVLEVQIPPRT
Ga0210402_1096014613300021478SoilVSGAFPPKVVAAGEGKTVMLFGVRFGYKVVSGDSGGRLAVLEVEIPAGTLVKPHS
Ga0210410_1019742443300021479SoilVSGAFPPKVVAADEGKTVMLFGVRFGYKVVSGDSGGRLAVLEVDPRA
Ga0210409_1043576913300021559SoilVTAGIPPKVVAAGEGKTVMLFGVRFGYKVVSGDSGGRLAVLEVEIPAGTLVKPRG
Ga0126371_1019189043300021560Tropical Forest SoilMTGAFPARVVAPGEGKTVMLFGVRFGYKIVSGDSGGKLAVLEVEI
Ga0247664_117620113300024232SoilMSGAFPPKVVAAGEGKTVMLFGVRFGYKVVSGDSGGRLAVLEVKIPPRTLVKPHSHAR
Ga0247661_108705823300024254SoilMSGAFPPKVVAAGEGKTVMLFGVRFGYKVVSGDSGGRLAVLEVEIPPR
Ga0247678_107692013300024325SoilMSGAFPPKVVAAGEGKTVMLFGVRFGYKVVSGDSGGRLAVLEVEIPPRT
Ga0207692_1055758833300025898Corn, Switchgrass And Miscanthus RhizosphereVSGAFPPKVVAAGEGKTVMLFGVRFGYKVVSGDSGGRLAVLEVE
Ga0207685_1056617623300025905Corn, Switchgrass And Miscanthus RhizosphereMTTAFSPRMVAPEEGKTVMLFGVRFSYKVESTHSGGSLAVLEVQIPSKTLVKPHNH
Ga0207643_1026505013300025908Miscanthus RhizosphereMSGAFPPKVVAAGEGKTVMLFGVRFGYKVVSGDSGGRLAVLEVK
Ga0207660_1039696033300025917Corn RhizosphereMSGAFPPKVVAAGEGKTVMLFGVRFGYKVVSGDSGGRLAVLEVEIPPRTLVKPHSH
Ga0207700_1104347713300025928Corn, Switchgrass And Miscanthus RhizosphereVSGAFPPKVVAAGEGKTVMLFGVRFGYKVVSGDSGGRLAVLEV
Ga0207664_1106822033300025929Agricultural SoilVSGAFPPKVVAAGEGKTVMLFGVRFGYKVVSGDSGGRL
Ga0207690_1110448213300025932Corn RhizosphereMSGAFPPKVVAAGEGKTVMLFGVRFGYKVVSGDSGGRLAVLEVEIP
Ga0207706_1056599033300025933Corn RhizosphereMSGAFPPKVVAAGEGKTVMLFGVRFGYKVVSGDSGGRL
Ga0207686_1044459213300025934Miscanthus RhizosphereMSGAFPPKVVAAGEGKTVMLFGVRFGYKVVSGDSGGRLAVLEVEIPPRTLVKPHSHARE
Ga0207709_1046344033300025935Miscanthus RhizosphereMSGAFPPKVVAAGEGKTVMLFGVRFGYKVVSGDSGGRLAV
Ga0207641_1163778213300026088Switchgrass RhizosphereMSGAFPPKVVAAGEGKTVMLFGVRFGYKVVSGDSGGRLAVLEVEIPPRTLVKPHSHSRE
Ga0209474_1053909813300026550SoilMAGAFTPKLVTPEEGKTVKLFGVQFSYKVVSADSGGS
Ga0207507_10571723300026805SoilMSGAFPPKVVAAGEGKTVMLFGVRFGYKVVSGDSG
Ga0209522_102396713300027119Forest SoilMSGAFPPKVVAAGEGTTVMLFGVRFGYKVVSGDSGGRLAVLEVEIPPRTLVKPHSHAREDEFSL
Ga0209525_110869513300027575Forest SoilMTADTASPFSPKAIAPGGGKTVMLFGVRFSYKVEAADSGGTLAVMEVEIPAHTLVKP
Ga0209274_1066211723300027853SoilMTPVPSPKVVAPGAGKTVMLFGVRFSYKIESADSGGSLAVLEVQI
Ga0209465_1008023013300027874Tropical Forest SoilMTGAFTPMLVAPGEGTTLMLFGVRFSYKVVSADSSGNLAV
Ga0308309_1046528013300028906SoilMTADPASPFSPKVTAPGAGKTVMLFGVRFCYKVETADSGGTLAVMEVEIPAHTLVKPHNH
Ga0268243_103053723300030510SoilMTTAPSPKLKAPGESKTVQLYGVRFDYKVEHADSGGSVALLEVAIPPGTLVKPHNHTRED
Ga0318541_1015834923300031545SoilMTGAFSPKVVAPGEGTTVKLFGVRFGYKVVSADSGGALAVME
Ga0318571_1022404213300031549SoilMTADIASPFSPKVVAPGEGKTVMLFGVRFSYKIESHDSAGKLAVLEVE
Ga0318555_1026287243300031640SoilMTVAFPPKVVAAGEGKTVMLFGVRFGYKVVSGDSGGKLAVLEVEIPAGT
Ga0318572_1026342313300031681SoilMTVAFPPKVVAAGEGKTVMLFGVRFGYKVVSGDSGGKLAVLEVEIPAGTLVKPHSHAREDEF
Ga0307405_1014017513300031731RhizosphereMPTPSTPRLVAPGEGTTVRLFGVRFDYKVESADSGGSLAVLEVEIPAKTL
Ga0318501_1038209613300031736SoilMTVAFPPKVVAAGEGKTVMLFGVRFGYKVVSGDSGGKLAVLEVEIPAWTLVKPHSHAREDEFS
Ga0307468_10134115623300031740Hardwood Forest SoilVSGAFPPKVVGAGEGKTVMLFGVRFGYKVVSGDSG
Ga0306918_1077241823300031744SoilMTTAFSPRTVAPGEGKTVMLFGVRFSYKVESAHSGGSLAVLEVQIPAKTL
Ga0306918_1118957133300031744SoilMTGAFPPKVVAAGEGKTVMLFGVRFGYKVVSGDSGGKLAVLEVEIPAG
Ga0318494_1061516113300031751SoilMPAAFSHKAVAPGEGKTVLLFGVRFSYKIVSADSAGQLAILEVEIPPK
Ga0318494_1076571923300031751SoilMTADIASPFSPKVVAPGEGKTVMLFGVRFSYKIESHDSAGKLAVLEVEIPAHT
Ga0318494_1095846013300031751SoilMTGAFTPKLVAPGEGKTVMLSGVRFSYKVVSAESGGSLALLAVEIPPRPW
Ga0318554_1024681223300031765SoilMTADIASPFSPKVVAPGEGKTVMLFGVRFSYKIESHDSAGKLAVLEVEIPAHTLVKP
Ga0318548_1036490113300031793SoilMTTAFSPRTVAPGEGKTVMLFGVRFSYKVESAHSGGSLTVLEVQIPAKTL
Ga0318557_1023640343300031795SoilMTGAFPPKVVAAGEGKTVMLFGVRFGYKVVSGDSGGKLAVLEVEIPAGTL
Ga0318576_1007279723300031796SoilMTGAFSPKVVAPGEGTTVKLFGVRFGYKVVSADSGGALAVMEVEIPSG
Ga0318565_1015506823300031799SoilMTADIASPFSPKVVAPGEGKTVMLFGVRFSYKVESHDSAGKLAVLEVEIPAHT
Ga0318567_1076039223300031821SoilMTEVFSPKLVAPGEGKIVMLFGVRFSYKVISADCAGSLAVLEVDIPARTLVKPHSHSREN
Ga0318564_1025127413300031831SoilMTTAFSPRTVAPGEGKTVMLFGVRFSYKVESAHSGGSLAVLEVQIPAK
Ga0318512_1000925413300031846SoilMTGAFSPKVVAPGEGTTVKLFGVRFGYKVVSADSGGALAVMEVEIPAGTLVKPH
Ga0318512_1011631233300031846SoilMTEVFSPKLVAPGEGKIVMLFGVRFSYKVISADCAGSLAVLEVDIPAR
Ga0318495_1017350013300031860SoilMTEAFSPKLVAPGEGKIVMLFGVRFSYKVVSADCAGSLAVLEVDIPARTLV
Ga0318495_1018259223300031860SoilMTTAFSPRTVAPGEGKTVMLFGVRFSYKVESAHSGGSLAVLEVQI
Ga0318536_1062941223300031893SoilMAADIASPFSPKVVAPGEGKTVMLFGVRFSYKVETADSGGTLAVLEVEIPAH
Ga0318551_1051490613300031896SoilMPAAFSHKAVAPGEGKTVLLFGVRFSYKIVSADSAGQLAILE
Ga0318520_1009293013300031897SoilMTVAFPPKVVAAGEGKTVMLFGVRFGYKVVSGDSGGKLAVLEVE
Ga0307406_1064492123300031901RhizosphereMPTPSTPRLVAPGEGTTVRLFGVRFDYKVESADSGGSLAVLEVEIPAK
Ga0310912_1116753913300031941SoilMAADTASPFSPKMVAPGEGKTVMLFGVRFSYKVDTTDSGGTLAVLEVEIPAHTLV
Ga0310910_1005575113300031946SoilMTTAFSPRMVAPGEGKTVMLFGVRFSYKVESAHSGGSLTVLEVQIPAKTLVKPHSHSRED
Ga0308176_1053028223300031996SoilVTETFAPKLVAPGEGKAVMLLGVRFSYKVVSADSGGKLAVLEVEIPPATL
Ga0318563_1041239513300032009SoilMPAAFSHKAVAPGEGKTVLLFGVRFSYKIVSADSAGQLAILEVEIPPKTLVKPH
Ga0318513_1036758313300032065SoilMTVAFPPKVVAAGEGKTVMLFGVRFGYKVVSGDSG
Ga0318514_1046724423300032066SoilMTADIASPFSPKVVAPGEGKTVMLFGVRFSYKVESHDSAGKLAVLEVEIPAHTLVKPHNH
Ga0318525_1041085223300032089SoilMTTAFSPRMLAPGEGKTVMLFGVRFSYKVESSHSGGSLAVLEV
Ga0318577_1020401933300032091SoilMTHPFDPKLVAPGDGKTVMLFGVRFSYKVESSDCAGSLAVLEVEIPAGTLVKPHSHSHEDEFSLVLS
Ga0307415_10036628843300032126RhizosphereVTGTRIPRHVAVGDGRTVQLFGVRFRYKIESADTDGSLCVLEVEIPPK
Ga0307471_10191881513300032180Hardwood Forest SoilMSGAFPPKVVAAGEGKTVMLFGVRFGYKVVSGDSGGRLAVLEVEIPPRTLVKPHSHARED
Ga0307472_10101391523300032205Hardwood Forest SoilVVAPGEGKTVMLFGVRFGYKVVSADSGGRLAVLEVEIPVRTLVKPHRHAREDDWIEELERTYGVKL
Ga0335085_1066550933300032770SoilMTGAFPPKAVAAGEGKTVMLFGVRFGYKVVSQDSAGR
Ga0335079_1229542523300032783SoilMTGAFRPKVVAADEGKTVMLFGVRFGYKVVSEDSAGRLAVLEVEIPPG
Ga0335078_1021098033300032805SoilMTPAPSPKVVAPGAGKNVMLFGVRFSYKIESADSGGSLAVLEIQMRTYGVKL
Ga0335078_1256808023300032805SoilMTGAFPPKVVAAGEGKTVMLFGVRFGYKVVSEDSAGRLAVLEVEIPPGT
Ga0335074_1042552033300032895SoilMGMTADIASPFSPKVIAPGEGKTVMLFGIRFSYKVETADCGGTLAVMEVEIPAHTLVKPHNHTR
Ga0335076_1018393343300032955SoilMTGAFPPKAVAAGEGKTVMLFGVRFGYKVVSQDSAGRLAVLEVEIPPG
Ga0335073_1004354913300033134SoilMTTAFSPRMVAPGEGKTVMLFGVRFSYKVESAHSGGSLAVLEVQIPAKTLVKPHNHSRED
Ga0310811_1130652923300033475SoilMSGAFPPKVVAAGEGKTVMLFGVRFGYKVVSGDSGGRLAVLEVEIPPRTLVK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.