| Basic Information | |
|---|---|
| Family ID | F052802 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 142 |
| Average Sequence Length | 49 residues |
| Representative Sequence | EIENMAWTEVMQSDDAQLALKTFLAVDPESRRDWFESENSKNYPAYSGH |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 142 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.23 % |
| % of genes near scaffold ends (potentially truncated) | 95.07 % |
| % of genes from short scaffolds (< 2000 bps) | 92.96 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.366 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (33.803 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.732 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (73.944 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.06% β-sheet: 0.00% Coil/Unstructured: 64.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 142 Family Scaffolds |
|---|---|---|
| PF00378 | ECH_1 | 80.28 |
| PF03352 | Adenine_glyco | 3.52 |
| PF08281 | Sigma70_r4_2 | 1.41 |
| PF02585 | PIG-L | 0.70 |
| PF00027 | cNMP_binding | 0.70 |
| PF01638 | HxlR | 0.70 |
| PF07690 | MFS_1 | 0.70 |
| PF06772 | LtrA | 0.70 |
| PF12146 | Hydrolase_4 | 0.70 |
| PF00355 | Rieske | 0.70 |
| PF07110 | EthD | 0.70 |
| PF00561 | Abhydrolase_1 | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 142 Family Scaffolds |
|---|---|---|---|
| COG2818 | 3-methyladenine DNA glycosylase Tag | Replication, recombination and repair [L] | 3.52 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.70 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.70 |
| COG4292 | Low temperature requirement protein LtrA (function unknown) | Function unknown [S] | 0.70 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.37 % |
| Unclassified | root | N/A | 5.63 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002914|JGI25617J43924_10295146 | Not Available | 557 | Open in IMG/M |
| 3300004479|Ga0062595_102650866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 504 | Open in IMG/M |
| 3300005174|Ga0066680_10396047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 878 | Open in IMG/M |
| 3300005181|Ga0066678_10286378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 1075 | Open in IMG/M |
| 3300005437|Ga0070710_11127431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 577 | Open in IMG/M |
| 3300005440|Ga0070705_101023291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 672 | Open in IMG/M |
| 3300005445|Ga0070708_101472765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 635 | Open in IMG/M |
| 3300005445|Ga0070708_102175224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 512 | Open in IMG/M |
| 3300005467|Ga0070706_101378625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 646 | Open in IMG/M |
| 3300005467|Ga0070706_101597372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 595 | Open in IMG/M |
| 3300005467|Ga0070706_102131742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 506 | Open in IMG/M |
| 3300005468|Ga0070707_100973649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 813 | Open in IMG/M |
| 3300005468|Ga0070707_101105016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 759 | Open in IMG/M |
| 3300005471|Ga0070698_100395182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1316 | Open in IMG/M |
| 3300005471|Ga0070698_100690311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 963 | Open in IMG/M |
| 3300005471|Ga0070698_100844462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 860 | Open in IMG/M |
| 3300005518|Ga0070699_100609195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 996 | Open in IMG/M |
| 3300005536|Ga0070697_100303620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 1372 | Open in IMG/M |
| 3300005536|Ga0070697_100745219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 865 | Open in IMG/M |
| 3300005536|Ga0070697_101294753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 650 | Open in IMG/M |
| 3300005538|Ga0070731_10491802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 817 | Open in IMG/M |
| 3300005549|Ga0070704_100145833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1855 | Open in IMG/M |
| 3300005556|Ga0066707_10887260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 547 | Open in IMG/M |
| 3300005561|Ga0066699_10658182 | Not Available | 750 | Open in IMG/M |
| 3300005764|Ga0066903_101558216 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
| 3300005841|Ga0068863_100690440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 1014 | Open in IMG/M |
| 3300006028|Ga0070717_11143932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 709 | Open in IMG/M |
| 3300006028|Ga0070717_11373141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 642 | Open in IMG/M |
| 3300006028|Ga0070717_11556502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 599 | Open in IMG/M |
| 3300006173|Ga0070716_100723903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 763 | Open in IMG/M |
| 3300006175|Ga0070712_100173025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 1677 | Open in IMG/M |
| 3300006175|Ga0070712_101911827 | Not Available | 520 | Open in IMG/M |
| 3300006755|Ga0079222_10317424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 1029 | Open in IMG/M |
| 3300006797|Ga0066659_10544978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 936 | Open in IMG/M |
| 3300006852|Ga0075433_10958509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 746 | Open in IMG/M |
| 3300006852|Ga0075433_11703228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 543 | Open in IMG/M |
| 3300006854|Ga0075425_100250710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2037 | Open in IMG/M |
| 3300006854|Ga0075425_100969551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 971 | Open in IMG/M |
| 3300006854|Ga0075425_102264225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 604 | Open in IMG/M |
| 3300006854|Ga0075425_102750142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 542 | Open in IMG/M |
| 3300006904|Ga0075424_100686286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 1094 | Open in IMG/M |
| 3300006954|Ga0079219_10869992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 722 | Open in IMG/M |
| 3300007076|Ga0075435_101204156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 663 | Open in IMG/M |
| 3300007255|Ga0099791_10638907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 522 | Open in IMG/M |
| 3300009012|Ga0066710_104368100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 528 | Open in IMG/M |
| 3300009038|Ga0099829_11143577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 645 | Open in IMG/M |
| 3300009088|Ga0099830_10188529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 1608 | Open in IMG/M |
| 3300009089|Ga0099828_10307161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1427 | Open in IMG/M |
| 3300009089|Ga0099828_11361049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 627 | Open in IMG/M |
| 3300009089|Ga0099828_11611607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 571 | Open in IMG/M |
| 3300009089|Ga0099828_11741006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 548 | Open in IMG/M |
| 3300009090|Ga0099827_11546360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 578 | Open in IMG/M |
| 3300009098|Ga0105245_10019055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6006 | Open in IMG/M |
| 3300009098|Ga0105245_10390479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1388 | Open in IMG/M |
| 3300009098|Ga0105245_10781345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 992 | Open in IMG/M |
| 3300009137|Ga0066709_103388820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 579 | Open in IMG/M |
| 3300009143|Ga0099792_10596689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 703 | Open in IMG/M |
| 3300009148|Ga0105243_10129299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2140 | Open in IMG/M |
| 3300009162|Ga0075423_10441367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1367 | Open in IMG/M |
| 3300009162|Ga0075423_12159616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 604 | Open in IMG/M |
| 3300009520|Ga0116214_1313372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 603 | Open in IMG/M |
| 3300010159|Ga0099796_10260780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 723 | Open in IMG/M |
| 3300010333|Ga0134080_10265608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 761 | Open in IMG/M |
| 3300010373|Ga0134128_12494034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 570 | Open in IMG/M |
| 3300010375|Ga0105239_10616767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1238 | Open in IMG/M |
| 3300010399|Ga0134127_12205526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 630 | Open in IMG/M |
| 3300011269|Ga0137392_10126357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2045 | Open in IMG/M |
| 3300011269|Ga0137392_10229984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 1523 | Open in IMG/M |
| 3300011269|Ga0137392_10989822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 691 | Open in IMG/M |
| 3300011270|Ga0137391_10081268 | All Organisms → cellular organisms → Bacteria | 2794 | Open in IMG/M |
| 3300011270|Ga0137391_10098438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2533 | Open in IMG/M |
| 3300011270|Ga0137391_10756359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 804 | Open in IMG/M |
| 3300011271|Ga0137393_10976768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 721 | Open in IMG/M |
| 3300011271|Ga0137393_11776943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 505 | Open in IMG/M |
| 3300012096|Ga0137389_10589791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 955 | Open in IMG/M |
| 3300012189|Ga0137388_10365954 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
| 3300012202|Ga0137363_11151280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 660 | Open in IMG/M |
| 3300012202|Ga0137363_11520260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 561 | Open in IMG/M |
| 3300012203|Ga0137399_10980889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 711 | Open in IMG/M |
| 3300012205|Ga0137362_11026149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 702 | Open in IMG/M |
| 3300012207|Ga0137381_11532647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 558 | Open in IMG/M |
| 3300012208|Ga0137376_11768160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 509 | Open in IMG/M |
| 3300012210|Ga0137378_10820152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 843 | Open in IMG/M |
| 3300012362|Ga0137361_10318567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 1425 | Open in IMG/M |
| 3300012362|Ga0137361_11469638 | Not Available | 604 | Open in IMG/M |
| 3300012363|Ga0137390_11469601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 623 | Open in IMG/M |
| 3300012363|Ga0137390_11473757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 622 | Open in IMG/M |
| 3300012582|Ga0137358_10620637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 725 | Open in IMG/M |
| 3300012917|Ga0137395_10459146 | Not Available | 915 | Open in IMG/M |
| 3300012918|Ga0137396_10447018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 958 | Open in IMG/M |
| 3300012923|Ga0137359_11009712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 714 | Open in IMG/M |
| 3300012925|Ga0137419_11032606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 682 | Open in IMG/M |
| 3300012927|Ga0137416_10308476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 1314 | Open in IMG/M |
| 3300012927|Ga0137416_10984836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 753 | Open in IMG/M |
| 3300012927|Ga0137416_11606946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 592 | Open in IMG/M |
| 3300012927|Ga0137416_11947608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 538 | Open in IMG/M |
| 3300012930|Ga0137407_11568407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 627 | Open in IMG/M |
| 3300012960|Ga0164301_11341052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 582 | Open in IMG/M |
| 3300012984|Ga0164309_10534377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 904 | Open in IMG/M |
| 3300012989|Ga0164305_10093789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1907 | Open in IMG/M |
| 3300013308|Ga0157375_13375101 | Not Available | 532 | Open in IMG/M |
| 3300015264|Ga0137403_10742744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 840 | Open in IMG/M |
| 3300015358|Ga0134089_10292503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 675 | Open in IMG/M |
| 3300015374|Ga0132255_104446315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 594 | Open in IMG/M |
| 3300017792|Ga0163161_11249281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 644 | Open in IMG/M |
| 3300018468|Ga0066662_11802471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 640 | Open in IMG/M |
| 3300021168|Ga0210406_10319746 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300021170|Ga0210400_10480171 | Not Available | 1026 | Open in IMG/M |
| 3300021307|Ga0179585_1028616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 529 | Open in IMG/M |
| 3300021478|Ga0210402_10090295 | All Organisms → cellular organisms → Bacteria | 2738 | Open in IMG/M |
| 3300022722|Ga0242657_1241532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 514 | Open in IMG/M |
| 3300025905|Ga0207685_10710036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 548 | Open in IMG/M |
| 3300025910|Ga0207684_10399135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1182 | Open in IMG/M |
| 3300025915|Ga0207693_10070272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2740 | Open in IMG/M |
| 3300025915|Ga0207693_10141994 | All Organisms → cellular organisms → Bacteria | 1888 | Open in IMG/M |
| 3300025915|Ga0207693_10228935 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
| 3300025915|Ga0207693_10525730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 923 | Open in IMG/M |
| 3300025915|Ga0207693_10997474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 639 | Open in IMG/M |
| 3300025916|Ga0207663_10091681 | All Organisms → cellular organisms → Bacteria | 2018 | Open in IMG/M |
| 3300025922|Ga0207646_10229873 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1676 | Open in IMG/M |
| 3300025928|Ga0207700_11314096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 644 | Open in IMG/M |
| 3300025929|Ga0207664_10235961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1591 | Open in IMG/M |
| 3300025939|Ga0207665_10070390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2387 | Open in IMG/M |
| 3300025939|Ga0207665_10946256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 684 | Open in IMG/M |
| 3300025940|Ga0207691_11238535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora → Saccharopolyspora spinosa | 618 | Open in IMG/M |
| 3300025986|Ga0207658_11068892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 737 | Open in IMG/M |
| 3300026295|Ga0209234_1306283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 510 | Open in IMG/M |
| 3300027671|Ga0209588_1197704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 627 | Open in IMG/M |
| 3300027846|Ga0209180_10097799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 1670 | Open in IMG/M |
| 3300027869|Ga0209579_10330225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 824 | Open in IMG/M |
| 3300027882|Ga0209590_10559530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 737 | Open in IMG/M |
| 3300027903|Ga0209488_10815111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 660 | Open in IMG/M |
| 3300028536|Ga0137415_10922755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 683 | Open in IMG/M |
| 3300031231|Ga0170824_114702437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 538 | Open in IMG/M |
| 3300031718|Ga0307474_10481222 | Not Available | 972 | Open in IMG/M |
| 3300031753|Ga0307477_10159795 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1571 | Open in IMG/M |
| 3300031753|Ga0307477_10828252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 614 | Open in IMG/M |
| 3300031962|Ga0307479_11247745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 706 | Open in IMG/M |
| 3300031962|Ga0307479_11588809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 609 | Open in IMG/M |
| 3300032174|Ga0307470_11697811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 531 | Open in IMG/M |
| 3300032180|Ga0307471_100666399 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
| 3300032205|Ga0307472_101996879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter ramosus | 581 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 33.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 24.65% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.04% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.11% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.41% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.41% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.41% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.41% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.70% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.70% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.70% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.70% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.70% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.70% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021307 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25617J43924_102951461 | 3300002914 | Grasslands Soil | MAWTEVMQSDDARLALKTCIAVDPDSRRDWFESKNSKNYPAYAGH* |
| Ga0062595_1026508661 | 3300004479 | Soil | ADANLQAAFEIENMAWTEVMQSDDARVALKNIIAVDPESRRDWFESENSKHYPAYAGH* |
| Ga0066680_103960472 | 3300005174 | Soil | QAAFEIENMAWTEVMQSDGAQLALKTFIAVDPDSRRDWFESENSKNYPTYAGH* |
| Ga0066678_102863781 | 3300005181 | Soil | IENMNWTEVMQSDDARLALKTFLAVDPASRRDWFETASSKTYPAYSGH* |
| Ga0070710_111274312 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | IEDMNWTEVMQSDDAQLAMTTVLGLKPENARDWFEAESSNDYPTYSGH* |
| Ga0070705_1010232912 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | TEVMQSDDAQLALKSINAVDPDSRRDWFESENSKNYPAYVGH* |
| Ga0070708_1014727651 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | QAAFEIENMAWTEVMQSDDAQLALKTFIAVDPDSRRDWFESENSKNYPTYAGH* |
| Ga0070708_1021752242 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | AFEIENMAWTEVMQSDDAQLALESINAVDPESRRDWFESENSKNYPAYSGH* |
| Ga0070706_1013786252 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | GADTNLQAAFEIENMMWTEVIQSDDVQVALKTFLAVDPASRRDWFESENSKNYPTYSGH* |
| Ga0070706_1015973722 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | QAAFEIENMMWTEVIQSDDAQVALKTFLAVDPDLRRDWFESENSKNYPAYSGH* |
| Ga0070706_1021317421 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | AAFEIENMAWTEVMQSDDAQLALKTFIAVDPDSRRDWFESENSKNYPAYAGH* |
| Ga0070707_1009736492 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MAWTEVMQSDDAQLALKTFIAVNPDSRRDWFESENSKNYPAYAGH* |
| Ga0070707_1011050161 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VMQSDDAKVALKTFLSVDPASRRDWFESANSMNYPTYSGR* |
| Ga0070698_1003951823 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | FEIENMAWTEVMQSDDAQLALTTFLAVDADSRRDWFESENSKNYPAYVGQ* |
| Ga0070698_1006903112 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MQSDDARLALKTCIAVDPDSRRDWFESENSKHYPAYAGH* |
| Ga0070698_1008444621 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | AAFEIENMAWTEVMQSDDAQIALKSINAVDPDSRRDWFESENSKNYPAYVGH* |
| Ga0070699_1006091951 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | NLQAAFEIENMNWTEVIQSDDAKVALSTFLAVDPDERRDWFESANSKNYPTYSGH* |
| Ga0070697_1003036201 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | EVMQSDDAKVALKTFLDVDPGSRRDWFESANSKNYPAYSGH* |
| Ga0070697_1007452192 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | IEDMNWTEVMQSDDAQLAMTTVLGLKPESARDWFEAESSNDYPTYSGH* |
| Ga0070697_1012947531 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | AYEIENMNWTEVMQSDDAQLAMTTILAVDPKSARDWFEESSTGTYPAYSGH* |
| Ga0070731_104918021 | 3300005538 | Surface Soil | AFEVENMNWTEVMQSDDAKVALGTFLAVDPASRRDWFESESTKTYPAYSGH* |
| Ga0070704_1001458335 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | ENMMWTEVIQSDDAQVALKTFLAVDPDSRRDWFESENSKNYPAYSGH* |
| Ga0066707_108872602 | 3300005556 | Soil | LQAAYEIENMQWTEVMQSDDAQLALKTFLAVDPDSRRDWFESENSKNYPAYSGH* |
| Ga0066699_106581823 | 3300005561 | Soil | NMQWTEVMQSDDAQLALQAYIAEGLDARRDWFESASSKRYPAYSGQ* |
| Ga0066903_1015582163 | 3300005764 | Tropical Forest Soil | AQLALKAFIAVDPDSRRDWFESENSKNYPTYSGH* |
| Ga0068863_1006904402 | 3300005841 | Switchgrass Rhizosphere | DAKVALSTFVAVDPDERRDWFESANSKNYPAYSGH* |
| Ga0070717_111439322 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | QAAFEIEDMNWTEVMQSDDAQLAMTTILGLNPENARDWFESENSKNYPTYSGQ* |
| Ga0070717_113731412 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GADANLQAAFEIENMAWTEVMQSDDAQLALKTCVGVDPDSRRDWFESENSKNYPAYAGH* |
| Ga0070717_115565022 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VENMNWTEVMQSDDAKVALKTFLAVNPACRRDWFESANSKNYPTYSGH* |
| Ga0070716_1007239031 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | ADANLQAAFEIENMAWTEVMQSDDAQLALKTCVGVDPDSRRDWFESENSKNYPAYAGH* |
| Ga0070712_1001730251 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | FEIEDMNWTEVMQSDDAQLAMTTILGVDPANARDWFESKSSSSYPTYSGH* |
| Ga0070712_1019118271 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | IEDMNWTEVMQSDDAQLAMTTILGLNPENARDWFESKNSKSYPSYSGH* |
| Ga0079222_103174242 | 3300006755 | Agricultural Soil | AAYEIENMNWTEVMQSDDAKVALSTFVAVDPDERRDWFESANSKNYPAYSGH* |
| Ga0066659_105449781 | 3300006797 | Soil | AAYEIENMNWTEVMQSDDAKVALKTFLDVDPASRRDWFESANSKNYPAYSGH* |
| Ga0075433_109585092 | 3300006852 | Populus Rhizosphere | ENMNWTEVIQSDDAQLALKTCIAVDPESRRDWFESESSKRYPAYSGH* |
| Ga0075433_117032281 | 3300006852 | Populus Rhizosphere | VALSAFLAVDPSSRRDWFESESTKTYPAYSGQRDFRCHS* |
| Ga0075425_1002507103 | 3300006854 | Populus Rhizosphere | NLQAAYEIENMNWTEVMQSDDAKVALSTFVAVDPDERRDWFESANSKNYPAYSGH* |
| Ga0075425_1009695513 | 3300006854 | Populus Rhizosphere | ENMMWTEVIQSDDAQVALRTFLAVDPDSRRDWFESENSKNYPAYSGH* |
| Ga0075425_1022642251 | 3300006854 | Populus Rhizosphere | AAYEIENMNWTEVMQSDDAKVALKTFLDVDPGSRRDWFESANSKNYPAYSGH* |
| Ga0075425_1027501421 | 3300006854 | Populus Rhizosphere | AAYEIENMNWTEVMQSDDAQLALKTFLAVDPASRRDWFETASSKTYPSYSGH* |
| Ga0075424_1006862861 | 3300006904 | Populus Rhizosphere | AFEIEDMNWTEVMQSDDAQLAMTTILGLNPENARDWFESENSKNYPTYTGH* |
| Ga0079219_108699921 | 3300006954 | Agricultural Soil | QGADTNLQAAYEIENMNWTEVMQSDDAQLAMTTILAVDPQSARDWFEEPSTGTYPTYSGH |
| Ga0075435_1012041561 | 3300007076 | Populus Rhizosphere | AYEIENMNWTEVMQSDDAKVALSTFVAVDPDERRDWFESANSKNYPAYSGH* |
| Ga0099791_106389071 | 3300007255 | Vadose Zone Soil | NMNWTEVMQSDDAKVALSTFLAVDQDERRDWFESANSKNYPTYSGH* |
| Ga0066710_1043681002 | 3300009012 | Grasslands Soil | MGADANLEAAFEIENMAWTEVMQSDDARVALESINAVDPESRRDWFESENSKNYPTYAGH |
| Ga0099829_111435772 | 3300009038 | Vadose Zone Soil | ENMAWTEVMQSDDARVALKTCIAVDPDSRRDWFESKNSKNYPAYAGH* |
| Ga0099830_101885291 | 3300009088 | Vadose Zone Soil | QAGFEIENMAWTEVMQSDDARVALKTCVDAEPDSRRNWFESANSPNYPAYSGH* |
| Ga0099828_103071611 | 3300009089 | Vadose Zone Soil | ENMNWTEVMQSDDAKVALKTFLDVKPASRRNWFESANSKNYPTYSGH* |
| Ga0099828_113610492 | 3300009089 | Vadose Zone Soil | LQAAFEIENMAWTEVMQSDDAQLALKTFIAVDPDSRRDWFESENSKNYPAYAGH* |
| Ga0099828_116116072 | 3300009089 | Vadose Zone Soil | FEIENMAWTEVMQSDDAQLALKTFIAVDPDSRRDWFESENSKNYPAYAGH* |
| Ga0099828_117410062 | 3300009089 | Vadose Zone Soil | RALYLGADTNLQAAFEIENMNWTEVIQSDDAQLALKTCIAIDPESRRDWFESESSKSYPAYSGH* |
| Ga0099827_115463602 | 3300009090 | Vadose Zone Soil | QSDDARLALKTCIAVDPDSRRDWFESKNSKNYPAYAGH* |
| Ga0105245_100190557 | 3300009098 | Miscanthus Rhizosphere | YLGADTNLQAAFEVENMMWTEVIQSDDAQVALKTFLAVDPDSRRDWFESENSKNCPAYSGH* |
| Ga0105245_103904791 | 3300009098 | Miscanthus Rhizosphere | NLEAAFEVENINWTEVMQSDDAKVALGAFLAVEPASRRDWFESRSTKTYPAYSGH* |
| Ga0105245_107813452 | 3300009098 | Miscanthus Rhizosphere | EIENMNWTEVMQSDDAKVALSTFVAVDPDERRDWFESANSKNYPAYSGH* |
| Ga0066709_1033888201 | 3300009137 | Grasslands Soil | EIENMMWTEVIQSDDVQVALKTFLAVDPDSRRDWFESENSKNYPTYSGH* |
| Ga0099792_105966891 | 3300009143 | Vadose Zone Soil | SNLRAANEIANMNWTEVMQSDDAQLALSSFLAVDPASRRDWFESASSKSYPAYSGH* |
| Ga0105243_101292991 | 3300009148 | Miscanthus Rhizosphere | DDAQLALKTCIAVDPESRRDWFESESSKSYPAYSGH* |
| Ga0075423_104413671 | 3300009162 | Populus Rhizosphere | AAFEIENMMWTEVIQSDDAQVALKTFLAVDPASRRDWFESENSKNYPTYSGH* |
| Ga0075423_121596161 | 3300009162 | Populus Rhizosphere | ENMNWTEVMQSDDAKVALKTFLDVNPASRRDWFESANSKNYPTYSGH* |
| Ga0116214_13133721 | 3300009520 | Peatlands Soil | AYEIENMNWTEVMQSDDAKVALSTFLAVDPDERRDWFESANSKNYPTYSGH* |
| Ga0099796_102607802 | 3300010159 | Vadose Zone Soil | FEIENMNWTEVIQSDDAQLALKTCIAVDPESRRDWFESESSKTYPAYSGH* |
| Ga0134080_102656082 | 3300010333 | Grasslands Soil | DDAQVALKTFLAVDPASRRDWFESENSKNYPTYSGH* |
| Ga0134128_124940342 | 3300010373 | Terrestrial Soil | LQAAFEVENMNWTEVVQSDDARLALKTCIAVDPESRRDWFESESSKSYPAYSGH* |
| Ga0105239_106167671 | 3300010375 | Corn Rhizosphere | NMMWTEVIQSDDAQVALKTFRSVDPDSRREWFESESSKTYPEYSGH* |
| Ga0134127_122055262 | 3300010399 | Terrestrial Soil | LQAAFEIENMNWTEVMQSDDAKVALSTFLDVDPGSRRDWFESANSKNYPAYSGH* |
| Ga0137392_101263574 | 3300011269 | Vadose Zone Soil | TEVMQSDDAQLALKSINAVDPDSRRDWFESENSKNYPAYAGH* |
| Ga0137392_102299842 | 3300011269 | Vadose Zone Soil | VMQSDDAQLALKTFLEVDPASRRDWFETKGSKTYPTYSGH* |
| Ga0137392_109898221 | 3300011269 | Vadose Zone Soil | FEIENMAWTEVMQSDDARVALESINAVDPESRRDWFESPNSKNYPAYAGH* |
| Ga0137391_100812684 | 3300011270 | Vadose Zone Soil | NLQAAYEIENMNWTEVMQSDDAKVALKTFLDVNPASRRDWFESANSKNYPTYSGH* |
| Ga0137391_100984382 | 3300011270 | Vadose Zone Soil | VATNDGQLALKTFIAVDPDSRRDWFDSENSKNYPAYAGH* |
| Ga0137391_107563592 | 3300011270 | Vadose Zone Soil | GADTNLQAAFEIENMMWTEVIQSDDAQVALKTFLAVDADSRRDWFESENSKNYPTYSGH* |
| Ga0137393_109767681 | 3300011271 | Vadose Zone Soil | NLQAAYEIENMNWTEVMQSDDAKVALKTFLDVDPASRRDWFESANSKNYPAYSGH* |
| Ga0137393_117769432 | 3300011271 | Vadose Zone Soil | EVENMNWTEVMQSDDAKLALSTFLAMDPASRREWFESESTKTYPAYSGH* |
| Ga0137389_105897912 | 3300012096 | Vadose Zone Soil | ANLQAALEIENMAWTEVVQSDDAQLALKTFIAVDPDSRRDWFESENSKNYPAYAGH* |
| Ga0137388_103659543 | 3300012189 | Vadose Zone Soil | DSNLQAAFEVENMNWTEVMQSDDAQVALSTFLAVDPASRRDWFESESTKTYPAYTGH* |
| Ga0137363_111512802 | 3300012202 | Vadose Zone Soil | NWTEVMQSDDAKVALKTFLDVNPASRRDWFESANSKNYPTYSGR* |
| Ga0137363_115202601 | 3300012202 | Vadose Zone Soil | AAFEIENMAWTEVMQSDDARVALESINAVDPESRRDWFESENSKNYPAYAGH* |
| Ga0137399_109808891 | 3300012203 | Vadose Zone Soil | DTNLQAAFEIENMAWTEVMQSDDAQLALKTFVAVDPDSRRDWFESENSKNYPAYAGH* |
| Ga0137362_110261491 | 3300012205 | Vadose Zone Soil | EVIQSDDAQVALKAILAVDPDSGRDWFESENSKNYPTYSGH* |
| Ga0137381_115326471 | 3300012207 | Vadose Zone Soil | ENMNWTEVMQSDDARVALSTFLAVDPASRRDWFESESTKTYPAYAGH* |
| Ga0137376_117681601 | 3300012208 | Vadose Zone Soil | DDAKVALKTFLDVDPGSRRDWFESANSKNYPAYSGH* |
| Ga0137378_108201522 | 3300012210 | Vadose Zone Soil | AAFEIENMMWTEVIQSDDAQLALKTFLAVDADSRRDWFESENSKNYPTYSGR* |
| Ga0137361_103185674 | 3300012362 | Vadose Zone Soil | WTEVMQSDDAKVALKTFLDVNPASRRDWFESANSKNYPTYSGR* |
| Ga0137361_114696381 | 3300012362 | Vadose Zone Soil | EIENMAWTEVMQSDDAQLALKTFLAVDPESRRDWFESENSKNYPAYSGH* |
| Ga0137390_114696011 | 3300012363 | Vadose Zone Soil | SDDAQIALKSINAVDPDSRRDWFESENSKNYPVYAGH* |
| Ga0137390_114737572 | 3300012363 | Vadose Zone Soil | YLVATNDGQLALKTFIAVDPDSRRDWFDSENSKNYPAYAGH* |
| Ga0137358_106206372 | 3300012582 | Vadose Zone Soil | NMAWTEVMQSDDAQLALKSINAVDPESRRDWFESENSKNYPAYAGH* |
| Ga0137395_104591462 | 3300012917 | Vadose Zone Soil | VMQSDDARLALKTYIAEGLDSRRDWFESENSKNYPTYSGK* |
| Ga0137396_104470182 | 3300012918 | Vadose Zone Soil | TEVIQSDDAQLALKACIAVNPDSRRDWFESENSNTYPTYTGH* |
| Ga0137359_110097121 | 3300012923 | Vadose Zone Soil | LQAAFEFENMAWTEVMQSDDAQLALKTCVAVAPDSRRDWFESENSKNYPAYAGH* |
| Ga0137419_110326062 | 3300012925 | Vadose Zone Soil | MNWTEVMQSDDAKVALKTFLDVDPASRRDWFESANSKNYPAYSGH* |
| Ga0137416_103084761 | 3300012927 | Vadose Zone Soil | EIENMAWTEVMQSDDAQLALKTFLAVDPDARRDWFESENSKNYPAYAGH* |
| Ga0137416_109848362 | 3300012927 | Vadose Zone Soil | FEIENMNWTEVIQSDDAQLALKTCIALDPESRRDWFESESSKSYPAYSGH* |
| Ga0137416_116069462 | 3300012927 | Vadose Zone Soil | SDDARVALESINAVEPGSRRDWFESANSKNYPAYAGH* |
| Ga0137416_119476082 | 3300012927 | Vadose Zone Soil | YLGADANLQAAFEIENMAWTEVMQSDDAQLALKTCIAVDPDSRRDWFESENSKNYPAYAGH* |
| Ga0137407_115684072 | 3300012930 | Vadose Zone Soil | ENMAWTEVMQSDDAQLALKTFIAVDPDSRRDWFESENSKNYPAYAGH* |
| Ga0164301_113410522 | 3300012960 | Soil | QAAFEIENMMWTEVIQSDDAQVALKTFVAVDPDSRRDWFESENSKNYPTYSGH* |
| Ga0164309_105343772 | 3300012984 | Soil | HLQAAFEIEDMNWTEVMQSDDAQLAMTTILGLNPENARDWFESENSKNYPTYSGH* |
| Ga0164305_100937891 | 3300012989 | Soil | LGADTNLQAAFEVENMMWTEVIQSDDAQVALKTFLAVDPDSRRDWFESENSKNYPAYSGH |
| Ga0157375_133751011 | 3300013308 | Miscanthus Rhizosphere | IQSDDAQVALKTFRSVDPDSRRDWFESESSKTYPEYTGH* |
| Ga0137403_107427441 | 3300015264 | Vadose Zone Soil | ALYLGADSSLQAASEVENMNWADVMQSEDAQLALKTFLAVDPGSRRDWFESANTKNYPTYSGH* |
| Ga0134089_102925031 | 3300015358 | Grasslands Soil | TEVIQSDDAQVALKTFLAVDPASRRDWFESENSKNYPTYSGH* |
| Ga0132255_1044463152 | 3300015374 | Arabidopsis Rhizosphere | WTEVMQSDDAQLALRTYIAEEPDSRRDWFESKNSKNYPTYTGH* |
| Ga0163161_112492811 | 3300017792 | Switchgrass Rhizosphere | QAAFEVENMMWTEVIQSDDAQVALKTFLAVDPDSRRDWFESENSKNCPAYSGH |
| Ga0066662_118024712 | 3300018468 | Grasslands Soil | DDAQLALKTFLAVDPDSRRDWFESENSKNYPAYAGH |
| Ga0210406_103197463 | 3300021168 | Soil | IENMNWTEVMQSDDAKVALSTFVAVDPDERRDWFESANSKNYPAYSGH |
| Ga0210400_104801712 | 3300021170 | Soil | DDAQLALETYIAEDLDSRRDWFESESAKNYPTYSGH |
| Ga0179585_10286162 | 3300021307 | Vadose Zone Soil | QSDDAQLALKTFLAVDPDSRRDWFESENSKNYPAYAGH |
| Ga0210402_100902954 | 3300021478 | Soil | AYEIENMNWTEVMQSDDAKVALSTFVAVDPDERRDWFESANSKSYPAYSGH |
| Ga0242657_12415322 | 3300022722 | Soil | ENMNWTEVMQSDDAKVALSTFVAVDPDERRDWFESANSKNYPAYSGH |
| Ga0207685_107100362 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | NWTEVMQSDDAQLAMTTILAVDPKSARDWFEESSTGTYPTYSGH |
| Ga0207684_103991351 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | TEVMQSDDAQLALKTCIAVDPDSRRDWFESENSKHYPAYAGH |
| Ga0207693_100702725 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | DMNWTEVMQSDDAQLAMTTILGVDPANARDWFESKSSSSYPTYSGH |
| Ga0207693_101419943 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | ENMNWTEVMQSDDAQLAMTTILAVDPKSARDWFEESSTGTYPTYSGH |
| Ga0207693_102289353 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | ASEIEDMNWTEVMQSDDAQLAMTTILGLNPENARDWFESKNSKSYPSYSGH |
| Ga0207693_105257301 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LYMGADANLEAAFEIENMAWTEVMQSDDAELALKSINAVDPDSRRDWFESENSKNYPAYVGH |
| Ga0207693_109974743 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | AAFEIENMAWTEVMQSNDAQLALKTCVGVDPDSRRDWFESENSKNYPAYAGH |
| Ga0207663_100916814 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | AYEIENMNWTEVMQSDDAKVALSTFVAVDPDERRDWFESANSKNYPAYSGH |
| Ga0207646_102298733 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | WVLRGGIVRPEVMQSDDAQLALSSFLSVDPASRRDWFESSSTKTYPAYSGH |
| Ga0207700_113140961 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | TEVMQSDDAQLAMTTILAVDPKSARDWFEETSTGTYPVYSGH |
| Ga0207664_102359612 | 3300025929 | Agricultural Soil | MNWTEVMQSDDAKVALKTFLDVNPASRRDWFESANSKNYPAYSGH |
| Ga0207665_100703903 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | NMNWTEVMQSDDAKVALKTFLDVDPGSRRDWFESVNSKNYPAYSGH |
| Ga0207665_109462562 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | DTNLQAAFEIENMNWTEVIQSDDAQLALKTCIAVDPESRRDWFESESSKSYPAYSGH |
| Ga0207691_112385351 | 3300025940 | Miscanthus Rhizosphere | ADTNLQAAFEIENMMWTEVIQSDDAQLALETCVAVDPDSRRDWFESDSSNSYPTYTGH |
| Ga0207658_110688921 | 3300025986 | Switchgrass Rhizosphere | VENMMGTEVIQSDDAQVALKTFLAVDPDSRRDWFESENSKNCPAYSGH |
| Ga0209234_13062832 | 3300026295 | Grasslands Soil | MAWTEVMQSDDAQLALKTFIAVDPDSRRDWFESENSKNYPTYDGH |
| Ga0209588_11977041 | 3300027671 | Vadose Zone Soil | AAFEIENMAWTEVMQSDDAQLALKTFLAVDPDSRRDWFESENSKNYPAYAGH |
| Ga0209180_100977991 | 3300027846 | Vadose Zone Soil | QAAYEIENMNWTEVMQSDDAKVALKTFLDVNPASRRDWFESANSKNYPTYSGH |
| Ga0209579_103302252 | 3300027869 | Surface Soil | MNWAEVMQSDDAKLALSTFLAVDPASRRDWFEPESTKTYPAYAGH |
| Ga0209590_105595301 | 3300027882 | Vadose Zone Soil | SDDAQLALKTCIAVDPDSRRDWFESKNSKNYPAYAGH |
| Ga0209488_108151112 | 3300027903 | Vadose Zone Soil | VMQSDDAQLALGNFLGVDPASRRDWFESASSKSYPAYSGH |
| Ga0137415_109227552 | 3300028536 | Vadose Zone Soil | AFEIENMAWTEVMQSDDARVALESINAVEPGSRRDWFESANSKNYPAYAGH |
| Ga0170824_1147024371 | 3300031231 | Forest Soil | EIENMNWTEVMQSDDAKLALRTFLAVDPTSRREWFESVSTKTYPAYSGN |
| Ga0307474_104812221 | 3300031718 | Hardwood Forest Soil | EDMNWTEVMQSDDAQLAMTTILAVDPKSARDWFEESSTGTYPTYSGH |
| Ga0307477_101597953 | 3300031753 | Hardwood Forest Soil | SDDAQVALKTSVAVDPDSRRDWFESENSKNYPTYSGH |
| Ga0307477_108282522 | 3300031753 | Hardwood Forest Soil | SNLQAAFEVENMNWTEVMQSDDAKVALSTFLAVDPASRREWFESESTKTYPAYSGH |
| Ga0307479_112477451 | 3300031962 | Hardwood Forest Soil | AAFEVENMNWTEVMQSDDAKLALSTFLAVDPASRREWFESESTKTYPAYSGH |
| Ga0307479_115888091 | 3300031962 | Hardwood Forest Soil | ETENMNWTEVMQSDDAQLALKTFLAVEPASRRDWFETPSTKTYPAYAGS |
| Ga0307470_116978111 | 3300032174 | Hardwood Forest Soil | SNLQAAYEIENMNWTEVMQSDDAKVALSTFVAVDPDERRDWFESANSKNYPAYSGH |
| Ga0307471_1006663991 | 3300032180 | Hardwood Forest Soil | FEIENMAWTEVMQSDDARLALKSINAVDPDSRRDWFESENSKNYPAYVGH |
| Ga0307472_1019968791 | 3300032205 | Hardwood Forest Soil | FEIENMAWTEVMQSDDAQLALKSINAVDPDSRRDWFESENSKNYPAYVGH |
| ⦗Top⦘ |