| Basic Information | |
|---|---|
| Family ID | F052788 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 142 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MHRLYLVRPVKPTPLPSEKRSAKVIELRVRREARRALRRVPRPDRPDAA |
| Number of Associated Samples | 119 |
| Number of Associated Scaffolds | 142 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 83.82 % |
| % of genes near scaffold ends (potentially truncated) | 19.72 % |
| % of genes from short scaffolds (< 2000 bps) | 90.14 % |
| Associated GOLD sequencing projects | 117 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.648 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (10.563 % of family members) |
| Environment Ontology (ENVO) | Unclassified (19.718 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.451 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.17% β-sheet: 0.00% Coil/Unstructured: 68.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 142 Family Scaffolds |
|---|---|---|
| PF10127 | RlaP | 21.83 |
| PF05731 | TROVE | 8.45 |
| PF01661 | Macro | 6.34 |
| PF01139 | RtcB | 4.23 |
| PF00583 | Acetyltransf_1 | 1.41 |
| PF00291 | PALP | 0.70 |
| PF02812 | ELFV_dehydrog_N | 0.70 |
| PF01494 | FAD_binding_3 | 0.70 |
| PF00749 | tRNA-synt_1c | 0.70 |
| PF01979 | Amidohydro_1 | 0.70 |
| PF01364 | Peptidase_C25 | 0.70 |
| PF02867 | Ribonuc_red_lgC | 0.70 |
| PF13358 | DDE_3 | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 142 Family Scaffolds |
|---|---|---|---|
| COG2110 | O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domain | Translation, ribosomal structure and biogenesis [J] | 6.34 |
| COG1690 | RNA-splicing ligase RtcB, repairs tRNA damage | Translation, ribosomal structure and biogenesis [J] | 4.23 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.41 |
| COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.70 |
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.70 |
| COG0334 | Glutamate dehydrogenase/leucine dehydrogenase | Amino acid transport and metabolism [E] | 0.70 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.70 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.70 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.70 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.65 % |
| Unclassified | root | N/A | 25.35 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_105107867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1300 | Open in IMG/M |
| 3300004114|Ga0062593_101205292 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300004156|Ga0062589_102745566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 513 | Open in IMG/M |
| 3300004157|Ga0062590_100292871 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
| 3300004157|Ga0062590_101405801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 694 | Open in IMG/M |
| 3300004643|Ga0062591_100110055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1810 | Open in IMG/M |
| 3300005093|Ga0062594_100193292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1407 | Open in IMG/M |
| 3300005179|Ga0066684_10020522 | All Organisms → cellular organisms → Bacteria | 3430 | Open in IMG/M |
| 3300005179|Ga0066684_10943344 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300005184|Ga0066671_10136107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 1414 | Open in IMG/M |
| 3300005187|Ga0066675_10191352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 1432 | Open in IMG/M |
| 3300005332|Ga0066388_100270859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2340 | Open in IMG/M |
| 3300005332|Ga0066388_100550727 | Not Available | 1783 | Open in IMG/M |
| 3300005332|Ga0066388_106973166 | Not Available | 568 | Open in IMG/M |
| 3300005364|Ga0070673_102402746 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300005434|Ga0070709_11611264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 529 | Open in IMG/M |
| 3300005440|Ga0070705_101761232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
| 3300005445|Ga0070708_100812276 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300005451|Ga0066681_10245377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1085 | Open in IMG/M |
| 3300005471|Ga0070698_101347946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 664 | Open in IMG/M |
| 3300005526|Ga0073909_10586227 | Not Available | 549 | Open in IMG/M |
| 3300005529|Ga0070741_10431495 | Not Available | 1205 | Open in IMG/M |
| 3300005530|Ga0070679_101684299 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300005540|Ga0066697_10357907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 850 | Open in IMG/M |
| 3300005545|Ga0070695_100833299 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300005546|Ga0070696_100649940 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300005560|Ga0066670_10480527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 765 | Open in IMG/M |
| 3300005575|Ga0066702_10375177 | Not Available | 866 | Open in IMG/M |
| 3300005576|Ga0066708_10903451 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Alienimonas → Alienimonas californiensis | 551 | Open in IMG/M |
| 3300005598|Ga0066706_10502470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 966 | Open in IMG/M |
| 3300005615|Ga0070702_101684358 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300005713|Ga0066905_100970762 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300005764|Ga0066903_101733745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1190 | Open in IMG/M |
| 3300005764|Ga0066903_101884374 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300005764|Ga0066903_106030941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 635 | Open in IMG/M |
| 3300005764|Ga0066903_106156761 | Not Available | 627 | Open in IMG/M |
| 3300005764|Ga0066903_107848066 | Not Available | 548 | Open in IMG/M |
| 3300006046|Ga0066652_100485335 | Not Available | 1145 | Open in IMG/M |
| 3300006173|Ga0070716_101323869 | Not Available | 583 | Open in IMG/M |
| 3300006176|Ga0070765_101775060 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300006797|Ga0066659_11143163 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300006800|Ga0066660_10717429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 819 | Open in IMG/M |
| 3300006804|Ga0079221_11506377 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300006852|Ga0075433_10767938 | Not Available | 843 | Open in IMG/M |
| 3300006871|Ga0075434_100197584 | Not Available | 2031 | Open in IMG/M |
| 3300006904|Ga0075424_100985036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 899 | Open in IMG/M |
| 3300007076|Ga0075435_100542418 | Not Available | 1007 | Open in IMG/M |
| 3300009012|Ga0066710_100593438 | Not Available | 1679 | Open in IMG/M |
| 3300009012|Ga0066710_100886500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1372 | Open in IMG/M |
| 3300009137|Ga0066709_102245709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 751 | Open in IMG/M |
| 3300010043|Ga0126380_11833759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 549 | Open in IMG/M |
| 3300010326|Ga0134065_10430965 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300010337|Ga0134062_10663872 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300010359|Ga0126376_10249332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1509 | Open in IMG/M |
| 3300010359|Ga0126376_12448732 | Not Available | 569 | Open in IMG/M |
| 3300010360|Ga0126372_12724808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. ap11 | 546 | Open in IMG/M |
| 3300010376|Ga0126381_103236633 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300010396|Ga0134126_10816498 | Not Available | 1053 | Open in IMG/M |
| 3300010396|Ga0134126_11464714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 753 | Open in IMG/M |
| 3300012199|Ga0137383_10699350 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300012200|Ga0137382_10788894 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300012200|Ga0137382_10806023 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300012202|Ga0137363_11415682 | Not Available | 585 | Open in IMG/M |
| 3300012205|Ga0137362_11132375 | Not Available | 665 | Open in IMG/M |
| 3300012207|Ga0137381_10734850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 857 | Open in IMG/M |
| 3300012208|Ga0137376_11165729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 659 | Open in IMG/M |
| 3300012210|Ga0137378_10238128 | Not Available | 1694 | Open in IMG/M |
| 3300012212|Ga0150985_120264546 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300012351|Ga0137386_11312405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
| 3300012362|Ga0137361_10418605 | Not Available | 1231 | Open in IMG/M |
| 3300012948|Ga0126375_10374245 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300012955|Ga0164298_10959117 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300012958|Ga0164299_10662932 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300012960|Ga0164301_11700188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 527 | Open in IMG/M |
| 3300012975|Ga0134110_10072831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1369 | Open in IMG/M |
| 3300012984|Ga0164309_11490760 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300012988|Ga0164306_10668998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 822 | Open in IMG/M |
| 3300013104|Ga0157370_10237162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 1688 | Open in IMG/M |
| 3300013105|Ga0157369_11404504 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300013307|Ga0157372_11149208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 898 | Open in IMG/M |
| 3300014745|Ga0157377_11164047 | Not Available | 595 | Open in IMG/M |
| 3300015357|Ga0134072_10033971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1347 | Open in IMG/M |
| 3300015371|Ga0132258_11339866 | All Organisms → cellular organisms → Bacteria | 1809 | Open in IMG/M |
| 3300016294|Ga0182041_11865556 | Not Available | 558 | Open in IMG/M |
| 3300017659|Ga0134083_10593695 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300017959|Ga0187779_10031109 | All Organisms → cellular organisms → Bacteria | 3073 | Open in IMG/M |
| 3300017959|Ga0187779_10479243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 821 | Open in IMG/M |
| 3300017959|Ga0187779_10748068 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300017965|Ga0190266_11197039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 526 | Open in IMG/M |
| 3300017974|Ga0187777_10285386 | Not Available | 1126 | Open in IMG/M |
| 3300017974|Ga0187777_10365271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 994 | Open in IMG/M |
| 3300017974|Ga0187777_11033228 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300017974|Ga0187777_11235429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
| 3300018027|Ga0184605_10258598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 791 | Open in IMG/M |
| 3300018029|Ga0187787_10079204 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300018060|Ga0187765_10087947 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1671 | Open in IMG/M |
| 3300018433|Ga0066667_10658932 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300019888|Ga0193751_1027471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2713 | Open in IMG/M |
| 3300020069|Ga0197907_10035658 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300020069|Ga0197907_10121923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 919 | Open in IMG/M |
| 3300020069|Ga0197907_10625606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 1202 | Open in IMG/M |
| 3300020070|Ga0206356_11167665 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300020581|Ga0210399_11032852 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300021344|Ga0193719_10103187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 1240 | Open in IMG/M |
| 3300021432|Ga0210384_11756790 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300021560|Ga0126371_10860209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 1052 | Open in IMG/M |
| 3300021560|Ga0126371_13589420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
| 3300021560|Ga0126371_13663887 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300021953|Ga0213880_10006885 | All Organisms → cellular organisms → Bacteria | 2196 | Open in IMG/M |
| 3300022532|Ga0242655_10242872 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300022714|Ga0242671_1103854 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300025939|Ga0207665_11359347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 566 | Open in IMG/M |
| 3300026330|Ga0209473_1045111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1941 | Open in IMG/M |
| 3300027869|Ga0209579_10674793 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300027910|Ga0209583_10754494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 513 | Open in IMG/M |
| 3300028773|Ga0302234_10425912 | Not Available | 568 | Open in IMG/M |
| 3300029943|Ga0311340_10200753 | All Organisms → cellular organisms → Bacteria | 2009 | Open in IMG/M |
| 3300029957|Ga0265324_10216977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 650 | Open in IMG/M |
| 3300030524|Ga0311357_10934327 | Not Available | 768 | Open in IMG/M |
| 3300031089|Ga0102748_11352170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. ap11 | 553 | Open in IMG/M |
| 3300031251|Ga0265327_10193235 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300031561|Ga0318528_10377844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 761 | Open in IMG/M |
| 3300031720|Ga0307469_11543163 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300031794|Ga0318503_10194716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 657 | Open in IMG/M |
| 3300031912|Ga0306921_12606177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
| 3300031962|Ga0307479_11307541 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300032008|Ga0318562_10757376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 557 | Open in IMG/M |
| 3300032067|Ga0318524_10775935 | Not Available | 507 | Open in IMG/M |
| 3300032180|Ga0307471_103145191 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300032770|Ga0335085_10047148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5856 | Open in IMG/M |
| 3300032829|Ga0335070_10273258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 1647 | Open in IMG/M |
| 3300032898|Ga0335072_10963648 | Not Available | 789 | Open in IMG/M |
| 3300032955|Ga0335076_10576184 | Not Available | 1008 | Open in IMG/M |
| 3300033004|Ga0335084_10935152 | Not Available | 876 | Open in IMG/M |
| 3300033134|Ga0335073_10659557 | Not Available | 1154 | Open in IMG/M |
| 3300034090|Ga0326723_0299206 | Not Available | 722 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.56% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 7.75% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.04% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.04% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.34% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.23% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.23% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.52% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.82% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.82% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.11% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.11% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.11% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.41% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.41% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.70% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.70% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.70% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.70% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.70% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.70% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.70% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.70% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.70% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021953 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07 | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022714 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Host-Associated | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300031089 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 2B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1051078672 | 3300000956 | Soil | MYRLYLVRPVKPTPLPSEKRSAKVIELRVRREARRALRERPRPDRPDAA* |
| soilL2_101143211 | 3300003319 | Sugarcane Root And Bulk Soil | MRRLYLVRPAKPTPVPYEKHAAKVIALRVRREARADVARVRRPDRPDAA* |
| Ga0062593_1012052921 | 3300004114 | Soil | MYRLYLVRPVKPMPLPSEKRSAKVIELRVRREARRALRLAPRPDR |
| Ga0062589_1027455661 | 3300004156 | Soil | GRALTTERRTRMHRLYLVRPAKPTPLPSEKRSAKVIELRVRREARRTLRERPRPDRPDAA |
| Ga0062590_1002928712 | 3300004157 | Soil | MYRLYLVRPVKPMPLPSEKRSAKVIELRVRREARRALRLAPRPDRPDAA* |
| Ga0062590_1014058011 | 3300004157 | Soil | RMHRLYLVRPVKPTPLPSEKRSAKVIELRVRREARRTLRERPRPDRPDAA* |
| Ga0062591_1001100554 | 3300004643 | Soil | MHRLYLVRPVKPTPLPSEKRSAKVIELRVRREARRTLRERPRPDRPDAA* |
| Ga0062594_1001932922 | 3300005093 | Soil | MYHLHLVRPVKASPLPSEKRSARVIDLRARREARRALRSLPRPDRPDAA* |
| Ga0066684_100205223 | 3300005179 | Soil | MYRLYLVRPVKPTPLPSEKRSAKVIELRVRREARRALRQAPRPHRPDAA* |
| Ga0066684_109433441 | 3300005179 | Soil | MHRLYLVRPVKPTPLPSEKRSAKVIELRVRREARRAQRRAPRPDRPDAA* |
| Ga0066671_101361072 | 3300005184 | Soil | MHRLYLVRPVKPTPLPSEKRSAKVIELRVRREARRALRRVPRPDRPDAA* |
| Ga0066675_101913522 | 3300005187 | Soil | MHLHLVRPVKPMPLPSEKRSAKVIELRVRREARRALRERPRPDGPDAA* |
| Ga0066388_1001345924 | 3300005332 | Tropical Forest Soil | MRRLYLVRPGKPTPPPHEQHAAKVIALRARRAARAEPVRVRRPDGPDAA* |
| Ga0066388_1002708592 | 3300005332 | Tropical Forest Soil | MHRLYLVRPVKPEPLPSEKRSAKVIELRVRREAQRALREIPPRADRPDAA* |
| Ga0066388_1005507272 | 3300005332 | Tropical Forest Soil | MHRLYLVRPVKPEPQPSEKYSAKVIELRVRREARREKRRILRPDRPDAA* |
| Ga0066388_1069731661 | 3300005332 | Tropical Forest Soil | PVKPTPPPYEKHSAKVISLRARREARRDAWRVRQPDRPDAA* |
| Ga0070673_1024027462 | 3300005364 | Switchgrass Rhizosphere | MFRMYLVRSVTPTPRPSEKHSAKVIELRVRREARRHLRLVPTPDRP |
| Ga0070709_116112642 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRLYLVRSVKPTPLPSEKRSAKVIELRVRQEARRDLQRRLRPDRPDAA* |
| Ga0070705_1017612321 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRLYLVRPVKPTPLPSEKRSAKVIELRVRREARRALRERPRPDRPDAA* |
| Ga0070708_1008122762 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRRLYLVRPDPRPRPEDRSAKVIQLRVRRELRLERRLPPRPDRPDAA* |
| Ga0066681_102453772 | 3300005451 | Soil | MYRLYLVRPVKPMPLPSEKRSAKVIELRVRREARRALRRAPRSDRPDAA* |
| Ga0070698_1013479462 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRLHLVRPVKPTPPPYEKNSAKVIALRVRREARYDVRRASRPDRPDAA* |
| Ga0073909_105862271 | 3300005526 | Surface Soil | MHRLYLVRSVTPTPRPSEKRSAKVIELRVRREARRQSQRVPQPDRPDAA* |
| Ga0070741_100305381 | 3300005529 | Surface Soil | MRRLYLVRPVKPTPPPHEKHAAKVIELRARRAARTDLVRVRRSDRPDAA* |
| Ga0070741_104314952 | 3300005529 | Surface Soil | MLVEASPPRRAPTIERKETRMQRLYLVRPVKSVPLPSEKRSAKVIELRVRREARRDARRPPRPDRPDAA* |
| Ga0070679_1016842992 | 3300005530 | Corn Rhizosphere | MTRLYLVRSVTPTPRPSEKRSAKVIELRVRREARRERLRFLRPDRPDAA* |
| Ga0070739_102129422 | 3300005532 | Surface Soil | MRRLYLVRPEKPTPPPREQHAAKVIALRARREARADLVRVRRFDGPDAA* |
| Ga0066697_103579072 | 3300005540 | Soil | MHLHLVRPVKPMPLPSEKRSAKVIELRVRREARRALRRAPRSDRPDAA* |
| Ga0070695_1008332992 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MYRLYLVRPVKPMPLPSEKRSAKVIELRGRREARRAQRQAPRPDRPDAA* |
| Ga0070696_1006499403 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRLYLVRPVKPMPLPSEKRSAKVIELRVRREARRAQRQAPRPDRPDAA* |
| Ga0066670_104805272 | 3300005560 | Soil | MHRLYLVRPVKPTPLPSEKRSAKVIELRVRREARRALRQAPRPHRPDAA* |
| Ga0066702_103751772 | 3300005575 | Soil | MYRLYLVRPVKPTPLPSEKRSAKVIELRVRREARRALCRDPRPDRPDAA* |
| Ga0066708_109034511 | 3300005576 | Soil | MYRLYLVRPVKSMPLPSEKRSAKVIELRVRREARRTLRRVPRPDRPDAA* |
| Ga0066706_105024702 | 3300005598 | Soil | MYRLYLVRPVKPMPLPSEKRSAKVIELRVRREARRALRRVPRPDRPDAA* |
| Ga0070702_1016843581 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MFRLHLVRPVKPAPKPRDEHSAKVIELRARREARRAAQRARQFDRPDAA* |
| Ga0066905_1009707622 | 3300005713 | Tropical Forest Soil | MHRLYLVRPVKPEPQPSEKYSAKVIELRVRREARREKRRILQSDRPDAA* |
| Ga0066903_1017337455 | 3300005764 | Tropical Forest Soil | MYRLYLVRPAKSTPPSSMKRSAKVIELRVRREARRDAQRARRPDRPDAA* |
| Ga0066903_1018843743 | 3300005764 | Tropical Forest Soil | MHGLYVVRSVKPSPLPSEKSSAKVISLRVRREARRQAVRPPRPDRPAAA* |
| Ga0066903_1060309412 | 3300005764 | Tropical Forest Soil | MYRLYLVRPVRSTPRPSEKRSAKVIELRVRREARREASRHRRPHRPDAA* |
| Ga0066903_1061567613 | 3300005764 | Tropical Forest Soil | MHRLYLVRPVKPEPQPSEKYSAKVIELRVRREARREKRRILRSDRPDAA* |
| Ga0066903_1078480661 | 3300005764 | Tropical Forest Soil | REARPHNRKETRMHRLYLVRPVKPEPQPSEKYSAKVIELRIRREARREKRRILQSDRPDAA* |
| Ga0066652_1004853352 | 3300006046 | Soil | MYRLYLVRPVKPMPLPSEKRSAKVIELRVRREARRARRRDPRPHRPDAA* |
| Ga0070716_1013238691 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | ERRTRMHRLYLVRPVKPTPLPSEKRSAKVIELRVRREARRELRRGLRPDRPDAA* |
| Ga0070765_1017750602 | 3300006176 | Soil | MHRLYLVRSVKPTPRPSEKHSAKVIELRVRREARRQLRHVPEPERPDAA* |
| Ga0066659_111431632 | 3300006797 | Soil | MYRLYLVRPVKPTPLPSEKRSAKVIELRVRREARRALCRDLRPDRPDAA* |
| Ga0066660_107174292 | 3300006800 | Soil | MYRLYLVRPVKPTPLPSEKRSAKVIELRVRREARRALRRAPRSDRPDAA* |
| Ga0079221_115063772 | 3300006804 | Agricultural Soil | MYRLYLVRPVRNVPLPSEKRSAKVIELRVRREAREAARRPQPAPDRPRAA* |
| Ga0075433_107679381 | 3300006852 | Populus Rhizosphere | TRMHRLYLVRPVKPTPLPSEKRSAKVIELRVRREARRALRERPRPDRPDAA* |
| Ga0075434_1001975842 | 3300006871 | Populus Rhizosphere | MHRLYVVRSVKPSPQPSEKSSAKVIALRARQEARRQAMPQPRPDRPAAA* |
| Ga0075424_1009850361 | 3300006904 | Populus Rhizosphere | VRPVKPTPRPNAKHSAKVIELRVRREARRDARRPRRPDRPDAA* |
| Ga0075435_1005424181 | 3300007076 | Populus Rhizosphere | MQRLYLVRPVKPTPLPSEKRSAKVIELRVRREARRALRERPRSDRPDAA* |
| Ga0066710_1005934382 | 3300009012 | Grasslands Soil | MYRLYLVRPVKPMPLPSEKRSAKVIELRVRREARRALRERPRPDRPDAA |
| Ga0066710_1008865002 | 3300009012 | Grasslands Soil | MHRLYLVRPAKPTPLPSEKRSAKVIELRVRREARRALRRAPRPDRPDAA |
| Ga0066709_1022457092 | 3300009137 | Grasslands Soil | MHLHLVRPVKPMPLPSEKRSAKVIELRVRREARRALRERPRPDRPDAA* |
| Ga0126380_118337592 | 3300010043 | Tropical Forest Soil | MHRLYLVRPVKPEPQPREKYSAKVIELRVRREARREKRRILRSDRPDAA* |
| Ga0134065_104309651 | 3300010326 | Grasslands Soil | MYRLYLVRPVKAAPLPSEKRSAKVIALRVRREARRAALREPRPDR |
| Ga0134062_106638722 | 3300010337 | Grasslands Soil | MFRLYLVRPVKPTPLPSEKRSAKVIELRVRREARRALRRAPRSDRPDAA* |
| Ga0126376_102493321 | 3300010359 | Tropical Forest Soil | RMYRLYLVRPVKPTPRPSELRSAKVIELRVRREARRDASRLPRTGRPGAA* |
| Ga0126376_124487322 | 3300010359 | Tropical Forest Soil | MYRLYLVRPVRNEPLPSEKRSAKVIQLRARREAREAARRAQPAPDRPRAA* |
| Ga0126372_127248082 | 3300010360 | Tropical Forest Soil | MHRLYLVQPVKPEPQPSEKYSAKVIELRVRREARREKRRILRSDRPDAA* |
| Ga0126381_1032366331 | 3300010376 | Tropical Forest Soil | MYRVHLVRPVKAPPLPSEKRSAKVIELRARREARRQLRSLPRPDRPDAA* |
| Ga0134126_108164985 | 3300010396 | Terrestrial Soil | VESVQRRAHNNRKETRMHRLYLVRPLKPSPLPSEKQSAKVIELRVRREQRRAPLRRLSRPDRPDAA* |
| Ga0134126_114647142 | 3300010396 | Terrestrial Soil | MHRLYLVRPVKPTPLPSEKRSAKVIELRVRREARRELRRVPRPDRPDAA* |
| Ga0137383_106993502 | 3300012199 | Vadose Zone Soil | MMHRLYLVRPVKPMPLPSEKRSAKVIELRVRREARRALRRAPRSDRPDAA* |
| Ga0137382_107888941 | 3300012200 | Vadose Zone Soil | MYRLYLVRPVKPMPLRSEKRSAKVIELRVRREARRALRQAPRPHRPDAA* |
| Ga0137382_108060231 | 3300012200 | Vadose Zone Soil | MYRVYLVRPVKPTPLPSEKRSAKVIELRVRREARRALRQAPRPHRPDAA* |
| Ga0137363_114156822 | 3300012202 | Vadose Zone Soil | MSRLYLVRSLTPTPQPREKHSAKVIVLRVRREARRDLRRSLQPDRPDAA* |
| Ga0137362_111323754 | 3300012205 | Vadose Zone Soil | VRSVTPTPQPREKHSAKVIVLRVRREARRDLRRSLQPDRPDAA* |
| Ga0137381_107348502 | 3300012207 | Vadose Zone Soil | MHRLYLVRPVKPMPLPSEKRSAKVIELRVRREARRALRRAPRSDRPDAA* |
| Ga0137376_111657291 | 3300012208 | Vadose Zone Soil | RLYLVRPVKSMPLPSEKRSAKVIELRVRREARRALRSAPRSDRPDAA* |
| Ga0137378_102381282 | 3300012210 | Vadose Zone Soil | MQRLYLVRSVTPTPQPREKRSAKVIELRVRREARRDLRRFLHPDRPDAA* |
| Ga0150985_1202645461 | 3300012212 | Avena Fatua Rhizosphere | MYRLYLVRPVKPMPLPSEMRSAKVIELRVRREARRAQRRAPRPDRPDAA* |
| Ga0137386_113124052 | 3300012351 | Vadose Zone Soil | LYLVRPVKPMPLPSEKRSAKVIELRVRREARRALRRAPRSDRPDAA* |
| Ga0137361_104186054 | 3300012362 | Vadose Zone Soil | MSRLYLVRSVTPTPQPREKHSAKVIVLRVRREARRDLRRSLQPDRPDAA* |
| Ga0126375_103742452 | 3300012948 | Tropical Forest Soil | MHRLYLVRPVKPEPLPSEKRSAKVIELRVRREARREKARILQSDRPDAA* |
| Ga0164298_109591171 | 3300012955 | Soil | MYRLYLVRPVRNEPLPSEKHSAKVIQRRARREAREAERRAQPAPDRPRAA* |
| Ga0164299_106629322 | 3300012958 | Soil | MYRLYLVRPVRNEPLPSEKHSAKVIQLRARREAREAERRAQPAPDR |
| Ga0164301_117001882 | 3300012960 | Soil | GEAMYRLYLVRPVRNEPLPSEKHSAKVIQLRARREAREAERRAQPAPDRPRAA* |
| Ga0134110_100728314 | 3300012975 | Grasslands Soil | MYRLYLVRPVKPMPQPSEKRSAKVIELRVRREARRALRRDPRPDRPDAA* |
| Ga0164309_114907602 | 3300012984 | Soil | MYRLYLVRPERPTPPPSDKHSAKVIELRVRREAERALREAPPRPDRLDAA* |
| Ga0164306_106689982 | 3300012988 | Soil | MYRLYLVRPVRNEPLPSEKRSAKVIELRVRREAREAARRPQPAPDRPRAA* |
| Ga0157370_102371623 | 3300013104 | Corn Rhizosphere | MTRLYLVRSVTPTPHPSEKRSAKVIELRVRREARRERLRFLRPDRPDAA* |
| Ga0157369_114045043 | 3300013105 | Corn Rhizosphere | MYRLYLVRPVRNVPLPSEKHSAKVIELRARREAREAARRPQPAPDRPRAA* |
| Ga0157372_111492083 | 3300013307 | Corn Rhizosphere | VRSVKPTPLPSEKRSAKVIELRVRQEARRDLQRRLRPDRPDAA* |
| Ga0157377_111640471 | 3300014745 | Miscanthus Rhizosphere | MYHLHLVRPVKASPLPSEKRSAKVIELQVRREARRALRQAPRPDRPDAA* |
| Ga0134072_100339711 | 3300015357 | Grasslands Soil | MHLHLVRPVKPMPLTSEKRSAKVIELRVRREARRALRQAPRPHRPDAA* |
| Ga0132258_113398662 | 3300015371 | Arabidopsis Rhizosphere | MHRLYLVRPVKPEPQPSEKRSAKVIELRVRREAQRALREAPPRPDRPDAA* |
| Ga0182041_118655561 | 3300016294 | Soil | MYRLYLVRPVQPVPPPSEKHSAKVIELRVRREAREAARRPQPAPDRPRAA |
| Ga0134083_105936951 | 3300017659 | Grasslands Soil | MYRLYLVRPVKPTPLPSEKRSAKVIELRVRREARRALRRDPRPDRPEAA |
| Ga0187775_103631952 | 3300017939 | Tropical Peatland | MRRLYLVRPVRPTPPPREQHAAKVIALRARRAARADLVRVRRSDGPDAA |
| Ga0187779_100311092 | 3300017959 | Tropical Peatland | MHRLYLVRSVKSAPQPSEKRSAKVIALRARREARRDVRRHLVPDRPDAA |
| Ga0187779_104792432 | 3300017959 | Tropical Peatland | MHSLYLVRSVKPAPRPSEKNSAKVIELRVRREVRRDARRPRRPDRPDAA |
| Ga0187779_107480682 | 3300017959 | Tropical Peatland | MYRLYLVRPVQSAPLPSEKRSAKVIELRVRREAREAARRPQPAPDRPRAA |
| Ga0190266_111970392 | 3300017965 | Soil | MYHLHLVRPVRPTPLPSEKHSAKVIELRVRREARRQLRLVRRPNRPDAA |
| Ga0187776_111242122 | 3300017966 | Tropical Peatland | MRRLYLVRPVRPMPPPQEQHAAKVIALRARRAARADLVRVRRSDGPDAA |
| Ga0187777_102853862 | 3300017974 | Tropical Peatland | MYHLHLVRPVKAELRSSEKRSAKVIHLQARREARRQLRSLPRADRPDAA |
| Ga0187777_103652712 | 3300017974 | Tropical Peatland | MHRLYLVRSVKPAPRPSEKNSAKVIELRVRREVRRDARRPRRPDRPDAA |
| Ga0187777_110332281 | 3300017974 | Tropical Peatland | MHRLYLVRSVKSAPQPSDKRSAKVIALRARREARLDVRRPRVPDRPDAA |
| Ga0187777_112354291 | 3300017974 | Tropical Peatland | MFRLYLVRPVRNVPLPSEKHSAKVIQLRARREAREASLRPQPSPDRPRAA |
| Ga0184605_102585982 | 3300018027 | Groundwater Sediment | MSRLYLVRPVKSTPLPSEKRSAKVIELRVRREARRALRREPRPDRPDAA |
| Ga0187787_100792045 | 3300018029 | Tropical Peatland | MYRLHLVRPVKPSPLPSEKRSAKVIELCVRQEQRRDKRRVLHADRPDAA |
| Ga0187765_100879472 | 3300018060 | Tropical Peatland | MHRLYLVRSVKSAPQPSEKRSAKVIALRARREARLDVRRPRVPDRPDAA |
| Ga0066667_106589321 | 3300018433 | Grasslands Soil | MYRLYLVRPVKPMPLPSEKRSAKVIELRVRREARRALRQAPRPHRPDAA |
| Ga0193751_10274717 | 3300019888 | Soil | MTRLYLVRSVTPTPQPSEKRSAKVIELRVRREVRRDLRRSLRPDRPDAA |
| Ga0197907_100356582 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | MYRLYLVRPVRNVPLPSEKHSAKVIELRARREAREAARRPQPAPDRPRAA |
| Ga0197907_101219232 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | MHRLYLVRSVKPTPLPSEKRSAKVIELRVRQEARRDLQRRLRPDRPDAA |
| Ga0197907_106256062 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRLYLVRSVTPTPHPSEKRSAKVIELRVRREARRERLRFLRPDRPDAA |
| Ga0206356_111676652 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRLYLVRSVTPTPRPSEKRSAKVIELRVRREARRERLRFLRPDRPDAA |
| Ga0210399_110328522 | 3300020581 | Soil | MTRLYLVRSVTPTPKPSEKRSAKVIELRVRREARRERRRFLRPDRPDAA |
| Ga0193719_101031872 | 3300021344 | Soil | MTRLYLVRSVKPTPQPREKRSAKVIELRVRREARRERLHSLQPDRPDAA |
| Ga0210384_117567901 | 3300021432 | Soil | MHRLYLVRSVKPTPRPSEKHSAKVIELRVRREARRQLRHVPEPKRPDAA |
| Ga0126371_108602092 | 3300021560 | Tropical Forest Soil | MYRLYLVRPVRNVPLPSEKRSAKVIELRVRREAREAALRAQPAPDRPRAA |
| Ga0126371_135894202 | 3300021560 | Tropical Forest Soil | NRKETGMYRVHLVRPVEAPPLPSEKRSAKVIELRARREARRHLRSLPRPDRPDAA |
| Ga0126371_136638872 | 3300021560 | Tropical Forest Soil | MYRLYLVRPAKSTPPPSMKRSAKVIELRVRREARRDAQRARRPDRPDAA |
| Ga0213880_100068855 | 3300021953 | Exposed Rock | MQRLYLVRSVTPTPQPREHKAAKVIELRVKREARRVERRHPRPDRPDAA |
| Ga0242655_102428721 | 3300022532 | Soil | MHRLYLVRSVKPTPRPSEKYSAKVIELRVRREARRQLRHVPEPKRPDAA |
| Ga0242671_11038541 | 3300022714 | Soil | MYHLHLVWPQKPTPPQPNDKNSAKVIELRVRREARELRLPPRPKRP |
| Ga0207665_113593471 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LVRSVTPTPQPSEKRSAKVIELRVRREARRERLRFLHPDRPDAA |
| Ga0209473_10451112 | 3300026330 | Soil | MYRLYLVRPVKPTPLPSEKRSAKVIELRVRREARRALRQAPRPHRPDAA |
| Ga0209579_106747932 | 3300027869 | Surface Soil | MYHLYLVRSVKPTPQPSDDQRSAKVIELRARREARRLLRQPRRPHRPDAA |
| Ga0209583_107544942 | 3300027910 | Watersheds | MYHLYLVRSVKPTPRTSDQRSAKVIELRARREARRQLRQPRRPHRPDAA |
| Ga0302234_104259121 | 3300028773 | Palsa | RLYLVRSVKPTPRPSEKYSAKVIELRVRREARRQLRRVPEPKRPDAA |
| Ga0311340_102007533 | 3300029943 | Palsa | MHRLYLVRSVKPTPRPSEKYSAKVIELRVRREARRQLRRVPEPKRPDAA |
| Ga0265324_102169772 | 3300029957 | Rhizosphere | MHRLYLVRPVRSTPLPSEKHSAKVIELRVRRETSRRLRLVPRPDRPDAA |
| Ga0311357_109343271 | 3300030524 | Palsa | TGRRRARHHTTKGDQMHRLYLVRSVKPTPRPSEKYSAKVIELRVRREARRQLRRVPEPKRPDAA |
| Ga0102748_113521702 | 3300031089 | Soil | MLYHLYLVRSVKPTPQPSDHRSAKVIELRARREARRLLRQPRRPHRPDAA |
| Ga0265327_101932352 | 3300031251 | Rhizosphere | MIRLHLVRPVRNVPLPSEKRSAKVIVLQARREAREAARRPQPAPDRPRAA |
| Ga0318528_103778443 | 3300031561 | Soil | MRRLYLVRPAKPSPPPYEKHSAKVISLRVRREARRDAWRALQPDRPDAA |
| Ga0307469_115431632 | 3300031720 | Hardwood Forest Soil | MHRLYLVRPVKPTPLPSEKRSAKVIELRVRREARRALRERPRPDRPDAA |
| Ga0318503_101947163 | 3300031794 | Soil | LVRPAKPSPPPYEKHSAKVISLRVRREARRDAWRALQPDRPDAA |
| Ga0306921_126061771 | 3300031912 | Soil | EEIRMRRLYLVRPAKPSPPPYEKHSAKVISLRVRREARRDAWRALQPDRPDAA |
| Ga0307479_113075412 | 3300031962 | Hardwood Forest Soil | MHRLYLVRSVKPTPPPRDKRSAKVIELRVRREARRDLRRSLHPDRPDAA |
| Ga0318562_107573762 | 3300032008 | Soil | RKETGMYRVHLVRPVKAPPLPSEKRSAKVIELRARREARRQLRSHPRPDRPDAA |
| Ga0318524_107759351 | 3300032067 | Soil | MRRLHLVRPAKPSPPPYEKHSAKVISLRVRREARRDAWRALQPDRPDAA |
| Ga0307471_1031451911 | 3300032180 | Hardwood Forest Soil | MHRLYLVRPVKPTPLPSEKRSAKVIELRVRREARRTLRERPRPDRPDAA |
| Ga0335085_100471487 | 3300032770 | Soil | MHRLYLVRPVRNVPLPSEKNSAKVIELRVRREAREAARRAQTAPDGPRAA |
| Ga0335070_102732585 | 3300032829 | Soil | MHRLYLVRPVKSAPQPSATRSAKVIALRARREARRDVRRPLVPDRPDAA |
| Ga0335072_109636481 | 3300032898 | Soil | MQHLYLVRTVTATPLPSEKNSAKVIALRIRREARRQAHRTPHPDRPAAA |
| Ga0335076_105761841 | 3300032955 | Soil | MQHLYLVRMVTATPLPSEKNSAKVIALRIRREARRQAHRTPHPDRPAAA |
| Ga0335084_109351521 | 3300033004 | Soil | MYHLHLVRPVKVAPRSSEKRSAKVIHLQARREERRQLRLLPRADRPDAA |
| Ga0335073_106595571 | 3300033134 | Soil | QHLYLVRTVTATPLPSEKNSAKVIALRIRREARRQAHRTPHPDRPAAA |
| Ga0326723_0299206_189_338 | 3300034090 | Peat Soil | MHRLYLVRSVRPEPREHEKRSAKVIELRVRREARNARLRPVPPRDRPAA |
| ⦗Top⦘ |