NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F052750

Metagenome / Metatranscriptome Family F052750

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F052750
Family Type Metagenome / Metatranscriptome
Number of Sequences 142
Average Sequence Length 52 residues
Representative Sequence GGLPEGLSENLAEQLSKMPSGLNFPPQGPQGNIPAAFRGGGKRKKK
Number of Associated Samples 131
Number of Associated Scaffolds 142

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.70 %
% of genes near scaffold ends (potentially truncated) 99.30 %
% of genes from short scaffolds (< 2000 bps) 95.07 %
Associated GOLD sequencing projects 128
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (85.211 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(33.803 % of family members)
Environment Ontology (ENVO) Unclassified
(33.099 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(40.141 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 15.22%    β-sheet: 0.00%    Coil/Unstructured: 84.78%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 142 Family Scaffolds
PF04679DNA_ligase_A_C 77.46
PF13338AbiEi_4 2.82
PF09084NMT1 1.41
PF00133tRNA-synt_1 0.70
PF13302Acetyltransf_3 0.70
PF13463HTH_27 0.70
PF13379NMT1_2 0.70
PF00886Ribosomal_S16 0.70
PF02653BPD_transp_2 0.70

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 142 Family Scaffolds
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 77.46
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 1.41
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 1.41
COG0060Isoleucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.70
COG0143Methionyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.70
COG0228Ribosomal protein S16Translation, ribosomal structure and biogenesis [J] 0.70
COG0495Leucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.70
COG0525Valyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.70

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.21 %
UnclassifiedrootN/A14.79 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2032320006|FACEOR_FYWIORV02GKYVSNot Available513Open in IMG/M
2124908016|OU_2_1_1_newblercontig19252All Organisms → cellular organisms → Bacteria959Open in IMG/M
3300005327|Ga0070658_10417442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1154Open in IMG/M
3300005334|Ga0068869_100466087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1050Open in IMG/M
3300005338|Ga0068868_100137558All Organisms → cellular organisms → Bacteria2003Open in IMG/M
3300005363|Ga0008090_15596128All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300005434|Ga0070709_11625493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia526Open in IMG/M
3300005436|Ga0070713_101580546All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300005437|Ga0070710_10835069Not Available660Open in IMG/M
3300005438|Ga0070701_10183282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1227Open in IMG/M
3300005539|Ga0068853_100434161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1233Open in IMG/M
3300005540|Ga0066697_10600436All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300005545|Ga0070695_101338389All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300005548|Ga0070665_100933068All Organisms → cellular organisms → Bacteria880Open in IMG/M
3300005556|Ga0066707_10574588All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300006175|Ga0070712_101063531Not Available701Open in IMG/M
3300006574|Ga0074056_11738660All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300006575|Ga0074053_11887070All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300006578|Ga0074059_12033629All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300006605|Ga0074057_12234246All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300006797|Ga0066659_11825815All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300006806|Ga0079220_10803202All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300006871|Ga0075434_100765094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Plantactinospora → Plantactinospora endophytica982Open in IMG/M
3300006953|Ga0074063_14174039All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300007255|Ga0099791_10376723All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300009038|Ga0099829_11317330All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300009092|Ga0105250_10356078All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300009098|Ga0105245_12278151All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300009551|Ga0105238_12612802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria541Open in IMG/M
3300010329|Ga0134111_10490753All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300010358|Ga0126370_10729891All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300010373|Ga0134128_10790319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1052Open in IMG/M
3300010373|Ga0134128_11794746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia675Open in IMG/M
3300011269|Ga0137392_11243035All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300011271|Ga0137393_10879392All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300012200|Ga0137382_11123414All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300012209|Ga0137379_10013911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea7679Open in IMG/M
3300012469|Ga0150984_105865056Not Available569Open in IMG/M
3300012683|Ga0137398_10156988All Organisms → cellular organisms → Bacteria1480Open in IMG/M
3300012924|Ga0137413_10225897All Organisms → cellular organisms → Bacteria1272Open in IMG/M
3300012924|Ga0137413_11135809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia620Open in IMG/M
3300012930|Ga0137407_10042563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3638Open in IMG/M
3300012957|Ga0164303_11516274All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia507Open in IMG/M
3300012985|Ga0164308_11990911Not Available542Open in IMG/M
3300012987|Ga0164307_11704000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia534Open in IMG/M
3300013100|Ga0157373_11564439All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300013297|Ga0157378_10213157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1832Open in IMG/M
3300013306|Ga0163162_11475644All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300014497|Ga0182008_10972338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
3300015242|Ga0137412_10752395All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300015371|Ga0132258_13488106All Organisms → cellular organisms → Bacteria1078Open in IMG/M
3300016319|Ga0182033_11535063All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300016341|Ga0182035_10482053All Organisms → cellular organisms → Bacteria1056Open in IMG/M
3300016404|Ga0182037_11775249All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300018085|Ga0187772_11189552Not Available561Open in IMG/M
3300019887|Ga0193729_1282474All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300020170|Ga0179594_10319326All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300021178|Ga0210408_10588699All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300021180|Ga0210396_11359335All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300021432|Ga0210384_10143233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2144Open in IMG/M
3300021475|Ga0210392_11353666All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300021478|Ga0210402_10495879All Organisms → cellular organisms → Bacteria1134Open in IMG/M
3300021478|Ga0210402_10605789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1015Open in IMG/M
3300024181|Ga0247693_1032247Not Available726Open in IMG/M
3300024232|Ga0247664_1073005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia792Open in IMG/M
3300024245|Ga0247677_1048851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia617Open in IMG/M
3300025509|Ga0208848_1090190All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300025625|Ga0208219_1134186Not Available546Open in IMG/M
3300025885|Ga0207653_10127808All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300025898|Ga0207692_11174619All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300025911|Ga0207654_11412295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Plantactinospora → Plantactinospora endophytica508Open in IMG/M
3300025914|Ga0207671_10439271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1039Open in IMG/M
3300025929|Ga0207664_11052121Not Available729Open in IMG/M
3300025930|Ga0207701_11085156All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Curtissbacteria → Candidatus Curtissbacteria bacterium RBG_16_39_7664Open in IMG/M
3300025939|Ga0207665_10564366All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300026078|Ga0207702_10286649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1559Open in IMG/M
3300026078|Ga0207702_11257485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii734Open in IMG/M
3300026095|Ga0207676_10525993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1126Open in IMG/M
3300026538|Ga0209056_10575875All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300026552|Ga0209577_10797525All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300027765|Ga0209073_10306488All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300027915|Ga0209069_10229288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria958Open in IMG/M
3300028715|Ga0307313_10065762All Organisms → cellular organisms → Bacteria1078Open in IMG/M
3300028716|Ga0307311_10162959Not Available645Open in IMG/M
3300028885|Ga0307304_10460771Not Available579Open in IMG/M
3300031152|Ga0307501_10191681All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300031198|Ga0307500_10013907Not Available1671Open in IMG/M
3300031543|Ga0318516_10297958Not Available932Open in IMG/M
3300031546|Ga0318538_10131974All Organisms → cellular organisms → Bacteria1311Open in IMG/M
3300031564|Ga0318573_10348180Not Available795Open in IMG/M
3300031572|Ga0318515_10183306All Organisms → cellular organisms → Bacteria1120Open in IMG/M
3300031640|Ga0318555_10310680Not Available853Open in IMG/M
3300031640|Ga0318555_10612571All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300031679|Ga0318561_10339566All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300031680|Ga0318574_10173005All Organisms → cellular organisms → Bacteria1234Open in IMG/M
3300031681|Ga0318572_10777679All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300031713|Ga0318496_10739031All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300031723|Ga0318493_10025562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2646Open in IMG/M
3300031723|Ga0318493_10521139All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300031751|Ga0318494_10741553All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300031764|Ga0318535_10395154All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300031768|Ga0318509_10460087All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300031771|Ga0318546_10505616All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300031777|Ga0318543_10242677Not Available803Open in IMG/M
3300031782|Ga0318552_10202523All Organisms → cellular organisms → Bacteria1004Open in IMG/M
3300031782|Ga0318552_10430022All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300031793|Ga0318548_10161248All Organisms → cellular organisms → Bacteria1095Open in IMG/M
3300031795|Ga0318557_10345648All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300031805|Ga0318497_10751844All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300031819|Ga0318568_10852279All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300031819|Ga0318568_10939497All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300031821|Ga0318567_10698517All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300031833|Ga0310917_10490729All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300031859|Ga0318527_10453511All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia547Open in IMG/M
3300031879|Ga0306919_10833760All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300031893|Ga0318536_10411969All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300031896|Ga0318551_10145492Not Available1291Open in IMG/M
3300031897|Ga0318520_10714794All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300032009|Ga0318563_10559119All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300032010|Ga0318569_10108312All Organisms → cellular organisms → Bacteria1260Open in IMG/M
3300032044|Ga0318558_10448534All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300032052|Ga0318506_10311369All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300032064|Ga0318510_10121188All Organisms → cellular organisms → Bacteria1012Open in IMG/M
3300032068|Ga0318553_10160741All Organisms → cellular organisms → Bacteria1165Open in IMG/M
3300032091|Ga0318577_10435088All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300032174|Ga0307470_10104245All Organisms → cellular organisms → Bacteria1633Open in IMG/M
3300032180|Ga0307471_103270610All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300032180|Ga0307471_103327976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia569Open in IMG/M
3300032211|Ga0310896_10620545Not Available605Open in IMG/M
3300032770|Ga0335085_10414310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. CA-1264281560Open in IMG/M
3300032782|Ga0335082_10559717All Organisms → cellular organisms → Bacteria1005Open in IMG/M
3300032829|Ga0335070_10725263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia928Open in IMG/M
3300032892|Ga0335081_10400168All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1767Open in IMG/M
3300032893|Ga0335069_10274343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2018Open in IMG/M
3300032954|Ga0335083_10080803All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3278Open in IMG/M
3300032954|Ga0335083_10414076All Organisms → cellular organisms → Bacteria1148Open in IMG/M
3300032955|Ga0335076_11043377Not Available700Open in IMG/M
3300033134|Ga0335073_10354424Not Available1736Open in IMG/M
3300033134|Ga0335073_10725836Not Available1081Open in IMG/M
3300033289|Ga0310914_10432804All Organisms → cellular organisms → Bacteria1191Open in IMG/M
3300033290|Ga0318519_10929184All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300033475|Ga0310811_10854939All Organisms → cellular organisms → Bacteria834Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil33.80%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.04%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil7.04%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.82%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.11%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.11%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.11%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.41%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.41%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.41%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.41%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.70%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.70%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.70%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.70%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.70%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.70%
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → 0.70%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.70%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.70%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.70%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.70%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.70%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.70%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.70%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.70%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.70%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.70%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.70%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.70%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.70%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2032320006Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+EnvironmentalOpen in IMG/M
2124908016Sample 642EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006574Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300024181Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34EnvironmentalOpen in IMG/M
3300024232Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05EnvironmentalOpen in IMG/M
3300024245Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18EnvironmentalOpen in IMG/M
3300025509Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025625Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FACEORE_41482302032320006SoilDPKTPNGPGQAPAGLGNMGGGLPEGFSEDLAEQLSKMPSGLTFPPQPQGPQGNIPAAFRGGGKRKKK
OU_018560102124908016SENLAEQLSKMPSGLSFPPQGPQGNIPAAFRGGGKRKKK
Ga0070658_1041744223300005327Corn RhizosphereGLSENLAEQLSKMPSGLSFPPQGPQGNIPAAFRGGGKRKKK*
Ga0068869_10046608723300005334Miscanthus RhizosphereGGLPDGLSENLAEQLSKMPSGLSFPPQGPQGNIPAAFRGGGKRKKK*
Ga0068868_10013755813300005338Miscanthus RhizosphereNGPGQAPGGVPNLGGGLGGLPDGLSENLAEQLSKMPSGLSFPPQGPQGNIPAAFRGGGKRKKK*
Ga0008090_1559612823300005363Tropical Rainforest SoilDLAEQLSKMPSGLSFPPQPPGPQGNIPAAFRGGGKRKKK*
Ga0070709_1162549323300005434Corn, Switchgrass And Miscanthus RhizosphereSENLAEQLSKMPSGLSFPPQGPQGNIPAAFRGGGKRKKK*
Ga0070713_10158054613300005436Corn, Switchgrass And Miscanthus RhizosphereGGLPEGFSENLAEQLSKMPSGLSFPPQPQGPQGNIPAAFRGGGKRKKK*
Ga0070710_1083506913300005437Corn, Switchgrass And Miscanthus RhizosphereAGLPDLGGLPEGLSENLAEQLSKMPSGLNFPPPPQGPQGNIPAAFRGGNKRKRK*
Ga0070701_1018328223300005438Corn, Switchgrass And Miscanthus RhizosphereGLGGLPDGLSENLAEQLSKMPSGLSFPPQGPQGNIPAAFRGGGKRKKK*
Ga0068853_10043416123300005539Corn RhizosphereGLPDGLSENLAEQLSKMPSGLSFPPQGPQGNIPAAFRGGGKRKKK*
Ga0066697_1060043623300005540SoilPNLGGGLGGLPEGLSENLAEQLSKMPSGLNFPPQPQGPQGNIPAAFRGGNKRKKK*
Ga0070695_10133838913300005545Corn, Switchgrass And Miscanthus RhizosphereLGGLPDGLSENLAEQLSKMPSGLSFPPQGPQGNIPAAFRGGGKRKKK*
Ga0070665_10093306813300005548Switchgrass RhizosphereNLAEQLSKMPSGLSFPPQGPQGNIPAAFRGGGKRKKK*
Ga0066707_1057458813300005556SoilGPAGLPDLGGLGGLPEGLSENLAEQLSKMPSGGLSFPPPPQGPQGNIPAAFRGGNKRKKK
Ga0070712_10106353113300006175Corn, Switchgrass And Miscanthus RhizosphereQLSKMPSDLNFPPPNQGPQGNVPAAFRGGGKRKKK*
Ga0074056_1173866023300006574SoilENLAEQLSKLPSSGLNFPPQGPQGIIPAAFRGGNSKRKKK*
Ga0074053_1188707013300006575SoilLGGGLPEGLSENLAEQLSKLPSSGLNFPPQGPQGPQGNIPAAFRGGNSKRKKK*
Ga0074059_1203362913300006578SoilGLSENLAEQLSKLPSSGLNFPPQGPQGNIPAAFRGGNSKRKKK*
Ga0074057_1223424613300006605SoilGLSENLAEQLSKLPSSGLNFPPQGPQGPQGPQGNIPAAFRGGNSKRKKK*
Ga0066659_1182581513300006797SoilGAQPDQAPNGPAGLPDLGGLGGLPEGLSENLAEQLSKMPSGGLSFPPPPQGPQGNIPAAFRGGNKRKKK*
Ga0079220_1080320213300006806Agricultural SoilLSKMPSGLNFPPKPPGPQGNIPAAFRGGGKRKKK*
Ga0075434_10076509413300006871Populus RhizosphereSENLAEQLSKMPSGLNFPPQGPQGNIPAAFRGGGKRKKK*
Ga0074063_1417403923300006953SoilGGGLGGLPEGLSENLAEQLSKLPPSGLNFPPQGPQGNIPAAFRGGGKRKKK*
Ga0099791_1037672313300007255Vadose Zone SoilQGGLPNLGGGLPEGFSENLAEQLSKMPSGLNFPPQPQGPQGNIPAAFRGGNKRKKK*
Ga0099829_1131733023300009038Vadose Zone SoilGGGGQDSAAPAGLPDPGSFGAGLPEGITEHLAEQLSKMPSGLNFPTPPQGPQGNIPAAFRGGAKRKKK*
Ga0105250_1035607813300009092Switchgrass RhizosphereLPDGLSENLAEQLSKMPSGLSFPPQGPQGNIPAAFRGGGKRKKK*
Ga0105245_1227815123300009098Miscanthus RhizosphereEQLSKMPSGLSFPPQGPQGNIPAAFRGGGKRKKK*
Ga0105238_1261280223300009551Corn RhizosphereVPNLGGGLGGLPDGLSENLAEQLSKMPSGLSFPPQGPQGNIPAAFRGGGKRKKK*
Ga0134111_1049075313300010329Grasslands SoilPEGFSENLAEQLSKMPSGLNFPPPPQGPQGNIPAAFRGGNKRKKK*
Ga0126370_1072989113300010358Tropical Forest SoilLGGLPEGLSENLAEQLSKMPSGLSFPPQGPQGNIPAAFRGGGKRKKK*
Ga0134128_1079031923300010373Terrestrial SoilLSENLAEQLSKMPSGLSFPPQGPQGNIPAAFRGGGKRKKK*
Ga0134128_1179474623300010373Terrestrial SoilPEGLTAESLAEQLSKMPSDLNFPPPNQGPQGNVPAAFRGGGKRKKK*
Ga0137392_1124303523300011269Vadose Zone SoilPAGPPDPGSFGAGLPEGITEHLAEQLSKMPSGLNFPTPPQGPQGNIPAAFRGGAKRKKK*
Ga0137393_1087939223300011271Vadose Zone SoilGGLPEGLSENLAEQLSKMPSGLNFPPQPQGPQGNIPAAFRGGNKRKKK*
Ga0137382_1112341423300012200Vadose Zone SoilGQPDQGGNGPSQLPGLGNLGGGLPEGLSENLADQLSKMPSGLSFPPQGPQGNIPAAFRGGKRKKK*
Ga0137379_1001391113300012209Vadose Zone SoilGGLPNLGGGLGGGLPEGLSENLAEQLSKLPSSGLNFPPQGPQGNIPAAFRGGNSKRKKK*
Ga0150984_10586505613300012469Avena Fatua RhizosphereENLAEQLSKMPSNLNFPPPNSGPQGNVPAAFRGGAKRKKK*
Ga0137398_1015698833300012683Vadose Zone SoilLGGGLPEGFSENLAEQLSKMPSGLNFPPPPQGPQGNIPAAFRGGGKRKKK*
Ga0137413_1022589723300012924Vadose Zone SoilPPNLGGGLGGLPEGLSENLAEQLSKMPSGLNFPPQPQGPQGNIPAAFRGGNKRKKK*
Ga0137413_1113580913300012924Vadose Zone SoilQAPASLGNLAGGLPEGFSENLAEQLSKMPSGLNFPPSAPQGPQGNVPAAFRGGGKRKKK*
Ga0137407_1004256313300012930Vadose Zone SoilLGNLGGLGGGLPEGLTAENLAEQLSNMPANLNFPPPNQGPQGPQGPQGNVPAAFRGGGKRKKK*
Ga0164303_1151627423300012957SoilPDGLSENLAEQLSKMPSGLSFPPQGPQGNIPAAFRGGGKRKKK*
Ga0164308_1199091113300012985SoilPANGPAGLGNLGGLGGGLPEGLTAESLAEQLSKMPSDLNFPAPNQGPQGNVPAAFRGGGKRKKK*
Ga0164307_1170400023300012987SoilAEQLSKMPSGLSFPPQGPQGNIPAAFRGGGKRKKK*
Ga0157373_1156443923300013100Corn RhizosphereLPEGLSENLAEQLSKMPPGLNLPPAAQGNIPAAFRGGGKRKKK*
Ga0157378_1021315713300013297Miscanthus RhizosphereLAEQLSKMPSGLSFPPQGPQGNIPAAFRGGGKRKKK*
Ga0163162_1147564423300013306Switchgrass RhizosphereGLPNLGGGLGGLPEGLSENLAEQLSKMPSGLNFPPQGPQGNIPAAFRGGGKRKKK*
Ga0182008_1097233813300014497RhizosphereSGLGGLPEGLSENLAEQLSKMPSGLNFPPQGPQGNIPAAFRGGGKRKKK*
Ga0137412_1075239513300015242Vadose Zone SoilPGQAQGGLPNLGGGLPEGFSENLAEQLSKMPSGLNFPPQPQGPQGNIPAAFRGGNKRKKK
Ga0132258_1348810613300015371Arabidopsis RhizosphereTAENLAEQLSKMPSNLNFPPPNQGPQGNVPAAFRGGGKRKKK*
Ga0182033_1153506323300016319SoilAPNGPGQAPAGLPNLGGLGGLPEGLPGDLAEQLANMPPGLNLPQQPQGNIPAAFRGAGKRKKK
Ga0182035_1048205323300016341SoilEGFSQEDLAEQLSKMPSGLSFPPKPPGPQGNIPAAFRGGGKRKKK
Ga0182037_1177524923300016404SoilLGGGLPEGFSQEDLAEQLSKMPSGLNFPPQGPQGNIPAAFRGGGKRKKK
Ga0187772_1118955213300018085Tropical PeatlandLPEDLTADKLAEQLSQMPQGLNFPPQAQGNIPAAFRGGGKGRKKK
Ga0193729_128247413300019887SoilGGGLPEGFSENLAEQLSKMPSGLNFPPQPQGPQGNIPAAFRGGNKRKKK
Ga0179594_1031932613300020170Vadose Zone SoilAGLGNLGGLGGGLPEGLTAENLAEQLSNMPANLNFPPPNQGPQGPQGPQGNVPAAFRGGGKRKKK
Ga0210408_1058869923300021178SoilEQLSKMPSGLNFPPPPQGPQGNIPAAFRGGGKRKKK
Ga0210396_1135933523300021180SoilGAEQDQGPDGPVQVPAGLPDLGGGLPEGFSENLAEQLSKMPSGLNFPPPPQGPQGNIPAAFRGGGKRKKK
Ga0210384_1014323333300021432SoilNLAEQLSKMPSGLNFPPPPQGPQGNIPAAFRGGNKRKKK
Ga0210392_1135366623300021475SoilSDGPGPAPAGLPNLGGGLPEGFSENLAEQLSKMPSGLNFPPPPQGPQGNIPAAFRGGGKRKKK
Ga0210402_1049587913300021478SoilGNLGGGLPEGLSENLAEQLSKMPPGLNLPPAAQGNIPAAFRGGGKRKKK
Ga0210402_1060578923300021478SoilNGPAGLPDLGGLPEGLSENLAEQLSKMPSGLNFPPPPQGPQGNIPAAFRGGNKRKKK
Ga0247693_103224723300024181SoilGGLPDGLSENLAEQLSKMPSGLSFPPQGPQGNIPAAFRGGGKRKKK
Ga0247664_107300523300024232SoilQAPGGVPNLGSGLGGLPEGLSENLAEQLSKMPSGLSFPPQGPQGNIPAAFRGGGKRKKK
Ga0247677_104885113300024245SoilGLSENLAEQLSKMPSGLSFPPQGPQGNIPAAFRGGGKRKKK
Ga0208848_109019023300025509Arctic Peat SoilLGGLGGGLPEGLSAENLAEQLSKMPSGLNFPPPNSGPQGNVPAAFRGNGKGKKK
Ga0208219_113418623300025625Arctic Peat SoilGLPEGLSAENLAEQLSKMPSNLNFPSPNSGPQGNVPAAFRGGGKRKKK
Ga0207653_1012780813300025885Corn, Switchgrass And Miscanthus RhizosphereSDLSENLAEQLSKMPSGLNFPPQGPQGNIPAAFRGGGKRKKK
Ga0207692_1117461913300025898Corn, Switchgrass And Miscanthus RhizosphereGLPEGLSENLAEQLSKMPSGLNFPPPPQGPQGNIPAAFRGGNKRKKK
Ga0207654_1141229513300025911Corn RhizosphereGQAPGGVPNLGGGLGGLPDGLSENLAEQLSKMPSGLSFPPQGPQGNIPAAFRGGGKRKKK
Ga0207671_1043927123300025914Corn RhizosphereAEQLSKMPSGLSFPPQGPQGNIPAAFRGGGKRKKK
Ga0207664_1105212113300025929Agricultural SoilEGLSENLAEQLSKMPSGLNFPPPAQGNIPAAFRGGGKRKKK
Ga0207701_1108515623300025930Corn, Switchgrass And Miscanthus RhizosphereLPEGLSENLAEQLSKMPSGLNFPPQGPQGNIPAAFRGGGKRKKK
Ga0207665_1056436613300025939Corn, Switchgrass And Miscanthus RhizosphereGGLPEGLSENLAEQLSKMPSGLNFPPQGPQGNIPAAFRGGGKRKKK
Ga0207702_1028664933300026078Corn RhizosphereLPDGLSENLAEQLSKMPSGLSFPPQGPQGNIPAAFRGGGKRKKK
Ga0207702_1125748513300026078Corn RhizospherePGGPGGLGNLGGGLPEGLTAENLAEQLSKMPSNLNFPPPNQGPQGNVPAAFRGGGKRKKK
Ga0207676_1052599313300026095Switchgrass RhizosphereGGVPNLGGGLGGLPDGLSENLAEQLSKMPSGLSFPPQGPQGNIPAAFRGGGKRKKK
Ga0209056_1057587523300026538SoilNLGGGLGGLPEGLSENLAEQLSKMPSGLNFPPPSQGPQGNIPAAFRGGNKRKKK
Ga0209577_1079752513300026552SoilNGPAGLPDLGGLGGLPEGLSENLAEQLSKMPSGGLSFPPPPQGPQGNIPAAFRGGNKRKK
Ga0209073_1030648823300027765Agricultural SoilAESLAEQLSKMPSDLSFPPPNQGPQGNVPAAFRGGGKRKKK
Ga0209069_1022928813300027915WatershedsPAQAPGLPNLGGGLPEGFSENLAEQLSKMPSGLNFPPPPQGPQGNIPAAFRGGGKRKTK
Ga0307313_1006576223300028715SoilLGGLPEGLSENLAEQLSKLPSSGLNFPPQGPQGNIPAAFRGGGKRKKK
Ga0307311_1016295913300028716SoilAEQLSKLPSSGLNFPPQGPQGNIPAAFRGGTSKRKKK
Ga0307304_1046077123300028885SoilPEGLSENLAEQLSKLPSSGLNFPPQGPQGNIPAAFRGGTSKRKKK
Ga0307501_1019168113300031152SoilGNGPSQVPGLGNLGGGLGGGLPEGLSENLADQLSKLPSGLNFPPQGPQGNIPAAFRGGGKRKKK
Ga0307500_1001390713300031198SoilNLAEQLSKLPSSGLNFPPQGPQGNIPAAFRGGGKRKKK
Ga0318516_1029795813300031543SoilAQGGLGNLGGFGGLPEDLTADKLAEQLSQMPPGLNFPPQAQGNIPAAFRGGGKGRKKK
Ga0318538_1013197413300031546SoilPGQLPAGLPNLGGGLGDLPEGLSENLAEQLSKMPSGLNFPPQGPQGNIPAAFRGGGKRKK
Ga0318573_1034818013300031564SoilGGLPEGLPGDLAEQLANMPPGLNLPQQPQGNIPAAFRGAGKRKKK
Ga0318515_1018330623300031572SoilGGGLPEGFSQEDLAEQLSKMPSGLNFPPQPPGPQGNIPAAFRGGGKRKKK
Ga0318555_1031068013300031640SoilPPNGPGQVPAGLGNLGGGLPEGFSQEDLAEQLSKMPSGLNFPPQPPGPQGNIPAAFRGGGKRKKK
Ga0318555_1061257113300031640SoilVPAGLGNLGGNLGGGLPEGFSQEDLAEQLSKMPSGLTFPPQPPGPQGNIPAAFRGGGKRKKK
Ga0318561_1033956623300031679SoilVPPGLGNLGGGLPEGFSQEDLAEQLSKMPSGLTFPPQPPGPQGNIPAAFRGGGKRKKK
Ga0318574_1017300513300031680SoilAGQDQPPNGPGQVPAGLGNLGGGLPEGFSQEDLAEQLSKMPSGLNFPPQPPGPQGNIPAAFRGGGKRKKK
Ga0318572_1077767913300031681SoilNLGGGLPEGFSQEDLAEQLSKMPSGLTFPPQPPGPQGNIPAAFRGGGKRKKK
Ga0318496_1073903113300031713SoilDQGPSGPGQVPAGLGNLGGNLGGGLPEGFSQEDLAEQLSKMPSGLTFPPQPPGPQGNIPAAFRGGGKRKKK
Ga0318493_1002556233300031723SoilPGQAPAGLPNLGGLGGLPEGLPDNLAEQLANMPQGLNLPPKPQGNIPAAFRGGGRRKKK
Ga0318493_1052113923300031723SoilENLAEQLSKMAPGRNFPASAQGNIPAAFRGGGKRRKK
Ga0318494_1074155313300031751SoilSQEDLAEQQSKMPSGLTFPPQPPGPQGNIPAAFRGGGKRKKK
Ga0318535_1039515413300031764SoilGSGAGQDQPPNGPGQAPAGLGNLGGLPEGFSQEDLAEQLSKMPSGLNFPPQPPGPQGNIPAAFRGGGKRKKK
Ga0318509_1046008713300031768SoilLPEGFSQEDLAEQLSKMPSGLTFPPQPPGPQGNIPAAFRGGGKRKKK
Ga0318546_1050561613300031771SoilGGLGDLPEGLSENLAEQLSKMPSGLNFPPQGPQGNIPAAFRGGGKRKKK
Ga0318543_1024267713300031777SoilQEDLAEQLSKMPSGLNFPPQPPGPQGNIPAAFRGGGKRKKK
Ga0318552_1020252323300031782SoilPSGPGQVPAGLGNLGGNLGGGLPEGFSQEDLAEQLSKMPSGLTFPPQPPGPQGNIPAAFRGGGKRKKK
Ga0318552_1043002213300031782SoilAAQQNQALPDLGGLGNLSGGLPDGISENLAEQLSKMPPGRNFPASAQGNIPAAFRGGGKRRKK
Ga0318548_1016124813300031793SoilQLSKMPSGLNFPPQPPGPQGNIPAAFRGGGKRKKK
Ga0318557_1034564823300031795SoilGQLPAGLPNLGGGLGDLPEGLSENLAEQLSKMPSGLNFPPQGPQGNIPAAFRGGGKRKKK
Ga0318497_1075184423300031805SoilGPSGPGQVPAGLGNLGGGLPEGFSQEDLAEQLSKMPSGLTFPPQPPGPQGNIPAAFRGGGKRKKK
Ga0318568_1085227913300031819SoilARPGQAPAGLGNLGGLPEGFSQEDLAEQLSKMPSGLNFPPQPPGPQGNIPAAFRGGGKRKKK
Ga0318568_1093949723300031819SoilDQGPSGPGQVPAGLGNLGGGLPEGFSQEDLAEQLSKMPSGLTFPPQPPGPQGNIPAAFRGGGKRKKK
Ga0318567_1069851723300031821SoilLPGDLAEQLANMPPGLNLPQQPQGNIPAAFRGAGKRKKK
Ga0310917_1049072913300031833SoilGLPNLGGGLGDLPEGLSENLAEQLSKMPSGLNFPPQGPQGNIPAAFRGGGKRKKK
Ga0318527_1045351113300031859SoilGANLPENLAEQLSKIPSGVNFPPPPQSPQGNIPAAFRGGAKRKKK
Ga0306919_1083376023300031879SoilPDQAPNGPGQAPAGLPNLGGLGGLPEGLPGDLAEQLANMPPGLNLPQQPQGNIPAAFRGAGKRKKK
Ga0318536_1041196913300031893SoilGLGDLPEGLSENLAEQLSKMPSGLNFPPQGPQGNIPAAFRGGGKRKKK
Ga0318551_1014549223300031896SoilPNGPGQAPAGLPNLGGLGGLPEGLPGDLAEQLANMPPGLNLPQQPQGNIPAAFRGAGKRKKK
Ga0318520_1071479423300031897SoilDQPPNGPGQVPAGLGNLGGGLPEGFSQEDLAEQLSKMPSGLNFPPQPPGPQGNIPAAFRGGGKRKKK
Ga0318563_1055911913300032009SoilLGQVPAGLGNLGGGLPEGFSQEDLAEQLSKMPSGLSFPPKPPGPQGNIPAAFRGGGKRKK
Ga0318569_1010831213300032010SoilGLSENLAEQLSKMPSGLNFPPQGPQGNIPAAFRGGGKRKKK
Ga0318558_1044853413300032044SoilLGNLGGGLPEGFSQEDLAEQLSKMPSGLSFPPKPPGPQGNIPAAFRGGGKRKKK
Ga0318506_1031136913300032052SoilAANGPGQLPAGLPNLGGGLGDLPEGLSENLAEQLSKMPSGLNFPPQGPQGNIPAAFRGGGKRKKK
Ga0318510_1012118823300032064SoilLPEGFSQEDLAEQLSKMPSGLNFPPQPPGPQGNIPAAFRGGGKRKKK
Ga0318553_1016074123300032068SoilPGQVPAGLGNLGGGLPEGFSQEDLAEQLSKMPSGLSFPPKPPGPQGNIPAAFRGGGKRKK
Ga0318577_1043508823300032091SoilGNLGGNLGGGLPEGFSQEDLAEQLSKMPSGLTFPPQPPGPQGNIPAAFRGGGKRKKK
Ga0307470_1010424523300032174Hardwood Forest SoilNGPGQAPGGLPNLGGGLGGLPEGLSENLAEQLSKMPSGLNFPPQPQGPQGNIPAAFRGGNKRKKK
Ga0307471_10327061013300032180Hardwood Forest SoilENLAEQLSKMPSGLNFPPPPQGPQGNIPAAFRGGNKRKKK
Ga0307471_10332797613300032180Hardwood Forest SoilEGLSENLAEQLSKMPSGGLSFPPPPQGPQGNIPAAFRGGNKRKKK
Ga0310896_1062054523300032211SoilQVPGPGNLGGGLGGLPEGLSENLAEQLSKLPSSGLNFPPPSQGPQGNIPAAFRGGKRKKK
Ga0335085_1041431013300032770SoilGGLPEGLSADDLAEQLSKMPSGLNLPPSAQGNIPAAFRGGGKRKKK
Ga0335082_1055971723300032782SoilQGPNGPGQVPAGRPNLGGGLPEGFSEDLAEQLSKMPSGLSFPPQPPGPQGNIPAAFRGGGKRKKK
Ga0335070_1072526313300032829SoilNGPGQVPAGLGNLGGNLGGGLPEGFSQEDLAEQLSKMPSGLSFPPQPPGPQGNIPAAFRGGGKRKKK
Ga0335081_1040016813300032892SoilNLAGLGGLPEGLSAENLAEQLSKMPPSGLNFPPAAQGPQGNVPAAFRGGGKRKKK
Ga0335069_1027434333300032893SoilDQAPAARPNLGAFGGNLPEDLAEQLSQMPQGLNFPPQPQGNIPAAFRGGGKGRKKK
Ga0335083_1008080313300032954SoilSQEDLAEQLSKMPSGLSFPPQPPGPQGNIPAAFRGGGKRKKR
Ga0335083_1041407623300032954SoilGGTPQDQAPNGPGQAPAGLGNLGGLGGLPEGLPDNLAEQLSKMPQGLNLPPSAQGNIPAAFRGGKRKKK
Ga0335076_1104337723300032955SoilPEDLAEQLSQMPQGLNFPPQPQGNIPAAFRGGGKGRKKK
Ga0335073_1035442423300033134SoilAGLGNLGGLGGGLPEGLTAENLAEQLSKMPSDLAFPPPNAGPQGNVPAAFRGGGKRKKK
Ga0335073_1072583613300033134SoilQAPAAPPNLGAFGGNLPDDLAEQLSQLPQGLKFPPQPQGNIPAAFRGGGKGRKKK
Ga0310914_1043280423300033289SoilGPGQAPGLPNLGGGLPEGFSEELAEQLSKMPSGLNFPPQGPQGNIPAAFRGGNKRKKK
Ga0318519_1092918413300033290SoilAGLGNLGGGLPEGFSQEDLAEQLSKMPSGLSFPPKPPGPQGNIPAAFRGGGKRKKK
Ga0310811_1085493923300033475SoilDLSGGLGGLPEGLSENLAEQLSKMPSGLNFPPQGPQGNIPAAFRGGGKRKKK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.