| Basic Information | |
|---|---|
| Family ID | F052696 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 142 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MQLKELTVWWQQRRMAREGRVAFDSAATRELYEALDEASMLAPRR |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 142 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 58.45 % |
| % of genes near scaffold ends (potentially truncated) | 35.92 % |
| % of genes from short scaffolds (< 2000 bps) | 75.35 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (64.789 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand (19.014 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.690 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) (32.394 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 66.67% β-sheet: 0.00% Coil/Unstructured: 33.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 142 Family Scaffolds |
|---|---|---|
| PF01545 | Cation_efflux | 32.39 |
| PF00248 | Aldo_ket_red | 16.20 |
| PF00892 | EamA | 11.97 |
| PF00441 | Acyl-CoA_dh_1 | 4.93 |
| PF02771 | Acyl-CoA_dh_N | 3.52 |
| PF02737 | 3HCDH_N | 2.82 |
| PF05103 | DivIVA | 2.11 |
| PF03466 | LysR_substrate | 1.41 |
| PF07690 | MFS_1 | 1.41 |
| PF04978 | DUF664 | 1.41 |
| PF00440 | TetR_N | 1.41 |
| PF00583 | Acetyltransf_1 | 0.70 |
| PF00108 | Thiolase_N | 0.70 |
| PF02469 | Fasciclin | 0.70 |
| PF10648 | Gmad2 | 0.70 |
| PF00296 | Bac_luciferase | 0.70 |
| PF03259 | Robl_LC7 | 0.70 |
| PF08241 | Methyltransf_11 | 0.70 |
| PF13473 | Cupredoxin_1 | 0.70 |
| PF14088 | DUF4268 | 0.70 |
| PF02770 | Acyl-CoA_dh_M | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 142 Family Scaffolds |
|---|---|---|---|
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 32.39 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 32.39 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 32.39 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 9.15 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 2.82 |
| COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 2.82 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 2.82 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 2.82 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 2.82 |
| COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 2.82 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 2.82 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.70 |
| COG2018 | Predicted regulator of Ras-like GTPase activity, Roadblock/LC7/MglB family | Signal transduction mechanisms [T] | 0.70 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.70 |
| COG2335 | Uncaracterized surface protein containing fasciclin (FAS1) repeats | General function prediction only [R] | 0.70 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 64.79 % |
| Unclassified | root | N/A | 35.21 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig75766 | Not Available | 520 | Open in IMG/M |
| 3300000858|JGI10213J12805_10090193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 999 | Open in IMG/M |
| 3300003203|JGI25406J46586_10005383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5943 | Open in IMG/M |
| 3300003203|JGI25406J46586_10013115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3573 | Open in IMG/M |
| 3300003373|JGI25407J50210_10001215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5740 | Open in IMG/M |
| 3300003373|JGI25407J50210_10001629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5135 | Open in IMG/M |
| 3300003373|JGI25407J50210_10007864 | All Organisms → cellular organisms → Bacteria | 2680 | Open in IMG/M |
| 3300003373|JGI25407J50210_10111420 | Not Available | 675 | Open in IMG/M |
| 3300003857|Ga0058693_1086841 | Not Available | 533 | Open in IMG/M |
| 3300004479|Ga0062595_102477058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 517 | Open in IMG/M |
| 3300005168|Ga0066809_10013410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae | 1579 | Open in IMG/M |
| 3300005562|Ga0058697_10019328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2367 | Open in IMG/M |
| 3300005562|Ga0058697_10038719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1777 | Open in IMG/M |
| 3300005562|Ga0058697_10285728 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300005562|Ga0058697_10553691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 595 | Open in IMG/M |
| 3300005937|Ga0081455_10054870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3393 | Open in IMG/M |
| 3300005981|Ga0081538_10001923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 20814 | Open in IMG/M |
| 3300005981|Ga0081538_10007016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 9801 | Open in IMG/M |
| 3300005981|Ga0081538_10113779 | All Organisms → cellular organisms → Bacteria | 1320 | Open in IMG/M |
| 3300005983|Ga0081540_1043399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2307 | Open in IMG/M |
| 3300006196|Ga0075422_10027600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1962 | Open in IMG/M |
| 3300006853|Ga0075420_101795971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 524 | Open in IMG/M |
| 3300006894|Ga0079215_10573219 | Not Available | 727 | Open in IMG/M |
| 3300006969|Ga0075419_10741281 | Not Available | 699 | Open in IMG/M |
| 3300007076|Ga0075435_100377898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1217 | Open in IMG/M |
| 3300009081|Ga0105098_10664437 | Not Available | 549 | Open in IMG/M |
| 3300009094|Ga0111539_13113047 | Not Available | 535 | Open in IMG/M |
| 3300009147|Ga0114129_11993580 | Not Available | 702 | Open in IMG/M |
| 3300009156|Ga0111538_10272276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2143 | Open in IMG/M |
| 3300009789|Ga0126307_10317475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1254 | Open in IMG/M |
| 3300009789|Ga0126307_10597179 | Not Available | 891 | Open in IMG/M |
| 3300009795|Ga0105059_1001447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1824 | Open in IMG/M |
| 3300009799|Ga0105075_1001361 | All Organisms → cellular organisms → Bacteria | 1737 | Open in IMG/M |
| 3300009800|Ga0105069_1036188 | Not Available | 571 | Open in IMG/M |
| 3300009807|Ga0105061_1001515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2492 | Open in IMG/M |
| 3300009807|Ga0105061_1023809 | Not Available | 833 | Open in IMG/M |
| 3300009807|Ga0105061_1049462 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300009810|Ga0105088_1030612 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300009811|Ga0105084_1011033 | Not Available | 1390 | Open in IMG/M |
| 3300009811|Ga0105084_1039399 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300009815|Ga0105070_1008861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1636 | Open in IMG/M |
| 3300009816|Ga0105076_1072022 | Not Available | 645 | Open in IMG/M |
| 3300009817|Ga0105062_1031492 | Not Available | 928 | Open in IMG/M |
| 3300009817|Ga0105062_1129794 | Not Available | 516 | Open in IMG/M |
| 3300009820|Ga0105085_1021653 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300009821|Ga0105064_1000397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4821 | Open in IMG/M |
| 3300009837|Ga0105058_1095676 | Not Available | 694 | Open in IMG/M |
| 3300009837|Ga0105058_1098540 | Not Available | 685 | Open in IMG/M |
| 3300009840|Ga0126313_10055074 | All Organisms → cellular organisms → Bacteria | 2818 | Open in IMG/M |
| 3300009840|Ga0126313_10754261 | Not Available | 790 | Open in IMG/M |
| 3300010029|Ga0105074_1064654 | Not Available | 660 | Open in IMG/M |
| 3300010036|Ga0126305_10010265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4682 | Open in IMG/M |
| 3300010036|Ga0126305_10520342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 795 | Open in IMG/M |
| 3300010037|Ga0126304_11277664 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300010038|Ga0126315_10472852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 796 | Open in IMG/M |
| 3300010038|Ga0126315_10561921 | Not Available | 733 | Open in IMG/M |
| 3300010145|Ga0126321_1118786 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300010166|Ga0126306_10001471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 12652 | Open in IMG/M |
| 3300012937|Ga0162653_100033050 | Not Available | 753 | Open in IMG/M |
| 3300012938|Ga0162651_100028374 | Not Available | 807 | Open in IMG/M |
| 3300014487|Ga0182000_10277065 | Not Available | 687 | Open in IMG/M |
| 3300014488|Ga0182001_10349795 | Not Available | 621 | Open in IMG/M |
| 3300017965|Ga0190266_10076087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1295 | Open in IMG/M |
| 3300017965|Ga0190266_10514645 | Not Available | 701 | Open in IMG/M |
| 3300017997|Ga0184610_1288745 | Not Available | 541 | Open in IMG/M |
| 3300018027|Ga0184605_10192551 | Not Available | 925 | Open in IMG/M |
| 3300018027|Ga0184605_10194799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 919 | Open in IMG/M |
| 3300018028|Ga0184608_10063141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1487 | Open in IMG/M |
| 3300018028|Ga0184608_10146255 | Not Available | 1016 | Open in IMG/M |
| 3300018031|Ga0184634_10023351 | All Organisms → cellular organisms → Bacteria | 2375 | Open in IMG/M |
| 3300018051|Ga0184620_10031150 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
| 3300018052|Ga0184638_1077312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1219 | Open in IMG/M |
| 3300018073|Ga0184624_10029120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 2124 | Open in IMG/M |
| 3300018073|Ga0184624_10453641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 563 | Open in IMG/M |
| 3300018075|Ga0184632_10400224 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300018078|Ga0184612_10073080 | Not Available | 1789 | Open in IMG/M |
| 3300018422|Ga0190265_10295449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1688 | Open in IMG/M |
| 3300018432|Ga0190275_10629474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1123 | Open in IMG/M |
| 3300018465|Ga0190269_11635192 | Not Available | 539 | Open in IMG/M |
| 3300018465|Ga0190269_11865149 | Not Available | 516 | Open in IMG/M |
| 3300018466|Ga0190268_11295767 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300018466|Ga0190268_11923096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
| 3300018466|Ga0190268_12336733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 505 | Open in IMG/M |
| 3300018476|Ga0190274_10002404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11031 | Open in IMG/M |
| 3300018476|Ga0190274_10049789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3023 | Open in IMG/M |
| 3300018476|Ga0190274_10725152 | Not Available | 1042 | Open in IMG/M |
| 3300019269|Ga0184644_1475939 | Not Available | 621 | Open in IMG/M |
| 3300019767|Ga0190267_10452059 | Not Available | 739 | Open in IMG/M |
| 3300019767|Ga0190267_10596671 | Not Available | 682 | Open in IMG/M |
| 3300019767|Ga0190267_10783540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter marinus | 630 | Open in IMG/M |
| 3300019875|Ga0193701_1087074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 597 | Open in IMG/M |
| 3300020005|Ga0193697_1041680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1147 | Open in IMG/M |
| 3300021073|Ga0210378_10018122 | All Organisms → cellular organisms → Bacteria | 2863 | Open in IMG/M |
| 3300021078|Ga0210381_10136482 | Not Available | 823 | Open in IMG/M |
| 3300021510|Ga0222621_1005933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2173 | Open in IMG/M |
| 3300022694|Ga0222623_10045902 | Not Available | 1679 | Open in IMG/M |
| 3300026791|Ga0208072_103566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 774 | Open in IMG/M |
| 3300027163|Ga0209878_1027555 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300027209|Ga0209875_1000493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5474 | Open in IMG/M |
| 3300027209|Ga0209875_1015403 | Not Available | 900 | Open in IMG/M |
| 3300027324|Ga0209845_1004171 | Not Available | 2491 | Open in IMG/M |
| 3300027379|Ga0209842_1030327 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300027561|Ga0209887_1017100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1791 | Open in IMG/M |
| 3300027577|Ga0209874_1098097 | Not Available | 700 | Open in IMG/M |
| 3300027718|Ga0209795_10058725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1149 | Open in IMG/M |
| 3300027750|Ga0209461_10068216 | Not Available | 756 | Open in IMG/M |
| 3300027952|Ga0209889_1051627 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300027957|Ga0209857_1052977 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300028608|Ga0247819_10888160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 557 | Open in IMG/M |
| 3300028707|Ga0307291_1005983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2601 | Open in IMG/M |
| 3300028708|Ga0307295_10075446 | Not Available | 890 | Open in IMG/M |
| 3300028719|Ga0307301_10271072 | Not Available | 555 | Open in IMG/M |
| 3300028722|Ga0307319_10015134 | Not Available | 2355 | Open in IMG/M |
| 3300028755|Ga0307316_10261791 | Not Available | 629 | Open in IMG/M |
| 3300028799|Ga0307284_10451013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 526 | Open in IMG/M |
| 3300028878|Ga0307278_10000778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 15726 | Open in IMG/M |
| 3300028881|Ga0307277_10064386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1512 | Open in IMG/M |
| 3300030499|Ga0268259_10027945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1074 | Open in IMG/M |
| 3300030499|Ga0268259_10104447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora → Saccharopolyspora spinosa | 637 | Open in IMG/M |
| 3300030502|Ga0268258_10078821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 704 | Open in IMG/M |
| 3300030511|Ga0268241_10117436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 629 | Open in IMG/M |
| 3300031548|Ga0307408_100005951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8124 | Open in IMG/M |
| 3300031731|Ga0307405_10047247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2649 | Open in IMG/M |
| 3300031731|Ga0307405_10466919 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300031824|Ga0307413_10279529 | Not Available | 1255 | Open in IMG/M |
| 3300031824|Ga0307413_10411388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1063 | Open in IMG/M |
| 3300031824|Ga0307413_10442936 | Not Available | 1029 | Open in IMG/M |
| 3300031852|Ga0307410_10031175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 3418 | Open in IMG/M |
| 3300031903|Ga0307407_10023749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3203 | Open in IMG/M |
| 3300031903|Ga0307407_11250208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 581 | Open in IMG/M |
| 3300031903|Ga0307407_11516475 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300031938|Ga0308175_101679501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 711 | Open in IMG/M |
| 3300031995|Ga0307409_100000738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 14687 | Open in IMG/M |
| 3300031995|Ga0307409_100001286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12149 | Open in IMG/M |
| 3300031995|Ga0307409_100617562 | Not Available | 1073 | Open in IMG/M |
| 3300032002|Ga0307416_100167251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2041 | Open in IMG/M |
| 3300032002|Ga0307416_103145889 | Not Available | 552 | Open in IMG/M |
| 3300032004|Ga0307414_11853151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 563 | Open in IMG/M |
| 3300032159|Ga0268251_10156521 | Not Available | 863 | Open in IMG/M |
| 3300034115|Ga0364945_0118794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 782 | Open in IMG/M |
| 3300034172|Ga0334913_006714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → unclassified Ktedonobacteraceae → Ktedonobacteraceae bacterium | 2994 | Open in IMG/M |
| 3300034668|Ga0314793_084739 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 19.01% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 17.61% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 11.27% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 8.45% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 7.04% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 4.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.93% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 4.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.82% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.82% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 2.82% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.11% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.41% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 1.41% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.70% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.70% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.70% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.70% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300003857 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009795 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 | Environmental | Open in IMG/M |
| 3300009799 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 | Environmental | Open in IMG/M |
| 3300009800 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_30_40 | Environmental | Open in IMG/M |
| 3300009807 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 | Environmental | Open in IMG/M |
| 3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
| 3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
| 3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
| 3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
| 3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010029 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
| 3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300026791 | Grasslands soil microbial communities from Kansas, USA that are Nitrogen fertilized - NN591 (SPAdes) | Environmental | Open in IMG/M |
| 3300027163 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027209 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027324 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027379 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027718 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027957 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300030499 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2) | Host-Associated | Open in IMG/M |
| 3300030502 | Agave microbial communities from Guanajuato, Mexico - As.Sf.rz (v2) | Host-Associated | Open in IMG/M |
| 3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
| 3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
| 3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
| 3300034668 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_12585770 | 2124908045 | Soil | MQLKELTVWWQQRRMAREGRVAFDSAATRELYEALDEASMLAPRR |
| JGI10213J12805_100901932 | 3300000858 | Soil | MQLKELAVWWQQRRLAREARAAFDSAAARELYEALDEASMLAPRR* |
| JGI25406J46586_100053832 | 3300003203 | Tabebuia Heterophylla Rhizosphere | MQLKELTVWWQQRRMAREGRVAFDSAATRELYEALDEASRLAPRR* |
| JGI25406J46586_100131151 | 3300003203 | Tabebuia Heterophylla Rhizosphere | MQLKELTVWWQQRRMAREGRVNFDSAATRELYEALDEASMLAPRR* |
| JGI25407J50210_100012155 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MQLKELTVWWQQRRIAREGRAAFESAATRELYEALDEASMLAPRR* |
| JGI25407J50210_100016292 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MQLRELTVWWQQRRMAREGRVAFDSAATRELYEALDEASRLAPRR* |
| JGI25407J50210_100078645 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MQLKELATWWQRRRLAREARDAFDSTAARELYEALDEASMLAPRR* |
| JGI25407J50210_101114202 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MQLKELTVWWQQRRTAREGRVAFDSVATRELYEALDEASRLAPRR* |
| Ga0058693_10868411 | 3300003857 | Agave | MQLKELTVWWQQRRMAREGRVXFDSAATRELYEALDEASMLAPRR* |
| Ga0062595_1024770581 | 3300004479 | Soil | MQLKELTVWWQQRRMAREGRVGFDSAATRELYEALDEASMLAPRR* |
| Ga0066809_100134102 | 3300005168 | Soil | MQLKELTVWWQQRRTAREGRVAFDSVATRELYEALDEASGLAPRR* |
| Ga0058697_100193281 | 3300005562 | Agave | MQLKELTVWWQQRRMAREGRVAFDSAATRELYEALDEASMLAPRR* |
| Ga0058697_100387192 | 3300005562 | Agave | MQLKELAVWWQQHRLAREARAAFDSAATRELYEALDEASMLAPRR* |
| Ga0058697_102857281 | 3300005562 | Agave | MQLKELAAWWQQRRLAREARAAFDSAATRELYEALDEASMLAPRR* |
| Ga0058697_105536912 | 3300005562 | Agave | MQLKELTVWWQQRRMAREGRVSFDSVATRELYEALDEASRLAPRR* |
| Ga0081455_100548703 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MQLKELTVWWQQRRIAREGRAAFESAATRELYEALDDASMLAPRR* |
| Ga0081538_1000192318 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MQLKEIATWWQQRRLAREARAAFDSAAARELYEALDEASMLAPRR* |
| Ga0081538_100070169 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MRLKDITAWWQQRRLAREARAAFDSAATRELYEALDEASMLAPRR* |
| Ga0081538_101137791 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MRLKELTVWWQQRRMAREGRVAFDSAATRELYEALDEASMLAPRR* |
| Ga0081540_10433993 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MQLKELTVWWQQRRMAREGRVSFDSAATRELYEALDEASRLAPRR* |
| Ga0075422_100276001 | 3300006196 | Populus Rhizosphere | RGTMQLKELTVWWQQRRMAREGRVGFDSAATRELYEALDEASMLAPRR* |
| Ga0075420_1017959711 | 3300006853 | Populus Rhizosphere | SSRRGTMQLKELTVWWQQRRIAREGRAAFESAATRELYEALDEASMLAPRR* |
| Ga0079215_105732192 | 3300006894 | Agricultural Soil | QQRRTAREGRVAFDSVATRELYEALDEASGLALRR* |
| Ga0075419_107412811 | 3300006969 | Populus Rhizosphere | GGEGDAGWGVRVGSSRRGTMQLKELTVWWQQRRIAREGRAAFESAATRELYEALDEASMLAPRR* |
| Ga0075435_1003778981 | 3300007076 | Populus Rhizosphere | SRRGTMQLKELTVWWQQRRMAREGRVGFDSAATRELYEALDEASMLAPRR* |
| Ga0105098_106644372 | 3300009081 | Freshwater Sediment | MQLRELTVWWQQRRMAREGRVAFDSAATRALYEALDKASRLAPRR* |
| Ga0111539_131130472 | 3300009094 | Populus Rhizosphere | MQLKELTVWWQQRRIAREGRAAFESAAARELYEALDDASMLAPRR* |
| Ga0114129_119935801 | 3300009147 | Populus Rhizosphere | MQLKELAAWWQQRRLAREARAVFDSAATRELYEALDEASMLAPRR* |
| Ga0111538_102722761 | 3300009156 | Populus Rhizosphere | QGGEGDPGWGVRVGSSRRGTMQLKELTVWWQQRRMAREGRVGFDSAATRELYEALDEASMLAPRR* |
| Ga0126307_103174752 | 3300009789 | Serpentine Soil | MQLKELTDWWQQRRMAREGRVAFDSVATRELYEALDEASRLAPRR* |
| Ga0126307_105971791 | 3300009789 | Serpentine Soil | QRRTAREGRVAFDSVATRELYEALDEASGLAPRR* |
| Ga0105059_10014472 | 3300009795 | Groundwater Sand | MQLKELAVWWQERRLAREARDAFDSAAARELYEALDEASMLAPRR* |
| Ga0105075_10013613 | 3300009799 | Groundwater Sand | MRLKELAVWWQERRLAREASDAFDSAAARELYEALDEASMLAPRR* |
| Ga0105069_10361881 | 3300009800 | Groundwater Sand | MQLKELTVWWQQRRIAREGRAAFESAATRELYEALDEA |
| Ga0105061_10015154 | 3300009807 | Groundwater Sand | MRLKELAVWWQERRLAREARDAFDSAAARERYEALDEASMLAPRR* |
| Ga0105061_10238092 | 3300009807 | Groundwater Sand | MQLKEFAAWWQQRRLAREARVSFDSSATRELYEALDEASMLAPRR* |
| Ga0105061_10494621 | 3300009807 | Groundwater Sand | MQLKEVAAWWQQRRLAREARAAFDSAAARELYEALDEASMLAPRR* |
| Ga0105088_10306122 | 3300009810 | Groundwater Sand | MQLKELAVWWQERRLAREASDAFDSAAARELYEALDEASMLAPRR* |
| Ga0105084_10110331 | 3300009811 | Groundwater Sand | MQLKEVAAWWQQRRLAREARAAFDSAAAREFYEALDEASMLAPRR* |
| Ga0105084_10393991 | 3300009811 | Groundwater Sand | MQLKELAVWWQQRRLAREARAAFDSAAARERYEALDEASMLAPRR* |
| Ga0105070_10088612 | 3300009815 | Groundwater Sand | MQLKELAVWWQQRRLAREARAAFDSAAAREFYEALDEASMLAPRR* |
| Ga0105076_10720222 | 3300009816 | Groundwater Sand | EQQEGDMQLKEFAAWWQQRRLAREARVSFDSSATRELYEALDEASMLAPRR* |
| Ga0105062_10314921 | 3300009817 | Groundwater Sand | MQLKEVAAWWQQRRLAREARAAFDSAAARERYEALDEASMLAPRR* |
| Ga0105062_11297942 | 3300009817 | Groundwater Sand | MQLKELAVWWQQRRLAREARAAFDSTAARELYEALDEASMLAPRR* |
| Ga0105085_10216532 | 3300009820 | Groundwater Sand | MRLKELAVWWQERRLAREARDAFDSAAARELYEALDEASMLAPRR* |
| Ga0105064_10003973 | 3300009821 | Groundwater Sand | MQLKELAVWWQERRLAREARAAFDSAAARELYEALDEASMLAPRR* |
| Ga0105058_10956761 | 3300009837 | Groundwater Sand | LKELAVWWQQRRLAREARAAFDSAAARERYEALDEASMLAPRR* |
| Ga0105058_10985402 | 3300009837 | Groundwater Sand | MQLKELAAWWQQRRLAREARAAFDSTAARELYEALDEASMLAPRR* |
| Ga0126313_100550742 | 3300009840 | Serpentine Soil | MQLKELATWWQQRRLAREARAAFDSAAARELYEALDEASMLAPRR* |
| Ga0126313_107542612 | 3300009840 | Serpentine Soil | GSRRGTMQLKELTVWWQQRRTAREGRVAFDSVATRELYEALDEASRLAPRR* |
| Ga0105074_10646541 | 3300010029 | Groundwater Sand | MQLKEFTVWWQQRRLAREARVSFDSSATRELYEALDEASMLAPRR* |
| Ga0126305_100102656 | 3300010036 | Serpentine Soil | WWQQRRTAREGRVAFDSVATRELYEALDEASGLAPRR* |
| Ga0126305_105203422 | 3300010036 | Serpentine Soil | MQLKELTDWWQQRRTAREGRVAFDSVATRELYEALDEASGLAPRR* |
| Ga0126304_112776641 | 3300010037 | Serpentine Soil | MQLKELTVWWQQRRMAREGRVNFDSAATRELYEALDEASRLAPRR* |
| Ga0126315_104728521 | 3300010038 | Serpentine Soil | MQLKELTVWWQQRRMAREGRVAFDSAVTRELYEALDEASMLAPRR* |
| Ga0126315_105619211 | 3300010038 | Serpentine Soil | TMQPREFTVWWQQRRMAREGRVAFDSAATRELYEALDEASMLAPRR* |
| Ga0126321_11187862 | 3300010145 | Soil | MQLKELAVWWQQRRLAREARAAFDSAATRELYEALDEASMLAPRR* |
| Ga0126306_1000147116 | 3300010166 | Serpentine Soil | MQLKELTVWWQQRRTARGGRAAFESAATRELYEALDEASRLAPRR* |
| Ga0162653_1000330502 | 3300012937 | Soil | QLKELTVWWQQRRTAREGRVAFDSVATRELYEALDEASGLAPRR* |
| Ga0162651_1000283742 | 3300012938 | Soil | MQPKELTVWWQQRRTAREGRVAFDSVATRELYEALDEASGLAPRR* |
| Ga0182000_102770652 | 3300014487 | Soil | MQLHDLATWWQRRKLARGPSGTFDSAAARELYEALDEASMLAPGR* |
| Ga0182001_103497952 | 3300014488 | Soil | MQLKELTDWWQQRRTAREGRVAFDSVATRELYEALDEASRLAPRR* |
| Ga0190266_100760872 | 3300017965 | Soil | MQLKELTDWWQQRRTAREGRVAFDSVATRELYEALDEASRLAPRR |
| Ga0190266_105146452 | 3300017965 | Soil | MQLKELTVWWQQRRIAREGRAAFESAATRELYEALDEASMLAPRR |
| Ga0184610_12887452 | 3300017997 | Groundwater Sediment | MQLKELAVWWQQRRLAREARAAFDSAAARERYEALDEASMLAPRR |
| Ga0184605_101925512 | 3300018027 | Groundwater Sediment | MQLKELTVWWQQRRTAREGRVGFDSVATRELYEALDEASGLA |
| Ga0184605_101947992 | 3300018027 | Groundwater Sediment | MQLKELTDWWQQRRTAREGRVAFDSVATRELYEALDEASGLAPRR |
| Ga0184608_100631412 | 3300018028 | Groundwater Sediment | MQLKELTVWWQQRRTAREGRVAFDSVATRELYEAL |
| Ga0184608_101462551 | 3300018028 | Groundwater Sediment | SRRGTMQLKELTVWWQQRRTAREGRVAFDSVATRELYEALDEASGLAPRR |
| Ga0184634_100233513 | 3300018031 | Groundwater Sediment | MQLKELAAWWQERRLAREASDAFDSAAARELYEALDEASMLAPRR |
| Ga0184620_100311502 | 3300018051 | Groundwater Sediment | MQLKELTVWWQQRRIAREGRAAFESATTRELYEALDEASMLAPRR |
| Ga0184638_10773122 | 3300018052 | Groundwater Sediment | MRLKELAVWWQERRLAREASDAFDSAAARELYEALDEASMLAPRR |
| Ga0184624_100291203 | 3300018073 | Groundwater Sediment | MQLKELTCWWQQRRMAREGRVGFDSAATRELYEALDEASMLAPRR |
| Ga0184624_104536412 | 3300018073 | Groundwater Sediment | MQLKELTDWWQQRRIAREGRAAFESAATRELYEALDEASMLAPRR |
| Ga0184632_104002242 | 3300018075 | Groundwater Sediment | MQLKELAAWWQERRLAREARDAFDSTAARELYEALDEASMLAPRR |
| Ga0184612_100730801 | 3300018078 | Groundwater Sediment | WWQQRRIAREGRAAFESAATRELYEALDEASMLAPRR |
| Ga0190265_102954492 | 3300018422 | Soil | MQLKELTVWWQQRRTARGGRAAFESAATRELYEALDEASRLAPRR |
| Ga0190275_106294742 | 3300018432 | Soil | MQLRELTVWWQQRRIAREGRAAFESAATRELYEALDEASMLAPRR |
| Ga0190269_116351922 | 3300018465 | Soil | MQLKELTVWWQQRRMAREGRVGFDSAATRELYEALDEASGLAPRR |
| Ga0190269_118651492 | 3300018465 | Soil | MQLKELTVWWQQRRTAREGRVAFDSVATRELYEALD |
| Ga0190268_112957672 | 3300018466 | Soil | EGDMQLKELTVWWQQRRLAREDRVAFDSAATRELYEALDEASMLAPRR |
| Ga0190268_119230961 | 3300018466 | Soil | MQLKELTVWWQQRRIAREGRAAFESAATRELYEALDE |
| Ga0190268_123367331 | 3300018466 | Soil | TVWWQQRRMAREGRVNFDSAATRELYEALDEASRLAPRR |
| Ga0190274_100024045 | 3300018476 | Soil | MQLRELTVWWQQRRMAREGRVAFDSAATRELYEALDEASRLAPRR |
| Ga0190274_100497891 | 3300018476 | Soil | PMQLKELAVWWQQRRLAREARAAFDSAAARELYEALDEASMLAPRR |
| Ga0190274_107251522 | 3300018476 | Soil | RGTMQLKELTVWWQQRRIAREGRAAFESAATRELYEALDEASMLAPRR |
| Ga0184644_14759391 | 3300019269 | Groundwater Sediment | MQLKELTVWWQQRRTAREGRVAFDSVATRELYEALDEASGLAPRR |
| Ga0190267_104520591 | 3300019767 | Soil | LTVGWEHRRMAREGRVGFDSAAKRELYEALDEASMLAPRR |
| Ga0190267_105966712 | 3300019767 | Soil | ARVRGSRRGTMQLKELTVWWQQRRTARGGRAAFESAATRELYEALDEASRLAPRR |
| Ga0190267_107835401 | 3300019767 | Soil | MQLKELTVWWQQRRMAREGRVGFDSAATRELYEALDEASRLAPRR |
| Ga0193701_10870742 | 3300019875 | Soil | KELTVWWQQRRIAREGRAAFESAATRELYEALDEASMLAPRR |
| Ga0193697_10416802 | 3300020005 | Soil | MQLKELTVWWQQRRTAREGRVGFDSVATRELYEALDEASGLAPRR |
| Ga0210378_100181222 | 3300021073 | Groundwater Sediment | MQLKELTVWWQQRRLAREDRVAFDSAATRELYEALDEASMLAPRR |
| Ga0210381_101364822 | 3300021078 | Groundwater Sediment | WQQRRIAREGRAAFESAATRELYEALDEASMLAPRR |
| Ga0222621_10059332 | 3300021510 | Groundwater Sediment | MQLKELTVWWQQRRMAREGRVGFDSAATRELYEALDEASMLAPRR |
| Ga0222623_100459023 | 3300022694 | Groundwater Sediment | QLEGDMQLKELTVWWQQRRLAREDRVAFDSAATRELYEALDEASMLAPRR |
| Ga0208072_1035662 | 3300026791 | Soil | MQLKELTVWWQQRKMAREGRVAFDSAATRELYEALDEASMLAPRR |
| Ga0209878_10275551 | 3300027163 | Groundwater Sand | MQLKELAAWWQQRRLAREARAAFDSTAARELYEALD |
| Ga0209875_10004933 | 3300027209 | Groundwater Sand | MQLKEVAAWWQQRRLAREARAAFDSAAARELYEALDEASMLAPRR |
| Ga0209875_10154031 | 3300027209 | Groundwater Sand | MQLKEFAAWWQQRRLAREARVSFDSSATRELYEALDEASMLAPRR |
| Ga0209845_10041713 | 3300027324 | Groundwater Sand | MQLKELAVWWQERRLAREARDAFDSAAARELYEALDEASMLAPRR |
| Ga0209842_10303272 | 3300027379 | Groundwater Sand | MQLKEVAAWWQQRRLAREARAAFDSAAAREFYEALDEASMLAPRR |
| Ga0209887_10171003 | 3300027561 | Groundwater Sand | MQLKEFTVWWQQRRLAREARVSFDSSATRELYEALDEASMLAPRR |
| Ga0209874_10980971 | 3300027577 | Groundwater Sand | MQLKELAAWWQQRRLAREARAAFDSTAARELYEALDEASMLAPRR |
| Ga0209795_100587252 | 3300027718 | Agave | MQLKELAAWWQQRRLAREARAAFDSAATRELYEAIDEASMLAPRR |
| Ga0209461_100682162 | 3300027750 | Agave | GLGGPGRGSRRGTMQLKELTVWWQQRRMAREGRVAFDSAATRELYEALDEASRLAPRR |
| Ga0209889_10516272 | 3300027952 | Groundwater Sand | MQLKELAVWWQRRRLAREARAAFDSTAARERYEALDEASMLAPRR |
| Ga0209857_10529772 | 3300027957 | Groundwater Sand | MQLKELAVWWQQRRLAREARAAFDSAAAREFYEALDEASMLAPRR |
| Ga0247819_108881601 | 3300028608 | Soil | LLLPRCGLGGPHRGSRRGTMQLKELTVWWQQRRIAREGRAAFESAATRELYEALDEASMLAPRR |
| Ga0307291_10059831 | 3300028707 | Soil | MQLKELTVWWQQRRTAREGRVAFDSVATRELYEALDEASGLA |
| Ga0307295_100754462 | 3300028708 | Soil | GGPGPGSRRGTMQLKELTVWWQQRRTAREGRVAFDSVATRELYEALDEASGLAPRR |
| Ga0307301_102710721 | 3300028719 | Soil | MQLKELATWWQQRRMAREARAAFDSAAARELYEALDEASMLAPRR |
| Ga0307319_100151341 | 3300028722 | Soil | TMQLKELTVWWQQRRIAREGRAAFESAATRELYEALDEASMLAPRR |
| Ga0307316_102617912 | 3300028755 | Soil | MQLKELTVWWQQRRTAREGRVGFDSVATRELYEALDEA |
| Ga0307284_104510131 | 3300028799 | Soil | RSSRRGTMQLKELTVWWQQRRMAREGRVGFDSAATRELYEALDEASMLAPRR |
| Ga0307278_1000077813 | 3300028878 | Soil | MQLKELTVWWQQRRLAREGRVGFDSAVTRELYEALDEASMLAPRR |
| Ga0307277_100643863 | 3300028881 | Soil | MQLKELTVWWQQRRMAREGRVSFDSAATRELYEALDEASRLAPRR |
| Ga0268259_100279452 | 3300030499 | Agave | MQLKELTVWWQQRRMAREGRVAFDSAATRELYEALDEASRLAPRR |
| Ga0268259_101044471 | 3300030499 | Agave | SSRRGTMQLHDLATWWQRRKLAREPSGTFDSAAARELYEALDEASMLAPGR |
| Ga0268258_100788211 | 3300030502 | Agave | MQLKELTVWWQQRRTAREGRVAFDSVATRELYEALDEASRLAPRR |
| Ga0268241_101174361 | 3300030511 | Soil | MQLKELTVWWQQRRMVREGRVAFDSAATRELYEALDEASRLAPRR |
| Ga0307408_1000059513 | 3300031548 | Rhizosphere | MQLKELTVWWQQRRMAREGRVNFDSAATRELYEALDEASRLAPRR |
| Ga0307405_100472474 | 3300031731 | Rhizosphere | LGGPGPGSRRGTMQLKELTVWWQQRRTAREGRVAFDSVATRELYEALDEASGLAPRR |
| Ga0307405_104669192 | 3300031731 | Rhizosphere | MQLKELATWWQQRRLAREARAAFDSAAARELYEAL |
| Ga0307413_102795292 | 3300031824 | Rhizosphere | MQLKELTVWWQQRRMAREGRVAFDSAVTRELYEALDEASMLAPRR |
| Ga0307413_104113882 | 3300031824 | Rhizosphere | MQLKELATWWQQRRLAREARAAFDSAAARELYEALDEASMLAPRR |
| Ga0307413_104429362 | 3300031824 | Rhizosphere | MQLKELTVWWQQRRTAREGRVAFDSVATRELYEALDEA |
| Ga0307410_100311754 | 3300031852 | Rhizosphere | ELTVWWQQRRMAREGRVGFDSAATRELYEALDEASMLAPRR |
| Ga0307407_100237494 | 3300031903 | Rhizosphere | MQLKELTVWWQQRRMAREGRVNFDSAATRELYEALDEASRLATRR |
| Ga0307407_112502081 | 3300031903 | Rhizosphere | MQLKELTVWWQQRRMAREGRVAFDSAATRELYEALDEASM |
| Ga0307407_115164752 | 3300031903 | Rhizosphere | MQLKELTVWWQQRRMAREGRVGFDSAATRELYEALDEASMLAP |
| Ga0308175_1016795011 | 3300031938 | Soil | MQLKELTVWWQQRRIAREGRAAFELAATRELYEALDEASMLAPRR |
| Ga0307409_10000073816 | 3300031995 | Rhizosphere | MQLKELTVWWQQRRMAREGRVNFDSAATRELYEAL |
| Ga0307409_10000128613 | 3300031995 | Rhizosphere | GSRRGTMQLKELTVWWQQRRMAREGRVNFDSAATRELYEALDEASRLAPRR |
| Ga0307409_1006175622 | 3300031995 | Rhizosphere | WQQRRMAREGRVGFDSAATRELYEALDEASMLAPRR |
| Ga0307416_1001672511 | 3300032002 | Rhizosphere | LGGSGRGSRRGTMQLKELTVWWQQRRMAREGRVGFDSAATRELYEALDEASMLAPRR |
| Ga0307416_1031458892 | 3300032002 | Rhizosphere | MQLKELTDWWQQRRMAREGRVAFDSVATRELYEALDEASRLAPRR |
| Ga0307414_118531512 | 3300032004 | Rhizosphere | MQLKELTVWWQQRRTARGGRVAFDSVATRELYEALDEASRLAPRR |
| Ga0268251_101565212 | 3300032159 | Agave | MQLKELAVWWQQHRLAREARAAFDSAATRELYEALDEASMLAPRR |
| Ga0364945_0118794_3_125 | 3300034115 | Sediment | MQLKELTVWWQQRRIAREGRAAFESAATRELYEALDEASML |
| Ga0334913_006714_1526_1663 | 3300034172 | Sub-Biocrust Soil | MQLKELAAWWQQRRLAREARAAFDSAATRELYEALDEASMLAPRR |
| Ga0314793_084739_446_592 | 3300034668 | Soil | MQLKELTVWWQQRRTAREGRVAFDSVATRELYEALDEASGARPAVVRL |
| ⦗Top⦘ |