| Basic Information | |
|---|---|
| Family ID | F052692 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 142 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MDNGSMISVLSGGRKRRRRHHMLAPPLWLTAAAFASFVAVALALVRI |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 142 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 60.56 % |
| % of genes near scaffold ends (potentially truncated) | 47.89 % |
| % of genes from short scaffolds (< 2000 bps) | 89.44 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.944 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.972 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.887 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (71.127 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.67% β-sheet: 0.00% Coil/Unstructured: 61.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 142 Family Scaffolds |
|---|---|---|
| PF02656 | DUF202 | 7.04 |
| PF13460 | NAD_binding_10 | 7.04 |
| PF00614 | PLDc | 4.93 |
| PF00583 | Acetyltransf_1 | 4.23 |
| PF13091 | PLDc_2 | 3.52 |
| PF04070 | DUF378 | 2.82 |
| PF01841 | Transglut_core | 2.11 |
| PF00665 | rve | 1.41 |
| PF00248 | Aldo_ket_red | 1.41 |
| PF00211 | Guanylate_cyc | 1.41 |
| PF00174 | Oxidored_molyb | 1.41 |
| PF09423 | PhoD | 1.41 |
| PF09954 | DUF2188 | 0.70 |
| PF13378 | MR_MLE_C | 0.70 |
| PF07883 | Cupin_2 | 0.70 |
| PF02518 | HATPase_c | 0.70 |
| PF00246 | Peptidase_M14 | 0.70 |
| PF01253 | SUI1 | 0.70 |
| PF00392 | GntR | 0.70 |
| PF01593 | Amino_oxidase | 0.70 |
| PF00903 | Glyoxalase | 0.70 |
| PF00127 | Copper-bind | 0.70 |
| PF01569 | PAP2 | 0.70 |
| PF13191 | AAA_16 | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 142 Family Scaffolds |
|---|---|---|---|
| COG2149 | Uncharacterized membrane protein YidH, DUF202 family | Function unknown [S] | 7.04 |
| COG1502 | Phosphatidylserine/phosphatidylglycerophosphate/cardiolipin synthase | Lipid transport and metabolism [I] | 4.93 |
| COG2155 | Uncharacterized membrane protein YuzA, DUF378 family | Function unknown [S] | 2.82 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 1.41 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.41 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 1.41 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 1.41 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 1.41 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 1.41 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 1.41 |
| COG0023 | Translation initiation factor 1 (eIF-1/SUI1) | Translation, ribosomal structure and biogenesis [J] | 0.70 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.65 % |
| Unclassified | root | N/A | 25.35 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig519220 | Not Available | 779 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c2105734 | Not Available | 550 | Open in IMG/M |
| 3300002073|JGI24745J21846_1025923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 698 | Open in IMG/M |
| 3300002077|JGI24744J21845_10098778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 538 | Open in IMG/M |
| 3300004479|Ga0062595_101799723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 582 | Open in IMG/M |
| 3300005093|Ga0062594_101050244 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300005328|Ga0070676_10099326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1796 | Open in IMG/M |
| 3300005329|Ga0070683_100375396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1355 | Open in IMG/M |
| 3300005329|Ga0070683_100537315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1118 | Open in IMG/M |
| 3300005329|Ga0070683_100703772 | Not Available | 968 | Open in IMG/M |
| 3300005334|Ga0068869_100132309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1919 | Open in IMG/M |
| 3300005334|Ga0068869_100217568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1513 | Open in IMG/M |
| 3300005335|Ga0070666_10123819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1794 | Open in IMG/M |
| 3300005335|Ga0070666_10940569 | Not Available | 640 | Open in IMG/M |
| 3300005339|Ga0070660_100052076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3154 | Open in IMG/M |
| 3300005339|Ga0070660_101692822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 539 | Open in IMG/M |
| 3300005355|Ga0070671_100159844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1905 | Open in IMG/M |
| 3300005355|Ga0070671_100537264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1007 | Open in IMG/M |
| 3300005367|Ga0070667_100594929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1019 | Open in IMG/M |
| 3300005367|Ga0070667_101460927 | Not Available | 642 | Open in IMG/M |
| 3300005438|Ga0070701_10851161 | Not Available | 626 | Open in IMG/M |
| 3300005455|Ga0070663_101307594 | Not Available | 640 | Open in IMG/M |
| 3300005459|Ga0068867_101718873 | Not Available | 589 | Open in IMG/M |
| 3300005466|Ga0070685_10268688 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
| 3300005518|Ga0070699_101501593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 618 | Open in IMG/M |
| 3300005530|Ga0070679_101578754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 604 | Open in IMG/M |
| 3300005539|Ga0068853_100453938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1206 | Open in IMG/M |
| 3300005545|Ga0070695_100324969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1145 | Open in IMG/M |
| 3300005547|Ga0070693_100217996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1249 | Open in IMG/M |
| 3300005549|Ga0070704_100536453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1021 | Open in IMG/M |
| 3300005564|Ga0070664_101383103 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300005614|Ga0068856_101246551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 759 | Open in IMG/M |
| 3300005617|Ga0068859_102219697 | Not Available | 606 | Open in IMG/M |
| 3300005718|Ga0068866_10202100 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1188 | Open in IMG/M |
| 3300005719|Ga0068861_100642664 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300005840|Ga0068870_10148901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1377 | Open in IMG/M |
| 3300005842|Ga0068858_100864584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 883 | Open in IMG/M |
| 3300006196|Ga0075422_10150547 | Not Available | 929 | Open in IMG/M |
| 3300006573|Ga0074055_11874719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1636 | Open in IMG/M |
| 3300006606|Ga0074062_13007169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 639 | Open in IMG/M |
| 3300006844|Ga0075428_101450493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 720 | Open in IMG/M |
| 3300006854|Ga0075425_100725576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1141 | Open in IMG/M |
| 3300006876|Ga0079217_10746384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 668 | Open in IMG/M |
| 3300006880|Ga0075429_101292843 | Not Available | 636 | Open in IMG/M |
| 3300007004|Ga0079218_11886754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 675 | Open in IMG/M |
| 3300009036|Ga0105244_10339040 | Not Available | 693 | Open in IMG/M |
| 3300009094|Ga0111539_10074097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4012 | Open in IMG/M |
| 3300009094|Ga0111539_11507892 | Not Available | 780 | Open in IMG/M |
| 3300009094|Ga0111539_11798862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 710 | Open in IMG/M |
| 3300009098|Ga0105245_10044724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3953 | Open in IMG/M |
| 3300009162|Ga0075423_10826093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 981 | Open in IMG/M |
| 3300009553|Ga0105249_10759325 | Not Available | 1032 | Open in IMG/M |
| 3300010375|Ga0105239_10053078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4447 | Open in IMG/M |
| 3300010375|Ga0105239_10455206 | All Organisms → cellular organisms → Bacteria | 1452 | Open in IMG/M |
| 3300010397|Ga0134124_10834560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 923 | Open in IMG/M |
| 3300010399|Ga0134127_10027233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4517 | Open in IMG/M |
| 3300010399|Ga0134127_10751645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1020 | Open in IMG/M |
| 3300010401|Ga0134121_10446292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1180 | Open in IMG/M |
| 3300011107|Ga0151490_1181609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1481 | Open in IMG/M |
| 3300011119|Ga0105246_10040204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3155 | Open in IMG/M |
| 3300012487|Ga0157321_1006188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 807 | Open in IMG/M |
| 3300012510|Ga0157316_1041305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 602 | Open in IMG/M |
| 3300012903|Ga0157289_10012030 | Not Available | 1708 | Open in IMG/M |
| 3300012951|Ga0164300_10552785 | Not Available | 669 | Open in IMG/M |
| 3300012958|Ga0164299_10107444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1464 | Open in IMG/M |
| 3300012960|Ga0164301_10351458 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300012961|Ga0164302_10652538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 771 | Open in IMG/M |
| 3300012984|Ga0164309_10414343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1009 | Open in IMG/M |
| 3300012984|Ga0164309_11523459 | Not Available | 572 | Open in IMG/M |
| 3300013102|Ga0157371_10225515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1346 | Open in IMG/M |
| 3300013297|Ga0157378_10379989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1387 | Open in IMG/M |
| 3300014325|Ga0163163_10338289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1560 | Open in IMG/M |
| 3300014745|Ga0157377_10015106 | All Organisms → cellular organisms → Bacteria | 3940 | Open in IMG/M |
| 3300015077|Ga0173483_10026071 | Not Available | 2098 | Open in IMG/M |
| 3300015200|Ga0173480_10358104 | Not Available | 834 | Open in IMG/M |
| 3300015371|Ga0132258_13204132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1129 | Open in IMG/M |
| 3300015372|Ga0132256_103248090 | Not Available | 547 | Open in IMG/M |
| 3300015373|Ga0132257_100204333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2342 | Open in IMG/M |
| 3300015373|Ga0132257_104008075 | Not Available | 536 | Open in IMG/M |
| 3300015374|Ga0132255_104263973 | Not Available | 606 | Open in IMG/M |
| 3300018469|Ga0190270_10189814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1723 | Open in IMG/M |
| 3300018469|Ga0190270_10783560 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus | 958 | Open in IMG/M |
| 3300018476|Ga0190274_10444317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1275 | Open in IMG/M |
| 3300018481|Ga0190271_10340923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1576 | Open in IMG/M |
| 3300018481|Ga0190271_10796162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1069 | Open in IMG/M |
| 3300018481|Ga0190271_13643053 | Not Available | 516 | Open in IMG/M |
| 3300019361|Ga0173482_10751003 | Not Available | 511 | Open in IMG/M |
| 3300019362|Ga0173479_10017220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1996 | Open in IMG/M |
| 3300020080|Ga0206350_10310115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 554 | Open in IMG/M |
| 3300020082|Ga0206353_12049174 | Not Available | 1217 | Open in IMG/M |
| 3300022883|Ga0247786_1033627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1004 | Open in IMG/M |
| 3300022901|Ga0247788_1021167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1138 | Open in IMG/M |
| 3300025321|Ga0207656_10013477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3127 | Open in IMG/M |
| 3300025321|Ga0207656_10450055 | Not Available | 651 | Open in IMG/M |
| 3300025885|Ga0207653_10062449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1259 | Open in IMG/M |
| 3300025899|Ga0207642_10093225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1493 | Open in IMG/M |
| 3300025903|Ga0207680_10661325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 748 | Open in IMG/M |
| 3300025907|Ga0207645_10186217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1363 | Open in IMG/M |
| 3300025908|Ga0207643_10066193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2072 | Open in IMG/M |
| 3300025919|Ga0207657_10004039 | All Organisms → cellular organisms → Bacteria | 15586 | Open in IMG/M |
| 3300025920|Ga0207649_10519735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 907 | Open in IMG/M |
| 3300025921|Ga0207652_10946336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 759 | Open in IMG/M |
| 3300025923|Ga0207681_10147846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1757 | Open in IMG/M |
| 3300025926|Ga0207659_10467743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1064 | Open in IMG/M |
| 3300025926|Ga0207659_11062143 | Not Available | 697 | Open in IMG/M |
| 3300025927|Ga0207687_10154387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1755 | Open in IMG/M |
| 3300025927|Ga0207687_10402560 | Not Available | 1126 | Open in IMG/M |
| 3300025933|Ga0207706_10034758 | All Organisms → cellular organisms → Bacteria | 4484 | Open in IMG/M |
| 3300025934|Ga0207686_10130649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1722 | Open in IMG/M |
| 3300025935|Ga0207709_10281410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1229 | Open in IMG/M |
| 3300025935|Ga0207709_11175195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 632 | Open in IMG/M |
| 3300025936|Ga0207670_10386240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1116 | Open in IMG/M |
| 3300025937|Ga0207669_10612021 | Not Available | 887 | Open in IMG/M |
| 3300025944|Ga0207661_11035422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 756 | Open in IMG/M |
| 3300025944|Ga0207661_11884745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 543 | Open in IMG/M |
| 3300025960|Ga0207651_11098636 | Not Available | 713 | Open in IMG/M |
| 3300025986|Ga0207658_10447871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 1143 | Open in IMG/M |
| 3300026023|Ga0207677_11502230 | Not Available | 622 | Open in IMG/M |
| 3300026078|Ga0207702_11430241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 685 | Open in IMG/M |
| 3300026078|Ga0207702_12497116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 503 | Open in IMG/M |
| 3300026088|Ga0207641_10394886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1327 | Open in IMG/M |
| 3300026089|Ga0207648_10380305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1276 | Open in IMG/M |
| 3300026095|Ga0207676_11412273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces phyllanthi | 692 | Open in IMG/M |
| 3300026095|Ga0207676_12029371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
| 3300026095|Ga0207676_12140994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 558 | Open in IMG/M |
| 3300026933|Ga0207578_1009547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 695 | Open in IMG/M |
| 3300027401|Ga0208637_1041428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 539 | Open in IMG/M |
| 3300027907|Ga0207428_10342761 | Not Available | 1101 | Open in IMG/M |
| 3300027907|Ga0207428_10367539 | Not Available | 1057 | Open in IMG/M |
| 3300027992|Ga0247750_1013060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 780 | Open in IMG/M |
| 3300030336|Ga0247826_10027810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2835 | Open in IMG/M |
| 3300030336|Ga0247826_10226009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1298 | Open in IMG/M |
| 3300030336|Ga0247826_10552968 | Not Available | 877 | Open in IMG/M |
| 3300031847|Ga0310907_10257792 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300031938|Ga0308175_101651834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 717 | Open in IMG/M |
| 3300032013|Ga0310906_10167166 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300032075|Ga0310890_10390818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1029 | Open in IMG/M |
| 3300032075|Ga0310890_10878842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 714 | Open in IMG/M |
| 3300032075|Ga0310890_11332348 | Not Available | 588 | Open in IMG/M |
| 3300033550|Ga0247829_10027974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3713 | Open in IMG/M |
| 3300033550|Ga0247829_10890975 | Not Available | 740 | Open in IMG/M |
| 3300034820|Ga0373959_0090904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 715 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 7.75% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.04% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 7.04% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 6.34% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.63% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 4.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.23% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.23% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.82% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.82% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.11% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.41% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.41% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.41% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.41% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.41% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.41% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.41% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.70% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.70% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.70% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Host-Associated | Open in IMG/M |
| 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Host-Associated | Open in IMG/M |
| 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Host-Associated | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
| 3300022901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026933 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10K4-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027401 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027992 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S125-311R-5 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_02047880 | 2124908045 | Soil | VKSVLSGGRKPRRRHRTLAHHLWLVTAALAGVIAAALIAIRI |
| ICChiseqgaiiDRAFT_21057342 | 3300000033 | Soil | VAEDEPAVMHEGHTISVLSGGRKRRRRHYMLAPPLWAAAAAFASF |
| JGI24745J21846_10259231 | 3300002073 | Corn, Switchgrass And Miscanthus Rhizosphere | LAMDNGSLIPVLSGGRKRRRRHHVLAPPLWLTAAALASFVAVALALVRI* |
| JGI24744J21845_100987782 | 3300002077 | Corn, Switchgrass And Miscanthus Rhizosphere | VEDETVAMDNGSMISVLSGGRKRRRWHHTVAPPLWLTAAALASFVAV |
| Ga0062595_1017997232 | 3300004479 | Soil | VEDETVAMDNGSMISVLSGGRKRRRWHHTVAPPLWLTAAALASFVAVALALVRL* |
| Ga0062594_1010502442 | 3300005093 | Soil | MYEGHTISVLSGGRKRRRRHHMLGPPLWLATAAFASFVAAALVLVRI* |
| Ga0070676_100993263 | 3300005328 | Miscanthus Rhizosphere | MDNGSMISVLSGGRKRRRRHQMLAPPLWLTAAALASFVAVALALVRI* |
| Ga0070683_1003753961 | 3300005329 | Corn Rhizosphere | MYEGHTISVLSGGRKRRRRHHMLAPPLWLATAAFASFVAAALVLVRI* |
| Ga0070683_1005373151 | 3300005329 | Corn Rhizosphere | VEDEPVAMDNGSMISVLSGGRKRRRRHHTIAPPLWLTAAALASFVAVALALVRL* |
| Ga0070683_1007037721 | 3300005329 | Corn Rhizosphere | ACSALDQRLRGYRSRAAKDELLAMDNGSLIPVLSGGRKRRRRHVLAPPLWLTAAGLASFVAVALALVRI* |
| Ga0068869_1001323092 | 3300005334 | Miscanthus Rhizosphere | MDNGSLIPVLSGGRKRRRRHHVLAPPLWLTAAALASFVAVALALVRI* |
| Ga0068869_1002175681 | 3300005334 | Miscanthus Rhizosphere | VEDEPVAMDNGSMISVLSGGRKRRRRHQMLAPPLWLTAAALASFVAVALALVRI* |
| Ga0070666_101238191 | 3300005335 | Switchgrass Rhizosphere | EDEPVAMDNGSMISVLSGGRKRRRWHHTVAPPLWLTAAALASFVAVALALVRL* |
| Ga0070666_109405691 | 3300005335 | Switchgrass Rhizosphere | MDNGSMISVLSGGRKRRRRHHMLALPLWLMAGAFASSVAVALALVRI* |
| Ga0070660_1000520762 | 3300005339 | Corn Rhizosphere | MDNGSLIPVLSGGRKRRRRHHMLAPPLWLTAAALASFVAVALALVRI* |
| Ga0070660_1016928222 | 3300005339 | Corn Rhizosphere | VEDETVAMDNGSMISVLSGGRKRRRWHHTVAPPLWLTAAALASFVAVALALVR |
| Ga0070671_1001598442 | 3300005355 | Switchgrass Rhizosphere | RSSAVEDEPVAMDNGSMISVLSGGRKRRRWHHTVAPPLWLTAAALASFVAVALALVRL* |
| Ga0070671_1005372642 | 3300005355 | Switchgrass Rhizosphere | VEDEPVAMDNGSMISVLSGGRKRRRRHQMLAPPLWLTAAALASCVAVALALVRI* |
| Ga0070667_1005949292 | 3300005367 | Switchgrass Rhizosphere | VEDEPVAMDNGSMISVLSGGRKRRRWHHTVAPPLWLTAAALASFVAVALALVRL* |
| Ga0070667_1014609272 | 3300005367 | Switchgrass Rhizosphere | MDNGSLIPVLSGGRKRRRRPHVLAPPLWLTAAALASFVAVALALVRI* |
| Ga0070701_108511612 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | VAMDNGSMISVLSGGRKRRRRHHMLALPLWLMAGAFASSVAVALALVRI* |
| Ga0070663_1013075942 | 3300005455 | Corn Rhizosphere | EDEPVAMDNGSMISVLSGGRKRRRRHQMLAPPLWLTAAALASFVAVALALVRI* |
| Ga0068867_1017188732 | 3300005459 | Miscanthus Rhizosphere | FVGYRSSAVEDEPVAMDNGSMISVLSGGRKRRRRHQMLAPPLWLTAAALASFVAVALALVRI* |
| Ga0070685_102686882 | 3300005466 | Switchgrass Rhizosphere | MYEGHTISVLSGGRKRRRRHHLLAPPLWLATAAFASFVAAALVLVRI* |
| Ga0070699_1015015932 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VEDETVAMDNGSMISVLSGGRKRRRWHHTVAPPLWLTAAALASFV |
| Ga0070679_1015787542 | 3300005530 | Corn Rhizosphere | LAMDNGSLIPVLSGGRKRRRRPHVLAPPLWLTAAALASFVAVALALVRI* |
| Ga0068853_1004539382 | 3300005539 | Corn Rhizosphere | VEDETVAMDNGSMISVLSGGRKRRRWHHTVAPPPLWLTAAALASFVAVALALVRL* |
| Ga0070695_1003249692 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VEDEPVAMDNGSMISVLSGGRKRRRRHQMLAPPLWLTAAALASFAAVALALVRI* |
| Ga0070693_1002179962 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MDNGSLIPVLSGGRKRRRRHHVLAPPLWMTAAALASFVAVALALVRI* |
| Ga0070704_1005364532 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VEDETVAMDNGSMISVLSGGRKRRRWHHTVAPPLWLTAAALASFVAVALALVRI* |
| Ga0070664_1013831031 | 3300005564 | Corn Rhizosphere | MYEGHTISVLSGGRKRRRRHHMLAPPLWLATAAFASFVAA |
| Ga0068856_1012465511 | 3300005614 | Corn Rhizosphere | MDNGSMISVLSGGRKRRRWHHTVAPPLWLTAAALASFVAVALALVR |
| Ga0068859_1022196971 | 3300005617 | Switchgrass Rhizosphere | AMDNGSLIPVLSGGRKRRRRHHVLGPPLWLTAAALASFVAVSLALVRI* |
| Ga0068866_102021002 | 3300005718 | Miscanthus Rhizosphere | MDNCSMISVLSGGRKRRRRHHMLALPLWLMAGAFASSVAVALALVRI* |
| Ga0068861_1006426643 | 3300005719 | Switchgrass Rhizosphere | MYEGHTISVLSGGRKRRRRHHMLGPPLWLATAAFASF |
| Ga0068870_101489013 | 3300005840 | Miscanthus Rhizosphere | RMYEGHTISVLSGGRKRRRRHHMLGPPLWLATAAFASFVAAALVLVRI* |
| Ga0068858_1008645842 | 3300005842 | Switchgrass Rhizosphere | VEDEPVAMDNGSMISVLSGGRKRRRWHHTVAPPLWLTAAAL |
| Ga0075422_101505472 | 3300006196 | Populus Rhizosphere | MYEGHMISVLSGGRKRRRRHHMLASPLWPAAVAFASFVAVALVLVRI* |
| Ga0074055_118747191 | 3300006573 | Soil | VAMDNGSMISVLSGGRKRRRRHHMLAPPLWLTAAAFASFVAVALALVRI* |
| Ga0074062_130071692 | 3300006606 | Soil | ISVLSGGRKRRRRHHMLAPPLWLTAAAFASFVAVALALVRI* |
| Ga0075428_1014504932 | 3300006844 | Populus Rhizosphere | VEDEPVAMDNGSMISVLSGGRKRRRRHQMLAPPLWLTAAALASFVAIALALVRI* |
| Ga0075425_1007255761 | 3300006854 | Populus Rhizosphere | VEDEPVAMDNGSMISVLSGGRKRRRRHQMLAPPLWLTA |
| Ga0079217_107463842 | 3300006876 | Agricultural Soil | GRKRRPRHRMLAPQLWLAAAAFASFVAAALVLVRI* |
| Ga0075429_1012928432 | 3300006880 | Populus Rhizosphere | SVLSGGRKRRRRHHMLASPLWPAAVAFASFVAVALVLVRI* |
| Ga0079218_118867542 | 3300007004 | Agricultural Soil | VAMYDGSMISVLSGGRKRRPRHRMLAPHLWLAAAAFASFVAAALVLVRI* |
| Ga0105244_103390402 | 3300009036 | Miscanthus Rhizosphere | LIPVLSGGRKRRRRHHVLAPPLWLTAAALASFVAVALALVRI* |
| Ga0111539_100740972 | 3300009094 | Populus Rhizosphere | MDNGSMISVLSGGRKRRRRHQMLAPPLWLTAAALASFVAIALALVRI* |
| Ga0111539_115078921 | 3300009094 | Populus Rhizosphere | MNEDHMSSVLSGGRKRRRRHRTLAAPLWVATCGLAGFVAASLVLIRI* |
| Ga0111539_117988621 | 3300009094 | Populus Rhizosphere | VGYRSSAVEDETVAMDNGSMISVLSGGRKRRRWHHTVAPPLWLTAAALASFVAVALALVRL* |
| Ga0105245_100447242 | 3300009098 | Miscanthus Rhizosphere | VGYRSSAVEDEPVAMDNGSMISVLSGGRKRRRWHHTVAPPLWLTAAALASFVAVALALVRL* |
| Ga0075423_108260932 | 3300009162 | Populus Rhizosphere | MDNGSLIPVLSGGRKRRRRHVLAPPLWLTAAGLASFVAVALALVRI* |
| Ga0105249_107593251 | 3300009553 | Switchgrass Rhizosphere | GRKRRRRHHMLASPLWPAAVAFASFVAVALVLVRI* |
| Ga0105239_100530784 | 3300010375 | Corn Rhizosphere | YRSSAVEDEPVAMDNGSMISVLSGGRKRRRWHHTVAPPLWLTAAALASFVAVALALVRL* |
| Ga0105239_104552062 | 3300010375 | Corn Rhizosphere | MYESHTISVLSGGRKRRRRHHLLASPLWLAAVAFASFVAVALLLVRI* |
| Ga0134124_108345602 | 3300010397 | Terrestrial Soil | AVEDEPVAMDNGSMISVLSGGRKRRRWHHTVAPPLWLTAAALASFVAVALALVRL* |
| Ga0134127_100272334 | 3300010399 | Terrestrial Soil | FVGYRSSAVEDEPVAMDNGSMISVLSGGRKRRRWHHTVAPPLWLTAAALASFVAVALALVRL* |
| Ga0134127_107516452 | 3300010399 | Terrestrial Soil | MDNGSLIPVLSGGRKRRRRHVLAPPLWLTAAALASFVAVALALVRI* |
| Ga0134121_104462922 | 3300010401 | Terrestrial Soil | MDNGSMISVLSGGRKRRRWHHTVAPPLWLTAAALASFVAVALALVRL* |
| Ga0151490_11816092 | 3300011107 | Soil | MDNGSMISVLSGGRKRRRRHHMLAPPLWLTAAAFASFVAVALALVRI* |
| Ga0105246_100402041 | 3300011119 | Miscanthus Rhizosphere | MYEGHTISVLSGGRKRRRRHHMLGPPLWLATAAFASFVAAALVL |
| Ga0157321_10061881 | 3300012487 | Arabidopsis Rhizosphere | MDNGSMISVLSGGRKRRRWHHTVAPPLWLTAAALASFVAVALAL |
| Ga0157316_10413051 | 3300012510 | Arabidopsis Rhizosphere | HTISVLSGGRKRRRRHHMLGPPLWLATAAFASFVAAALVLVRI* |
| Ga0157289_100120301 | 3300012903 | Soil | SLIPVLSGGRKRRRRHHVLAPPLWLTAAALASFVAVALALVRI* |
| Ga0164300_105527852 | 3300012951 | Soil | MYEGHTISVLSGGRKRRRRHHVLGPPLWLATAAFASFVAAALVLVRI* |
| Ga0164299_101074441 | 3300012958 | Soil | MYNGSMISVLSGGRKRRRRHHMLGPPLWLATAAFASFVAAALVLVRI* |
| Ga0164301_103514582 | 3300012960 | Soil | MYEGHTISVLSGGRKRRRRHHMLAPPLWLATAAFASFVAAALVLIRI* |
| Ga0164302_106525381 | 3300012961 | Soil | VGYRSSAVEDETVAMDNGSMISVLSGGRKRRRWHHTVAPPLWLTAAALASFVAVALALVRI* |
| Ga0164309_104143432 | 3300012984 | Soil | MDNGSMISVLSGGRKRRRRHHMLAPPLWLTAAAFASFVAVALALVRL* |
| Ga0164309_115234592 | 3300012984 | Soil | MYEGHTISVLSGGRKRRRRHHMLGPPLWLATAAFASFVAAALVLIRI* |
| Ga0157371_102255152 | 3300013102 | Corn Rhizosphere | MDNGSLILVLSGGRKRRRRHHVLAPPLWLTAAALASFVAVALALVRI* |
| Ga0157378_103799891 | 3300013297 | Miscanthus Rhizosphere | VGYRSSAVENETVAMDNGSMISVLSGGRKRRRWHHTVAPPLWLTAAALASFVAVALALVRL* |
| Ga0163163_103382893 | 3300014325 | Switchgrass Rhizosphere | MYEGHTISVLSGGRKRRRRHHMLAPPLWLATAAFASFVAVALVLVRI* |
| Ga0157377_100151067 | 3300014745 | Miscanthus Rhizosphere | GSLIPVLSGGRKRRRRHHVLAPPLWLTAAALASFVAVALALVRI* |
| Ga0173483_100260712 | 3300015077 | Soil | MYEGHMISVLSGGRKRRRRHYMLTAPLWPAAVAFASFVAVALVLVRI* |
| Ga0173480_103581042 | 3300015200 | Soil | AMDNGSMISVLSGGRKRRRRHHMLALPLWLMAGAFASSVAVALALVRI* |
| Ga0132258_132041321 | 3300015371 | Arabidopsis Rhizosphere | VAMDNGSMISVLSGGRKRRRWHHTVAPPLWLTAAALASFVAVALALVRL* |
| Ga0132256_1032480902 | 3300015372 | Arabidopsis Rhizosphere | MYEGHMISVLSGGRKRRRRYHVLAPPLWLATAAFASFVTA |
| Ga0132257_1002043334 | 3300015373 | Arabidopsis Rhizosphere | RQRSSAAEDELAAMNAGHMTSVLSGGRKRRRRRHMLAPPLWLAAAAFASSVAVALVLVRI |
| Ga0132257_1040080752 | 3300015373 | Arabidopsis Rhizosphere | MDNGSLIPVLSGGRKRRRRRVLAPPLWLTAAGLASFVAVAPALVRI* |
| Ga0132255_1042639731 | 3300015374 | Arabidopsis Rhizosphere | EGHMTSVLSGGRKRRRRHHLLASPLWLAAVAFASFVAVALVLVRI* |
| Ga0190270_101898142 | 3300018469 | Soil | MYEGHVISVLSDGRKRRRRHSMLAPPLWLAAAAFASFVVAALVLVRI |
| Ga0190270_107835601 | 3300018469 | Soil | SSRVSSVLSGGRKRRRHRKLAPHLWVAAAGFAGFVAAALVLVRI |
| Ga0190274_104443171 | 3300018476 | Soil | MYEGHMISVLSGGRKRRRRHYMLAPPLWVAAAAFAGFVSAALVLVRI |
| Ga0190271_103409231 | 3300018481 | Soil | SSVAEDEPAVMYEGHMISVLSGGRKRRRRHYMLAPPLWMAAAAFASFVAAALVLVRI |
| Ga0190271_107961621 | 3300018481 | Soil | MNEGQTISVLSGGRKRRHHTLAPPLWLAAAGFASFVAAALVLVRI |
| Ga0190271_136430531 | 3300018481 | Soil | VAEDEPAVMHEGHMISVLSGGRKRRRRHYVLAPPLWVAAAAFASFVAAALVLVRI |
| Ga0173482_107510031 | 3300019361 | Soil | MDNGSMISVLSGGRKRRRRHHMLALPLWLMAGAFASSVAVALALVRI |
| Ga0173479_100172202 | 3300019362 | Soil | MDNGSLIPVLSGGRKRRRRHHVLAPPLWLTAAALASFVAVALALVRI |
| Ga0206350_103101151 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | GGSSAVEDEPVAMDNGSMISVLSGGRKRRRWHHTVAPPLWLTAAALASFVAVALALVRL |
| Ga0206353_120491741 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | SSGAEDEPVAMDNGSMISVLSGGRKRRRRHHMLALPLWLMAGAFASSVAVALALVRI |
| Ga0247786_10336272 | 3300022883 | Soil | MDNGSLIPVLSGGRKRRRRHVLAPPLWLTAAGLASFVAVALALVRI |
| Ga0247788_10211671 | 3300022901 | Soil | MDNGSLIPVLSGGRKRRRRHHVLAPPLWLTAAALASF |
| Ga0207656_100134775 | 3300025321 | Corn Rhizosphere | VEDETVAMDNGSMISVLSGGRKRRRWHHTVAPPLWLTAAA |
| Ga0207656_104500551 | 3300025321 | Corn Rhizosphere | AKASWGRSSAVEDEPVAMDNGSMISVLSGGRKRRRRHHMLVLPLWLMAGAFASSVAVALALVRI |
| Ga0207653_100624491 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | VEDETVAMDNGSMISVLSGGRKRRRWHHTVAPPLWLTAAALASFVAVALALVRL |
| Ga0207642_100932251 | 3300025899 | Miscanthus Rhizosphere | MYEGHTISVLSGGRKRRRRHHMLGPPLWLATAAFASFVAVALVLVRI |
| Ga0207680_106613252 | 3300025903 | Switchgrass Rhizosphere | MDNGSMISVLSGGRKRRRWHHTVAPPLWLTAAALASFVAVALALVRL |
| Ga0207645_101862172 | 3300025907 | Miscanthus Rhizosphere | VEDETVAMDNGSMISVLSGGRKRRRRHQMLAPPLWLTAAALASFVAVALALVRI |
| Ga0207643_100661931 | 3300025908 | Miscanthus Rhizosphere | VEDEPVAMDNGSMISVLSGGRKRRRRHQMLAPPLWLTAAALASFVAVALALVRI |
| Ga0207657_1000403918 | 3300025919 | Corn Rhizosphere | MDNGSLIPVLSGGRKRRRRPHVLAPPLWLTAAALASFVAVALALVRI |
| Ga0207649_105197352 | 3300025920 | Corn Rhizosphere | DEPVAMDNGSMISVLSGGRKRRRRHHTIAPPLWLTAAALASFVAVALALVRL |
| Ga0207652_109463362 | 3300025921 | Corn Rhizosphere | MDNGSMISVLSGGRKRRRRHQMLAPPLWLTAAALASFVAVALALVRI |
| Ga0207681_101478462 | 3300025923 | Switchgrass Rhizosphere | ERFVGYRSSAVEDEPVAMDNGSMISVLSGGRKRRRRHQMLAPPLWLTAAALASFVAVALALVRI |
| Ga0207659_104677432 | 3300025926 | Miscanthus Rhizosphere | MYEGHTISVLSGGRKRRRRHHMLAPPLWLATAAFASFVAAALVLVRI |
| Ga0207659_110621432 | 3300025926 | Miscanthus Rhizosphere | MYESHTISVLSGGRKRRRRHHLLASPLWLAAVAFASFVAVALLLVRI |
| Ga0207687_101543871 | 3300025927 | Miscanthus Rhizosphere | MDNGSMISVLSGGRKRRRRHHVLAPPLWLTAAALASFVAVALALVRI |
| Ga0207687_104025603 | 3300025927 | Miscanthus Rhizosphere | EPVAMDNGSMISVLSGGRKRRRRHHMLALPLWLMAGAFASSVAVALALVRI |
| Ga0207706_100347584 | 3300025933 | Corn Rhizosphere | SWGRSSAVEDEPVAMDNGSMISVLSGGRKRRRWHHTVAPPLWLTAAALASFVAVALALVR |
| Ga0207686_101306494 | 3300025934 | Miscanthus Rhizosphere | DNGSLIPVLSGGRKRRRRHHVLAPPLWLTAAALASFVAVALALVRI |
| Ga0207709_102814101 | 3300025935 | Miscanthus Rhizosphere | MYEGHTISVLSGGRKRRRRHHMLGPPLWLATAAFASFVAAALV |
| Ga0207709_111751952 | 3300025935 | Miscanthus Rhizosphere | ARMYEGHTISVLSGGRKRRRRHHMLGPPLWLATAAFASFVAAALVLVRI |
| Ga0207670_103862401 | 3300025936 | Switchgrass Rhizosphere | VEDETVAMDNGSMISVLSGGRKRRRWHHTVAPPLWLTAAALASFVA |
| Ga0207669_106120211 | 3300025937 | Miscanthus Rhizosphere | VAMDNGSMISVLSGGRKRRRRHHMLALPLWLMAGAFASSVAVALALVRI |
| Ga0207661_110354221 | 3300025944 | Corn Rhizosphere | MDNGSMISVLSGGRKRRRRHHMLVLPLWLMAGAFAS |
| Ga0207661_118847451 | 3300025944 | Corn Rhizosphere | VEDEPVAMDNGSMISVLSGGRKRRRRHHTIAPPLWLTAAALASFVAVALALVRL |
| Ga0207651_110986363 | 3300025960 | Switchgrass Rhizosphere | MDNGSMISVLSGGRKRRRRHHMLVLPLWLMAGAFASSVAVALALVRI |
| Ga0207658_104478712 | 3300025986 | Switchgrass Rhizosphere | YEGHTISVLSGGRKRRRRHHMLGPPLWLATAAFASFVAAALVLVRI |
| Ga0207677_115022302 | 3300026023 | Miscanthus Rhizosphere | VLSGGRKRRRRHHVLAPPLWLTAAALASFVAVALALVRI |
| Ga0207702_114302412 | 3300026078 | Corn Rhizosphere | FVGYRSSAVEDETVAMDNGSMISVLSGGRKRRRWHHTVAPPLWLTAAALASFVAVALALVRL |
| Ga0207702_124971161 | 3300026078 | Corn Rhizosphere | MDNGSMISVLSGGRKRRRGHHMLALPLWLMAGAFASSVAVALALVRI |
| Ga0207641_103948862 | 3300026088 | Switchgrass Rhizosphere | VGYRSSAVEDETVAMDNGSMISVLSGGRKRRRWHHTVAPPLWLTAAALASFVAVALALVR |
| Ga0207648_103803053 | 3300026089 | Miscanthus Rhizosphere | LSGGRKRRRRHHVLAPPLWMTAAALASFVAVALALVRI |
| Ga0207676_114122731 | 3300026095 | Switchgrass Rhizosphere | SGGRKRRRRHQMLAPPLWLTAAALASFVAVALALVRI |
| Ga0207676_120293712 | 3300026095 | Switchgrass Rhizosphere | LSGGRKRRRRHHMLAPPLWLATAAFASFVAAALVLVRI |
| Ga0207676_121409941 | 3300026095 | Switchgrass Rhizosphere | VAMDNGSMISVLSGGRKRRRRHHMLALPLWLMAGAFASSVAVAL |
| Ga0207578_10095472 | 3300026933 | Soil | MDNGSLIPVLSGGRKRRRRHHVLAPPLWLTAAALASFV |
| Ga0208637_10414281 | 3300027401 | Soil | SGGRKRRRRHHILAPPLWLATAAFASFVAAALVLIRI |
| Ga0207428_103427611 | 3300027907 | Populus Rhizosphere | MYEGHMISVLSGGRKRRRRHHMLASPLWPAAVAFASFVA |
| Ga0207428_103675391 | 3300027907 | Populus Rhizosphere | VGYRSSAVEDEPVAMDNGSMISVLSGGRKRRRRHQMLAPPLWLTAAALASFVAIALALVR |
| Ga0247750_10130601 | 3300027992 | Soil | MDNGSLIPVLSGGRKRRRRHHVLAPPLWLTAAALASFVAVALALVR |
| Ga0247826_100278104 | 3300030336 | Soil | MHEGHMISVLSGGRKRRRRHYMLASPRWPAAVAFASFVAAALVLVRI |
| Ga0247826_102260091 | 3300030336 | Soil | VAEDEPAVMYEGHMISVLSGGRKRRRRHYVLAPQLWVAAAAFASFVAAALVLVRI |
| Ga0247826_105529682 | 3300030336 | Soil | MNEGQMISVLSGGRKRRHRTLAPPLWLAAAGFASFVVAALVLVRI |
| Ga0310907_102577921 | 3300031847 | Soil | MYEGHTISVLSGGRKRRRRHHMLGPPLWLATAAFASFVAAALVLVRI |
| Ga0308175_1016518341 | 3300031938 | Soil | MDNGSMISVLSGGRKRRRRHHMLALPLWLMAGAFESFVAVALALVRI |
| Ga0310906_101671661 | 3300032013 | Soil | VEDEPAAMYEGHTISVLSGGRKRRRRHHLLAPPLWLATAA |
| Ga0310890_103908182 | 3300032075 | Soil | TVAMDNGSMISVLSGGRKRRRWHHTVAPPLWLTAAALASFVAVALALVRL |
| Ga0310890_108788421 | 3300032075 | Soil | VEDEPVAMDNGSMISVLSGGRKRRRWHHTVAPPLWLTAAALASFVA |
| Ga0310890_113323481 | 3300032075 | Soil | VAEDEPAAMHEGHTISVLSGGRKRRRRHYMLAPPLWAAAAAFASFVAAALVLVRI |
| Ga0247829_100279743 | 3300033550 | Soil | MYEGHMISVLSGGRKRRRRHYVLAPQLWVAAAAFASFVAAALVLVRI |
| Ga0247829_108909751 | 3300033550 | Soil | MNEGQMISVLSGGRKRRHRTLAPPLWLAAAGFASFVAAALVLVRI |
| Ga0373959_0090904_2_142 | 3300034820 | Rhizosphere Soil | MEDETVAMDNGSMISVLSGGRKRRRWHHTVAPPLWLTAAALASFVAV |
| ⦗Top⦘ |