Metagenome Family F052663

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F052663
Family Type	Metagenome
Number of Sequences	142
Average Sequence Length	42 residues
Representative Sequence	VALVVVMLEEVKPVGIPQLAAVVNDVAVLYELDPAEQTV
Number of Associated Samples	80
Number of Associated Scaffolds	115

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	12.06 %
% of genes near scaffold ends (potentially truncated)	50.00 %
% of genes from short scaffolds (< 2000 bps)	98.59 %
Associated GOLD sequencing projects	75
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.19

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (71.831 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (9.155 % of family members)
Environment Ontology (ENVO)	Unclassified (57.746 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (72.535 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 10.45% β-sheet: 14.93% Coil/Unstructured: 74.63%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.19
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.19
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 115 Family Scaffolds
PF00754	F5_F8_type_C	1.74
PF00041	fn3	1.74
PF13229	Beta_helix	0.87

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.83 %
All Organisms	root	All Organisms	28.17 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.83 %
cellular organisms	root	All Organisms → cellular organisms	28.17 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.83 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	28.17 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.83 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	28.17 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.83 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	28.17 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.83 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	28.17 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.83 %
Saprospiria	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria	9.15 %
Flavobacteriia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia	2.82 %
Chitinophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia	2.11 %
unclassified Bacteroidetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes	2.11 %
Cytophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia	0.70 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.83 %
Saprospirales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales	9.15 %
Flavobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	2.82 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	2.11 %
Chitinophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales	2.11 %
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	0.70 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.83 %
Saprospiraceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae	9.15 %
Flavobacteriaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae	2.11 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	2.11 %
unclassified Chitinophagales	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → unclassified Chitinophagales	1.41 %
Chitinophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	0.70 %
Cyclobacteriaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cyclobacteriaceae	0.70 %
unclassified Flavobacteriales	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales	0.70 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.83 %
unclassified Saprospiraceae	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae	9.15 %
Flavobacterium	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium	2.11 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	2.11 %
Chitinophagales bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → unclassified Chitinophagales → Chitinophagales bacterium	1.41 %
Filimonas	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Filimonas	0.70 %
unclassified Cyclobacteriaceae	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cyclobacteriaceae → unclassified Cyclobacteriaceae	0.70 %
Flavobacteriales bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium	0.70 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.83 %
Saprospiraceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium	9.15 %
Flavobacterium lotistagni	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium lotistagni	2.11 %
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	2.11 %
Chitinophagales bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → unclassified Chitinophagales → Chitinophagales bacterium	1.41 %
Filimonas lacunae	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Filimonas → Filimonas lacunae	0.70 %
Cyclobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cyclobacteriaceae → unclassified Cyclobacteriaceae → Cyclobacteriaceae bacterium	0.70 %
Flavobacteriales bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium	0.70 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459017\|G14TP7Y01BRJGA	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium	608	Open in IMG/M
3300005290\|Ga0065712_10636032	Not Available	574	Open in IMG/M
3300005329\|Ga0070683_102444753	Not Available	500	Open in IMG/M
3300005334\|Ga0068869_100274543	Not Available	1354	Open in IMG/M
3300005364\|Ga0070673_101539370	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	628	Open in IMG/M
3300005365\|Ga0070688_100462396	Not Available	950	Open in IMG/M
3300005535\|Ga0070684_102103160	Not Available	533	Open in IMG/M
3300005547\|Ga0070693_100254289	Not Available	1166	Open in IMG/M
3300005577\|Ga0068857_102206159	Not Available	541	Open in IMG/M
3300005577\|Ga0068857_102206159	Not Available	541	Open in IMG/M
3300005616\|Ga0068852_101547560	Not Available	685	Open in IMG/M
3300005616\|Ga0068852_101547560	Not Available	685	Open in IMG/M
3300005616\|Ga0068852_102816535	Not Available	505	Open in IMG/M
3300005618\|Ga0068864_101316859	Not Available	723	Open in IMG/M
3300005618\|Ga0068864_101760390	Not Available	625	Open in IMG/M
3300005618\|Ga0068864_102322990	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium	543	Open in IMG/M
3300005718\|Ga0068866_11005632	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium	593	Open in IMG/M
3300005718\|Ga0068866_11397263	Not Available	511	Open in IMG/M
3300005719\|Ga0068861_101958593	Not Available	584	Open in IMG/M
3300005719\|Ga0068861_101958593	Not Available	584	Open in IMG/M
3300005841\|Ga0068863_102309845	Not Available	548	Open in IMG/M
3300005841\|Ga0068863_102309845	Not Available	548	Open in IMG/M
3300005843\|Ga0068860_102089524	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	588	Open in IMG/M
3300005844\|Ga0068862_100820410	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	909	Open in IMG/M
3300005844\|Ga0068862_100820410	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	909	Open in IMG/M
3300006046\|Ga0066652_101715822	Not Available	572	Open in IMG/M
3300006237\|Ga0097621_101385336	Not Available	665	Open in IMG/M
3300006237\|Ga0097621_101385336	Not Available	665	Open in IMG/M
3300006358\|Ga0068871_101089374	Not Available	747	Open in IMG/M
3300006755\|Ga0079222_11431344	Not Available	642	Open in IMG/M
3300006755\|Ga0079222_11431344	Not Available	642	Open in IMG/M
3300006755\|Ga0079222_12439887	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Filimonas → Filimonas lacunae	524	Open in IMG/M
3300006806\|Ga0079220_10896376	Not Available	687	Open in IMG/M
3300006954\|Ga0079219_10703232	Not Available	769	Open in IMG/M
3300006954\|Ga0079219_12157902	Not Available	535	Open in IMG/M
3300006954\|Ga0079219_12157902	Not Available	535	Open in IMG/M
3300009098\|Ga0105245_11199481	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium	807	Open in IMG/M
3300009101\|Ga0105247_10987651	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium lotistagni	656	Open in IMG/M
3300009101\|Ga0105247_11664684	Not Available	526	Open in IMG/M
3300009148\|Ga0105243_11786742	Not Available	645	Open in IMG/M
3300009148\|Ga0105243_12835644	Not Available	525	Open in IMG/M
3300009174\|Ga0105241_10554568	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium	1032	Open in IMG/M
3300009174\|Ga0105241_11969665	Not Available	574	Open in IMG/M
3300009174\|Ga0105241_11969665	Not Available	574	Open in IMG/M
3300009174\|Ga0105241_12514826	Not Available	516	Open in IMG/M
3300009174\|Ga0105241_12514826	Not Available	516	Open in IMG/M
3300009176\|Ga0105242_11894585	Not Available	636	Open in IMG/M
3300009176\|Ga0105242_12604267	Not Available	555	Open in IMG/M
3300009176\|Ga0105242_12604267	Not Available	555	Open in IMG/M
3300009176\|Ga0105242_12754803	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium	542	Open in IMG/M
3300009177\|Ga0105248_13373172	Not Available	507	Open in IMG/M
3300010362\|Ga0126377_12096394	Not Available	642	Open in IMG/M
3300010364\|Ga0134066_10446197	Not Available	505	Open in IMG/M
3300010375\|Ga0105239_13001359	Not Available	550	Open in IMG/M
3300010400\|Ga0134122_11095669	Not Available	788	Open in IMG/M
3300010400\|Ga0134122_11842716	Not Available	638	Open in IMG/M
3300010400\|Ga0134122_12720565	Not Available	547	Open in IMG/M
3300010401\|Ga0134121_12963582	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	522	Open in IMG/M
3300010403\|Ga0134123_11902177	Not Available	651	Open in IMG/M
3300010403\|Ga0134123_11902177	Not Available	651	Open in IMG/M
3300010403\|Ga0134123_12538390	Not Available	579	Open in IMG/M
3300011119\|Ga0105246_11313431	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium	671	Open in IMG/M
3300011119\|Ga0105246_11398086	Not Available	653	Open in IMG/M
3300012212\|Ga0150985_106122529	Not Available	566	Open in IMG/M
3300012212\|Ga0150985_111230183	Not Available	515	Open in IMG/M
3300012212\|Ga0150985_111236512	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	945	Open in IMG/M
3300012212\|Ga0150985_111236512	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	945	Open in IMG/M
3300012212\|Ga0150985_112604901	Not Available	624	Open in IMG/M
3300012212\|Ga0150985_112604901	Not Available	624	Open in IMG/M
3300012469\|Ga0150984_103666432	Not Available	1390	Open in IMG/M
3300012469\|Ga0150984_103666432	Not Available	1390	Open in IMG/M
3300012469\|Ga0150984_112260212	Not Available	762	Open in IMG/M
3300012517\|Ga0157354_1084420	Not Available	520	Open in IMG/M
3300012898\|Ga0157293_10128045	Not Available	691	Open in IMG/M
3300012898\|Ga0157293_10128045	Not Available	691	Open in IMG/M
3300012906\|Ga0157295_10378133	Not Available	521	Open in IMG/M
3300012906\|Ga0157295_10378133	Not Available	521	Open in IMG/M
3300012961\|Ga0164302_11843313	Not Available	512	Open in IMG/M
3300012985\|Ga0164308_10967460	Not Available	754	Open in IMG/M
3300012985\|Ga0164308_10967460	Not Available	754	Open in IMG/M
3300013100\|Ga0157373_10626055	Not Available	785	Open in IMG/M
3300013100\|Ga0157373_10626055	Not Available	785	Open in IMG/M
3300013296\|Ga0157374_10479715	Not Available	1247	Open in IMG/M
3300013296\|Ga0157374_11743223	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium	648	Open in IMG/M
3300013297\|Ga0157378_12251641	Not Available	596	Open in IMG/M
3300013306\|Ga0163162_11083060	Not Available	908	Open in IMG/M
3300013306\|Ga0163162_13113850	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → unclassified Chitinophagales → Chitinophagales bacterium	532	Open in IMG/M
3300013307\|Ga0157372_13082208	Not Available	532	Open in IMG/M
3300013308\|Ga0157375_10505296	Not Available	1373	Open in IMG/M
3300013308\|Ga0157375_12387769	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	631	Open in IMG/M
3300013308\|Ga0157375_12688086	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → unclassified Chitinophagales → Chitinophagales bacterium	595	Open in IMG/M
3300013308\|Ga0157375_12728243	Not Available	591	Open in IMG/M
3300014150\|Ga0134081_10212378	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	662	Open in IMG/M
3300014325\|Ga0163163_10010789	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	8245	Open in IMG/M
3300014968\|Ga0157379_10556359	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium	1068	Open in IMG/M
3300014969\|Ga0157376_12443805	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	562	Open in IMG/M
3300015372\|Ga0132256_102152332	Not Available	663	Open in IMG/M
3300015372\|Ga0132256_102152332	Not Available	663	Open in IMG/M
3300015372\|Ga0132256_102407268	Not Available	629	Open in IMG/M
3300015372\|Ga0132256_102407268	Not Available	629	Open in IMG/M
3300015372\|Ga0132256_103534383	Not Available	525	Open in IMG/M
3300015373\|Ga0132257_102865684	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium	628	Open in IMG/M
3300015373\|Ga0132257_104001256	Not Available	536	Open in IMG/M
3300015374\|Ga0132255_101974004	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	888	Open in IMG/M
3300017792\|Ga0163161_10452081	Not Available	1038	Open in IMG/M
3300017792\|Ga0163161_10740334	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium	821	Open in IMG/M
3300017947\|Ga0187785_10476874	Not Available	617	Open in IMG/M
3300025321\|Ga0207656_10500505	Not Available	617	Open in IMG/M
3300025908\|Ga0207643_10804474	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium lotistagni	609	Open in IMG/M
3300025916\|Ga0207663_10975039	Not Available	679	Open in IMG/M
3300025916\|Ga0207663_10975039	Not Available	679	Open in IMG/M
3300025918\|Ga0207662_11038866	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium	582	Open in IMG/M
3300025923\|Ga0207681_11411220	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	584	Open in IMG/M
3300025926\|Ga0207659_10840093	Not Available	789	Open in IMG/M
3300025926\|Ga0207659_11600506	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	556	Open in IMG/M
3300025931\|Ga0207644_11256430	Not Available	622	Open in IMG/M
3300025936\|Ga0207670_11128222	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	662	Open in IMG/M
3300025936\|Ga0207670_11904404	Not Available	506	Open in IMG/M
3300025938\|Ga0207704_11757849	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium lotistagni	533	Open in IMG/M
3300025945\|Ga0207679_11431630	Not Available	634	Open in IMG/M
3300025949\|Ga0207667_11490767	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	648	Open in IMG/M
3300025960\|Ga0207651_10497310	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium	1053	Open in IMG/M
3300025960\|Ga0207651_10497310	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium	1053	Open in IMG/M
3300025960\|Ga0207651_12046898	Not Available	514	Open in IMG/M
3300025981\|Ga0207640_11458493	Not Available	614	Open in IMG/M
3300025981\|Ga0207640_11458493	Not Available	614	Open in IMG/M
3300025986\|Ga0207658_12034469	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cyclobacteriaceae → unclassified Cyclobacteriaceae → Cyclobacteriaceae bacterium	522	Open in IMG/M
3300026035\|Ga0207703_12229641	Not Available	524	Open in IMG/M
3300026088\|Ga0207641_12055142	Not Available	572	Open in IMG/M
3300026142\|Ga0207698_12366360	Not Available	543	Open in IMG/M
3300027514\|Ga0208338_1016228	Not Available	544	Open in IMG/M
3300027775\|Ga0209177_10129709	Not Available	834	Open in IMG/M
3300027775\|Ga0209177_10300461	Not Available	611	Open in IMG/M
3300031740\|Ga0307468_100954537	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	749	Open in IMG/M
3300032205\|Ga0307472_102316492	Not Available	544	Open in IMG/M
3300033412\|Ga0310810_11188027	Not Available	620	Open in IMG/M
3300033412\|Ga0310810_11188027	Not Available	620	Open in IMG/M
3300033412\|Ga0310810_11233637	Not Available	600	Open in IMG/M
3300033412\|Ga0310810_11233637	Not Available	600	Open in IMG/M
3300033475\|Ga0310811_10865867	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	825	Open in IMG/M
3300033475\|Ga0310811_10865867	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	825	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	65.49%
Environmental	Environmental	33.80%
Engineered	Engineered	0.70%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	65.49%
Terrestrial	Environmental → Terrestrial	33.80%
Solid Waste	Engineered → Solid Waste	0.70%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	33.80%
Rhizosphere	Host-Associated → Plants → Rhizosphere	33.80%
Rhizoplane	Host-Associated → Plants → Rhizoplane	28.87%
Roots	Host-Associated → Plants → Roots	2.82%
Grass	Engineered → Solid Waste → Grass	0.70%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	26.06%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	21.13%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	21.83%
Soil	Host-Associated → Plants → Rhizosphere → Soil	12.68%
Loam	Environmental → Terrestrial → Soil → Loam	7.04%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	7.04%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	2.82%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.70%
Composting	Engineered → Solid Waste → Grass → Composting	0.70%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	21.13%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	21.83%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	17.61%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	12.68%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	7.04%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	6.34%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	6.34%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	2.82%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	1.41%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	0.70%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.70%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.70%
Unclassified	Engineered → Solid Waste → Grass → Composting → Unclassified	0.70%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	9.15%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	8.45%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	7.04%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	6.34%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	6.34%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	5.63%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	5.63%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	4.93%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	4.23%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	4.23%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	3.52%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	3.52%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	2.82%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.82%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.11%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	2.11%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	2.11%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	2.11%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	2.11%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	2.11%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.41%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.41%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.41%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.41%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.70%
Unplanted Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil	0.70%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	0.70%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.70%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	0.70%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.70%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.70%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.70%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.70%
Switchgrass, Maize And Mischanthus Litter	Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter	0.70%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459017	Litter degradation ZMR4	Engineered	Open in IMG/M
3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1	Host-Associated	Open in IMG/M
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Environmental	Open in IMG/M
3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Environmental	Open in IMG/M
3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Environmental	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010364	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012517	Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610	Environmental	Open in IMG/M
3300012898	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1	Environmental	Open in IMG/M
3300012906	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300012985	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG	Environmental	Open in IMG/M
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014150	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300017947	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG	Environmental	Open in IMG/M
3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027514	Forest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN91 (SPAdes)	Environmental	Open in IMG/M
3300027775	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300033475	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
4ZMR_04696380	2170459017	Switchgrass, Maize And Mischanthus Litter	VVILEEVKPVGVAQLGVVVNDAGALYAPDPAEHTV
Ga0065712_106360322	3300005290	Miscanthus Rhizosphere	LAVTLVVVMLEELKPVGIPQLAAVVNEAAVLYELDPAEQTV*
Ga0070683_1024447532	3300005329	Corn Rhizosphere	VVQLTVALVVVILEDVKPVGIPQLAAVVNDVAVLYELVPAEQTVCTWNW*
Ga0068869_1002745434	3300005334	Miscanthus Rhizosphere	MPEELRPVGIPQVAAVVKDAAVLYELVPAEQTVCTWNWYAVP
Ga0070673_1015393703	3300005364	Switchgrass Rhizosphere	MPEELKPVGMPQVAAVVNDVAVLYELDPAEQTVCTWNWYAVP
Ga0070688_1004623964	3300005365	Switchgrass Rhizosphere	VEVIPEDVKPVGIPQVAAVVNDVAVLYELDPAEQTVCTWNWYA
Ga0070684_1021031601	3300005535	Corn Rhizosphere	PGTEGQLTVALVVVMLEKVKPAGMPQLMAVVNDVGSLYELDPAEQIV*
Ga0070693_1002542892	3300005547	Corn, Switchgrass And Miscanthus Rhizosphere	VVQLTVALVVAMLEEDNPVGVPQLDEVANDVEALYELVPAEQTV*
Ga0068857_1022061591	3300005577	Corn Rhizosphere	MFQLTVAVVLVILKELKPVGVPQLAVVVNDAAVLYELDPNEQTV*
Ga0068857_1022061592	3300005577	Corn Rhizosphere	GTTLQLTVALVLVMLEELKPVGESQLAVVENDVALLYELDPAEQTV*
Ga0068852_1015475602	3300005616	Corn Rhizosphere	MLEEVKPVGIPQLPAVVNDVALLYELDPDPPEQTV*
Ga0068852_1015475603	3300005616	Corn Rhizosphere	VMLEEVKPVGIPQLAVVVNDEAVLYELDPAEQTV*
Ga0068852_1028165352	3300005616	Corn Rhizosphere	MVAVVVVMLEEVKPVGIPQLATVVNDAELLKELDPAEQTV*
Ga0068864_1013168592	3300005618	Switchgrass Rhizosphere	MPEELRPVGIPQVAAVVKDAAVLYELVPAEQTVCTW
Ga0068864_1017603901	3300005618	Switchgrass Rhizosphere	ALVVAMLEEVKPVGTSQLVAVVNDMGALYELDPAEQTV*
Ga0068864_1023229902	3300005618	Switchgrass Rhizosphere	VAPVVVMLEEVKPVGIPQLAAVVNDVIVLYELDPAEQTV*
Ga0068866_110056322	3300005718	Miscanthus Rhizosphere	VAPVVVMLEEVKPVGIPQLAAVVNDVVVLYELDPDPPEQTV*
Ga0068866_113972632	3300005718	Miscanthus Rhizosphere	MAVQLTVALVLVMLEEVRPVGVPQLAVVVSDAGSLYELDPYEQTV*
Ga0068861_1019585932	3300005719	Switchgrass Rhizosphere	MLEEVKPVGIPQLAAVVNDVVVLYELDPDPPEQTV*
Ga0068861_1019585933	3300005719	Switchgrass Rhizosphere	VVVMLEEVKPVGIPQLPAVVNDVAPLYELDPDPPEQTV*
Ga0068863_1023098451	3300005841	Switchgrass Rhizosphere	TSVQLTVALVVAMFEEVKPVGISQLVVVVNDVAVLYELDPAEQTV*
Ga0068863_1023098452	3300005841	Switchgrass Rhizosphere	MFEEVKPVGISQLVVVVNDVAVLYELDPDPPEQTV*
Ga0068860_1020895243	3300005843	Switchgrass Rhizosphere	LVVVMLEEVKPVGIAQLPAVVNDVALLYELDPDPPEQTV*
Ga0068862_1008204102	3300005844	Switchgrass Rhizosphere	MASQLTVAPLVVMLEELKPVGIPQLAIVVNDEAVLYELDPAEQTV*
Ga0068862_1008204103	3300005844	Switchgrass Rhizosphere	PVVVMLEELKPVGMPQIAVVVNDVELLYELDPAEQTV*
Ga0066652_1017158222	3300006046	Soil	MLEEVKPVGIPQLPAVVNDVAVLYELDPDPPEQIV*
Ga0097621_1013853361	3300006237	Miscanthus Rhizosphere	GTSVQLTVALVVAMFEEVKPVGISQLVVVVNDVAVLYELDPDPPEQTV*
Ga0097621_1013853362	3300006237	Miscanthus Rhizosphere	MLEEVKPVGIPQLPAVVNAVAPLYELDPDPPEQTV*
Ga0068871_1010893741	3300006358	Miscanthus Rhizosphere	MPEELKPVGMPQVAAVVNDVAVLYELDPAEQTVCTWNW
Ga0079222_114313441	3300006755	Agricultural Soil	MAFGMSSQLTVPHDASTIEEVKFVGMSQLVKVVNDVELLYELDPAEQTV*
Ga0079222_114313442	3300006755	Agricultural Soil	MPSQLTVAFALSMFEEVKFVGMSQLVKVVNDVELLNELDPAEQTV*
Ga0079222_124398871	3300006755	Agricultural Soil	LLQLTVALVVAMLEELKPVGVPQLVVVVNEEELLYELDPDEQTV*
Ga0079220_108963761	3300006806	Agricultural Soil	MASQLKVALVLAMFEEVKPVGIPQLAIVLNDAELLYALDPAEQTV*IWNWYA
Ga0079219_107032321	3300006954	Agricultural Soil	MASQVNVAFALSMFEVAKPVGTPQLATVLNDVALLYELDPAEQTV*TWNWY
Ga0079219_121579021	3300006954	Agricultural Soil	ETAVQLTVAVVVVMLEEPKPVGIPQVAAVVNEVVLLYELDPAEQTVCTWN*
Ga0079219_121579022	3300006954	Agricultural Soil	MPEELKPVGIPQAAAVVNEVELLYELDPAEQTVCTWN*
Ga0105245_111994811	3300009098	Miscanthus Rhizosphere	VALVVVMLEEVKPVGIPQLAAVVNDVVVLYELDPDPPEQTV*
Ga0105247_109876512	3300009101	Switchgrass Rhizosphere	APVTAVQLTVALVVVMFEEVKPVGIPQLAAVVNDDAVLYELDPDPPEQTV*
Ga0105247_116646841	3300009101	Switchgrass Rhizosphere	VAVVVVMLEEVKPVGIPQLATVVNDAELLKELDPAEQTV*
Ga0105243_117867422	3300009148	Miscanthus Rhizosphere	VALVVAMLEEVKPVGIPQLPAVVNDVALLYELDPDPPEQTV*
Ga0105243_128356441	3300009148	Miscanthus Rhizosphere	MIALVVVMPEDAKPVGMPQLATVVNDIELLKELEPAEHIV*
Ga0105241_105545681	3300009174	Corn Rhizosphere	TSVQLTVALVVAMFEEVKPVGISQLVVVVNDVAVLYELDPDPPEQTV*
Ga0105241_119696651	3300009174	Corn Rhizosphere	MLEEDKPVGITQLVAVVNDVAELYALDPDPPEQTV*
Ga0105241_119696652	3300009174	Corn Rhizosphere	MLEEDKPVGIAQLVAVVNDVAELYALDPDPPEQTV*
Ga0105241_125148261	3300009174	Corn Rhizosphere	APETAVQLTVALVVVMLEEDKPVGMPQVAAVVNDVAVLYELDPDPAEQTV*
Ga0105241_125148262	3300009174	Corn Rhizosphere	MAVQLTVALVVVMLEEDKPVGMPQLAAVVNDVAVLYELDPDPAEQTV*
Ga0105242_118945851	3300009176	Miscanthus Rhizosphere	AVQLIVALVVVILEEVKPIGTPQLAAVVKDVAVLYELDPAEQTV*
Ga0105242_126042671	3300009176	Miscanthus Rhizosphere	TAPGTAVQLTVALVVVTFEEVKPVGIAQLPAVVNDVALLYELDPDPPEQTV*
Ga0105242_126042672	3300009176	Miscanthus Rhizosphere	MPEEVKPAGIAQLAAVVNDVAVLYELDPDPPEQTV*
Ga0105242_127548031	3300009176	Miscanthus Rhizosphere	TAPVTAVQLTVALVVVMPEEVKPVGIPQLATVVNDVGSLYELEPAAQTV*
Ga0105248_133731721	3300009177	Switchgrass Rhizosphere	VVVVMLEELKPVGMPQLATVVNDAELLKELDPAEQTV*
Ga0126377_120963943	3300010362	Tropical Forest Soil	MAPETPVQLTVALVEAMPDEVKPDTVPQLVVVVNDVALLYELDPDEQTV*
Ga0134066_104461972	3300010364	Grasslands Soil	MAPVTAVQLTVAVVLVMPEELKPAGISQGATVVNDVGSLYALDPAAQIV*
Ga0105239_130013591	3300010375	Corn Rhizosphere	PVTAVQLAVTLVVVMLEELKPVGIPQLAAVVNEAAVLYELDPAEQTV*
Ga0134122_110956691	3300010400	Terrestrial Soil	PGTAVQLTVAPVVVMLEEVKPVGIPQLAAVVNDVVVLYELDPDPPEQTV*
Ga0134122_116599141	3300010400	Terrestrial Soil	IAVQLTVALVLLTFEEFRSVGVPQLIVVVNDASLLYELVPAEQTA*
Ga0134122_118427161	3300010400	Terrestrial Soil	VALAVAMLEEVKPVGIPQLPAVVNDVALLYELDPDPPEQTV*
Ga0134122_127205652	3300010400	Terrestrial Soil	MFEKLKPVGIPQVAAVVNDDAVLYELDPDPPEQTV*
Ga0134121_129635821	3300010401	Terrestrial Soil	MFEEVKPVGISQLVVVVNDAAVLYELDPDPPEQTV*
Ga0134123_119021771	3300010403	Terrestrial Soil	MVEEVKPGGTPQVAAVVNDDAVLYELDPDPPEQTVWTWN
Ga0134123_119021772	3300010403	Terrestrial Soil	MFEKLKPVGIPQAAAVVNDDAVLYELDPDPPEQTV*
Ga0134123_125383901	3300010403	Terrestrial Soil	VVQVTVALAVVMLEEVKSVGVPQLAVVANDVAVLYEPVPKEQTV*
Ga0105246_113134313	3300011119	Miscanthus Rhizosphere	FEEVKPVGISQLVVVVNDVAVLYELDPDPPEQTV*
Ga0105246_113980861	3300011119	Miscanthus Rhizosphere	MIALVVVMPEDVNPVGMPQLATVVNDVELVKELEPAEQTV*
Ga0150985_1061225292	3300012212	Avena Fatua Rhizosphere	MASQLTVALVVVVLEEAKPVGASQLARVANDVELLYELDPAGQTV*
Ga0150985_1112301832	3300012212	Avena Fatua Rhizosphere	MLEEVKPAGIAQLAAVVNDVASLYELNPDPAEQTV*
Ga0150985_1112365121	3300012212	Avena Fatua Rhizosphere	MPEEVKLAGVAQLAAVVNEVAVLYELDPDPPEQTV*
Ga0150985_1112365123	3300012212	Avena Fatua Rhizosphere	MAVQLTVALVVVMLEEVKPVGVPQLAVVVNDAAVLYEPAPAEQTT*
Ga0150985_1126049011	3300012212	Avena Fatua Rhizosphere	LTVALVVVMFEEVKPIGVPQVAAVVNDVAVLYELDPDPPEQIV*
Ga0150985_1126049012	3300012212	Avena Fatua Rhizosphere	MLEEAKPVGVPQLAAVVNDVAVLYELDPDPPEQTV*
Ga0150984_1036664321	3300012469	Avena Fatua Rhizosphere	PGTAVQLTVALVVVMLEEVKLAGIPQLAAVENDVAVLYELDPDPPEQTV*
Ga0150984_1036664322	3300012469	Avena Fatua Rhizosphere	MPEEVKPVGIPQLAAVVNDVAVLYELDPDPPEQTV*
Ga0150984_1122602122	3300012469	Avena Fatua Rhizosphere	MVPGMAVQLTVALVVVMLEEVKPAGIPQLAAVVNEVAALYELDPDPPEQTV*
Ga0157354_10844201	3300012517	Unplanted Soil	FVMLEEVKPVGVPQLAVVVNDVAVLYELDPAEQTV*
Ga0157293_101280451	3300012898	Soil	VVILEEDKPVGIPQLVAVVNDVAVLYELDPDPAEQTV*
Ga0157293_101280452	3300012898	Soil	VVQLSIALVVVMLEDDKPVGVPQPVAVVNDVAEPYELDPDPPEQTV*
Ga0157295_103781331	3300012906	Soil	MLEEDKPVGIPQVAAVVNDVAVLYELEPDPPEQTV*
Ga0157295_103781332	3300012906	Soil	VVQLTIALVVVMLEDDKPVGVPQPVAVVNDVAEPYELDPDPPEQTV*
Ga0164302_118433132	3300012961	Soil	VILEELKPVGIPQLAVVVNDVALLYELDPNEQTL*
Ga0164308_109674601	3300012985	Soil	VALVVVMLEEVKPVGIPQLAAVVNDVAVLYELDPAEQTV*
Ga0164308_109674603	3300012985	Soil	TAVQLTVALVAVMLEEFKSVGVPQLTIVVNDVEVLYELDPAEQIV*
Ga0157373_106260551	3300013100	Corn Rhizosphere	MLEEIKPVGIPQVAAVVNDVAVLYELDPDPPEQTV*
Ga0157373_106260553	3300013100	Corn Rhizosphere	MFEEAKPVGIPQVAAVVNDVAVLYELDPDPPKQTV*
Ga0157374_104797153	3300013296	Miscanthus Rhizosphere	MAPVTAVQLTVALVVVMLEEVKPVGIPQLATVVNEVGSLYELEPAAQTV*
Ga0157374_117432233	3300013296	Miscanthus Rhizosphere	QLTVALVVVMLEEVKPVGIAQLPAVVNAVALLYELDPDPPEQTV*
Ga0157378_122516411	3300013297	Miscanthus Rhizosphere	MLEEVKPVGISQLVVVVNDAAVLYELDPDPPEQTV*
Ga0163162_110830601	3300013306	Switchgrass Rhizosphere	MTGVQVTVAVVLVMFNEDKPVGIPQVAVVANDVEGLNELEPTEQTV*
Ga0163162_131138501	3300013306	Switchgrass Rhizosphere	QLTVALVVVMLEEVKPVGIAQLPAVVNDVALLYELDPDPPEQTV*
Ga0157372_130822082	3300013307	Corn Rhizosphere	MFEEAKPVGIPQVAAVVNDVAVLYELDPDPPEQTV*
Ga0157375_105052962	3300013308	Miscanthus Rhizosphere	VEVIPEDVKPVGIPQVAAVVNDVAVLYELDPAEQTVCT*
Ga0157375_123877691	3300013308	Miscanthus Rhizosphere	IAMPEEVKPVGIPQLAIVVNDVGSLYELEPAAQTV*
Ga0157375_126880861	3300013308	Miscanthus Rhizosphere	VQLTVALVVAMLEEVKPVGISQLVVVVNDVAVLYELDPDPPEQTV*
Ga0157375_127282432	3300013308	Miscanthus Rhizosphere	MLEEVKPVGIAQLPAVVNDVELLYELDPDPPEQIV*
Ga0134081_102123781	3300014150	Grasslands Soil	MPEEVKPAGIAQLAAVVNDAAVLYELDPDPPEQTV*
Ga0163163_100107897	3300014325	Switchgrass Rhizosphere	AVALVLVMLEELKLVGTPQLAAVVNDAAVLYELDPAEQTV*
Ga0157379_105563592	3300014968	Switchgrass Rhizosphere	MLEEVKPVGISQLVVVVNDVAVLYELDPDPPEQTV*
Ga0157376_124438052	3300014969	Miscanthus Rhizosphere	MLEEVKPVGIAQLPAVVNDVALLYELDPDPPEQTV*
Ga0132256_1021523321	3300015372	Arabidopsis Rhizosphere	LVLVLFEELKPVGIPQLTVVVNDVGSLYELDPAEQIV*
Ga0132256_1021523323	3300015372	Arabidopsis Rhizosphere	VLVLFEELKPVGIPQLTVVVNDVGSLYELDPAEQIV*
Ga0132256_1024072681	3300015372	Arabidopsis Rhizosphere	TAVQLTVALVVVMLEEDKPVGVPQVAEVVNDVAVLYELDPDPPEQTV*
Ga0132256_1024072682	3300015372	Arabidopsis Rhizosphere	MLEEDKPVGIPQLAAAVNDVAVLYELDPDPPEQTV*
Ga0132256_1035343831	3300015372	Arabidopsis Rhizosphere	VTAPETAVQLTVALVVVMLEEVKPVGIPQLAVVVNDAAVLYELDPAEQTV*
Ga0132257_1028656841	3300015373	Arabidopsis Rhizosphere	MAFGTAVQLTVAPEVVTLEEPKPVGIPQLAEVVNDVAVLYELEPDPPEQTV*
Ga0132257_1040012562	3300015373	Arabidopsis Rhizosphere	MTVQLTVALVLVMFEEVKPAGVPQLAGVVNDVAVLYELDPAEQTVCTWNW*
Ga0132255_1019740042	3300015374	Arabidopsis Rhizosphere	TVAPEVVTLEEPKPVGIPQLAEVVNDVAVLYELEPDPPEQTV*
Ga0163161_104520811	3300017792	Switchgrass Rhizosphere	MPEELKAVGMPQVAAVVNDVAVLYELDPAEQTVCTWN
Ga0163161_107403341	3300017792	Switchgrass Rhizosphere	MLEEVKPVGIPQLAAVVNDVVVLYELDPDPPEQTV
Ga0187785_104768742	3300017947	Tropical Peatland	MLEEPKPEGTPQGAVVVNDEVVLNELDPAEQTVCTWN
Ga0207656_105005052	3300025321	Corn Rhizosphere	VALVVAMLEEVKPVGIPQLPAVVNDVALLYELDPDPPEQTV
Ga0207643_108044741	3300025908	Miscanthus Rhizosphere	PVQLTVALVVVMFEEVKPVGISQLVVVVNDVAVLYELDPAEQTV
Ga0207663_109750392	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	MFEEVKPVGISQLVVVVNDAAVLYELDPDPPEQTV
Ga0207663_109750393	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	MASQLTVALEVVMLEEFKPVGIAQLAAVVNEVAELYELDPDPPEQTVXTWN
Ga0207662_110388662	3300025918	Switchgrass Rhizosphere	MIALVVVMPEDAKPVGMPQLATVVNDIELLKELEPAEHIV
Ga0207681_114112202	3300025923	Switchgrass Rhizosphere	MAVQLTVALVVVMLEEVKPVGIPQLATVVNDVGSLYALDPAAQI
Ga0207659_108400931	3300025926	Miscanthus Rhizosphere	MASQVTVALALSTFEEVKPVGASQLAIVVNDAVVLYELVPAEQTVCTWY
Ga0207659_116005061	3300025926	Miscanthus Rhizosphere	VVQLTVALVVVMLEEVKPVGIAQLPAVVNDVALLYELDPDPPEQTV
Ga0207644_112564301	3300025931	Switchgrass Rhizosphere	QLAVALELVMLEEVKPVGVPQLTIVANDVDVLYELDPAEQTV
Ga0207670_111282221	3300025936	Switchgrass Rhizosphere	AVQLAVALVVVMPEEVKPVGVAQLAVVVNDAGALYAPDPAEQTV
Ga0207670_119044041	3300025936	Switchgrass Rhizosphere	VTVAVVLVMLEEVKPVGTSQLVVVVNDMGALYELDPAEQTV
Ga0207704_117578491	3300025938	Miscanthus Rhizosphere	APGTAVQLTVAPVVVMLEEVKPVGIPQLAAVVNDVVVLYELDPDPPEQTV
Ga0207679_114316301	3300025945	Corn Rhizosphere	MAVQLSVALVVVILEEDKPVGIPQLPAVVNDVAVLYELNPDPAEQTVXT
Ga0207667_114907673	3300025949	Corn Rhizosphere	MPEELKPVGMPQVAAVVNDVAVLYELDPAEQTVCTW
Ga0207651_104973101	3300025960	Switchgrass Rhizosphere	RLYVTTPVTAVQLTVALVAVIPDEVKPVGVPQVAAVVNDVELLNELEPAEQTV
Ga0207651_104973102	3300025960	Switchgrass Rhizosphere	MIALVVVMPEDVNPVGMPQLATVVNDVELLKELEPAEHIV
Ga0207651_120468982	3300025960	Switchgrass Rhizosphere	VLVMFNEDKPVGIPQVAVVANDVEGLNELEPTEQTV
Ga0207640_114584931	3300025981	Corn Rhizosphere	MFEEAKPVGIPQVAAVVNDVAVLYELDPDPPEQTV
Ga0207640_114584932	3300025981	Corn Rhizosphere	TAVQLTVALVVVMLEEDKPVGIPQVAAVVNDVAVLYELDPDPPEQTV
Ga0207658_120344691	3300025986	Switchgrass Rhizosphere	MVAVVVVMLEEVKPVGIPQLATVVNDAELLKELDPA
Ga0207703_122296411	3300026035	Switchgrass Rhizosphere	MPEELKAVGMPQVAAVVNDVAVLYELDPADQTVCT
Ga0207641_120551422	3300026088	Switchgrass Rhizosphere	LKVALVVAMLEEVKPVGTSQLVVVVNDMGALYELDPAEQTV
Ga0207698_123663601	3300026142	Corn Rhizosphere	TSVQFKVALVVAMLEEVKPVGTSQLLVVVNDAAVLYELDPAEQTV
Ga0208338_10162281	3300027514	Soil	MASQLTVALALVMLEEVKPVGASQLARVANDVELLYELDPAEQTV
Ga0209177_101297091	3300027775	Agricultural Soil	MAFGMSSQLTVALALSVFEEVKFVGISQLVKVVNDVELLYELDPA
Ga0209177_103004611	3300027775	Agricultural Soil	MASQVNVAFALSMFEVAKPVGTPQLATVLNDVALLYELD
Ga0307468_1009545372	3300031740	Hardwood Forest Soil	SLNLAAPDTAVQLTVALEVVMHEEVKPVGIPQGAAVVNDVAVLYELDPDEQTV
Ga0307472_1023164921	3300032205	Hardwood Forest Soil	IVLLTLEEFKSVGVPQLNVVVNDEASLYELDPTEQTA
Ga0310810_111880271	3300033412	Soil	MASQLTVALVLVMLEEVKPVGIPQLARVVNDVALLYELDPNEQTV
Ga0310810_111880272	3300033412	Soil	MASQLTVALVVLMLEEVKPVGVPQLAVVVNDDAVLYELDPAEQTV
Ga0310810_112336371	3300033412	Soil	TAFDMASQLTVALVVVMPEEVKPVGIPQLARVVNDVEVLYELDPAEQTV
Ga0310810_112336372	3300033412	Soil	MASQLTVALVLAMLEDVKPVGIPQLTRVVNDEAVLYALDPAEQTV
Ga0310811_108658672	3300033475	Soil	MASQLTVALVVVMLEEVKPVGIPQLARVVNDEAVLYELDPNEQTV
Ga0310811_108658673	3300033475	Soil	MASQLTVALVLVMLEEVKPVGTPQLAVVVNDDAVLYELDPAEQTV

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F052663

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences