| Basic Information | |
|---|---|
| Family ID | F052560 |
| Family Type | Metagenome |
| Number of Sequences | 142 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MVKDTIGMLFVTAFVITFFTNAITDWNFWYLMARFGGQ |
| Number of Associated Samples | 82 |
| Number of Associated Scaffolds | 142 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 72.54 % |
| % of genes near scaffold ends (potentially truncated) | 35.92 % |
| % of genes from short scaffolds (< 2000 bps) | 78.17 % |
| Associated GOLD sequencing projects | 65 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.704 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (50.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (71.831 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (93.662 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.52% β-sheet: 0.00% Coil/Unstructured: 48.48% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 142 Family Scaffolds |
|---|---|---|
| PF07508 | Recombinase | 16.20 |
| PF01541 | GIY-YIG | 11.97 |
| PF13730 | HTH_36 | 7.04 |
| PF09588 | YqaJ | 2.82 |
| PF13481 | AAA_25 | 2.11 |
| PF01726 | LexA_DNA_bind | 2.11 |
| PF00959 | Phage_lysozyme | 1.41 |
| PF07453 | NUMOD1 | 1.41 |
| PF11351 | GTA_holin_3TM | 1.41 |
| PF08279 | HTH_11 | 0.70 |
| PF00239 | Resolvase | 0.70 |
| PF01507 | PAPS_reduct | 0.70 |
| PF05065 | Phage_capsid | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 142 Family Scaffolds |
|---|---|---|---|
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 16.90 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.70 |
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.70 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 50.70 % |
| All Organisms | root | All Organisms | 49.30 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 50.00% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 11.27% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 8.45% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 7.04% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 5.63% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 4.23% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 2.11% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.11% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 2.11% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.41% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.70% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.70% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.70% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.70% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.70% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.70% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.70% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300004457 | Marine viral communities from Newfoundland, Canada MC-1 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018410 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018413 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300020176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020601 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011506CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022922 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025668 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300032373 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2 | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_100329825 | 3300000116 | Marine | MVKDTIGMLFVTALVITFGTNAITDDYNIWALMVRFGG* |
| DelMOWin2010_1000042238 | 3300000117 | Marine | MVKDTIGMLVLTALVITFGTNAITQDYNIWALMVRFGG* |
| DelMOWin2010_100280152 | 3300000117 | Marine | MVKDTICMLFVTAFAITFFTNFITTEYNVWALMVKLGGAG* |
| BBAY92_100098995 | 3300000947 | Macroalgal Surface | MVKDTIGMLFVTALVITFGTNAITDDYNIWSLMVRFGG* |
| Ga0055584_1011018453 | 3300004097 | Pelagic Marine | MIKDTIGMLFVTAFVITFFTNAITDWNFWYLMARFGGAN* |
| Ga0066224_11978823 | 3300004457 | Marine | VGESDMIKDTIGMLFVTAFVITFFTNAITDWNFWYLMARFGGAN* |
| Ga0075474_101423394 | 3300006025 | Aqueous | MVKDFIGMLFVTAFAITFFTNAVTDEWNVWALMARFGGAN* |
| Ga0075462_100075955 | 3300006027 | Aqueous | MLKDTIGMLFVTAFVITFFTNAITDWNFWYLMARFGGAG* |
| Ga0075462_100178321 | 3300006027 | Aqueous | TIGMLFVTAFVITFFTNAITTEYNVWALMVKFGS* |
| Ga0075462_100235312 | 3300006027 | Aqueous | MIKDTICMLFVTAFVITFFTNAITDWNFWYLMARFGGAN* |
| Ga0075462_100283103 | 3300006027 | Aqueous | MVKDTIGMLVLTALVITFGTNAITSDYNIWALMVRFGG* |
| Ga0075462_100678124 | 3300006027 | Aqueous | MVKDTIGMLFVTALVITFGTNAITQDYNIWALMVRFGG* |
| Ga0075462_100939463 | 3300006027 | Aqueous | MVKDAIGMLFVTAFAITFGTNLITTEYNVWALMVKLGGAG* |
| Ga0075462_101395742 | 3300006027 | Aqueous | MLKDTIGMLFVTAFVITFFTNAVTDWNFWYLMARFGGAN* |
| Ga0075461_101776833 | 3300006637 | Aqueous | MLKDTIGMLFVTAFVITFFTNAVTDWNFWYLMARF |
| Ga0098038_10553563 | 3300006735 | Marine | MVKDTVGMLFVTAFVITFFTNAITTEYNVWALMVKFGS* |
| Ga0098048_10188463 | 3300006752 | Marine | MVKDTIGMLFVTAFVITFFTNAVTDWNFWYLMARFGGAG* |
| Ga0098048_10617412 | 3300006752 | Marine | MVKDTIGMLFVTAFVITFFTNAITDWNFWYLMARFGGQ* |
| Ga0098055_11114591 | 3300006793 | Marine | MVKDTIGMLFVTAFVITFFTNAITDWNFWYLMARFG |
| Ga0098055_11428022 | 3300006793 | Marine | GSKLMVKDTIGMLFVTAFVITFFTNAITDWNFWYLMARFGGQ* |
| Ga0070749_100446563 | 3300006802 | Aqueous | MVKDTIGMLFVTAFVITFFTNAVTDWNFWYLMARFGGAN* |
| Ga0070749_101030912 | 3300006802 | Aqueous | MVKDTIGMLFVTAFVITFFTNAITDWNFWYLMARFGGAN* |
| Ga0070749_101430651 | 3300006802 | Aqueous | MLKDTIGMLFVTAFVITFFTNAVTDWNFWYLMARFGG |
| Ga0070749_101694214 | 3300006802 | Aqueous | MVKDTIGMLFVTALVITFGTNAITSDYNIWALMVRFGG* |
| Ga0070749_102213072 | 3300006802 | Aqueous | MLKDTIGMLFVTAFVITFFTNAITDWNFWYLMARFGGAN* |
| Ga0070749_105905313 | 3300006802 | Aqueous | MLKDTIGMLLVTAFVITFFTNAITDWNFWYLMARFGGAN* |
| Ga0070749_106908172 | 3300006802 | Aqueous | MVKDAIGMLVLTALVIALGTNFVTETHNIWALMSRYG* |
| Ga0070749_107194873 | 3300006802 | Aqueous | MLKDTIGMLFVTAFVITFFTNAVTDWNFWYLMARFGGAG* |
| Ga0070754_100820602 | 3300006810 | Aqueous | MVKDAIGMLFVTAFAITFFTNFITTEYNVWALMVKLGGAG* |
| Ga0070754_101512143 | 3300006810 | Aqueous | MVKDIIGMLVLTALVITFGTNAITSDYNIWALMVRFGG* |
| Ga0070754_104390902 | 3300006810 | Aqueous | MVKDTIGMLVLTALVIALGTNFVTETHNIWALMSRYG* |
| Ga0075476_101022164 | 3300006867 | Aqueous | MVKDAIGMLVLTALVITFGTNAITNDYNIWALMVRFGG* |
| Ga0070750_101616841 | 3300006916 | Aqueous | KLMVKDTIGMLFVTAFVITFFTNAITDWNFWYLMARFGGQ* |
| Ga0070750_101924543 | 3300006916 | Aqueous | MVKDTIGMLFVTAFVITFFTNAVTDWNFWYLMARFGGQ* |
| Ga0070746_100877743 | 3300006919 | Aqueous | MVRDTIGMLFVTALVITFGTNAITDDYNIWGLMVRFGG* |
| Ga0070746_101309703 | 3300006919 | Aqueous | MVKDIIGMLFVTALVITFGTNAITSDYNIFALMARFGG* |
| Ga0098045_10288182 | 3300006922 | Marine | MVRDTIGMLFVTALVITFGTNAITDDYNIWALMVRFGG* |
| Ga0098050_10043861 | 3300006925 | Marine | DTIGMLFVTAFVITFFTNAITDWNFWYLMARFGGQ* |
| Ga0075460_100556291 | 3300007234 | Aqueous | LMLKDTIGMLFVTAFVITFFTNAITDWNFWYLMARFGGAG* |
| Ga0075460_100557581 | 3300007234 | Aqueous | LMVKDAIGMLFVTAFAITFFTNLITTEWNMWSLMVKLGGAG* |
| Ga0075460_102216992 | 3300007234 | Aqueous | MVKDIIGMLFVTALVITFGTNAITSDYNIWALMARFGG* |
| Ga0075463_100253085 | 3300007236 | Aqueous | MVKDAIGMLFVTALVVTFGTNAITQDYNIWALMVRFGG* |
| Ga0075463_100399711 | 3300007236 | Aqueous | RGKLMLKDTIGMLFVTAFVITFFTNAVTDWNFWYLMARFGGAG* |
| Ga0075463_100700801 | 3300007236 | Aqueous | KDTIGMLFVTAFVITFFTNAVTDWNFWYLMARFGGAG* |
| Ga0070745_13566692 | 3300007344 | Aqueous | MVKDAIGMLFVTAFAITFFTNLITTEYNVWSLMVKLGGAG* |
| Ga0070753_11167841 | 3300007346 | Aqueous | YWGSDMVKDTIGMLVLTALVIALGTNFVTETHNIWALMSRYG* |
| Ga0070753_11234953 | 3300007346 | Aqueous | WGSDMVKDTIGMLVLTALVITFGTNAITSDYNIWALMVRFGG* |
| Ga0099849_10600624 | 3300007539 | Aqueous | VKDAIGMLFVTAFAITFFTNLITTEYNVWALMVKLGGQ* |
| Ga0099849_13213193 | 3300007539 | Aqueous | MVKDTICMLFVTAFAITFFTNLITTEWNVWSLMVKLG |
| Ga0099847_10082784 | 3300007540 | Aqueous | MVRDTIGMLFVTALVITFGTNAITSDYNIWALMVRFGG* |
| Ga0099847_11580813 | 3300007540 | Aqueous | MLKDAIGMLFVTAFAITFFTNFITTEYNVWALMVKLGGQ* |
| Ga0070751_11686483 | 3300007640 | Aqueous | TIGMLVLTALVITFGTNAITSDYNIWALMVRFGG* |
| Ga0099850_12367143 | 3300007960 | Aqueous | MLKDTIGMLFVTAFAITFFTNAITDWNFWYLMARFGGQ* |
| Ga0099850_13490113 | 3300007960 | Aqueous | KDTIGMLVLTALVIALGTNFISETHNIWALMSRYG* |
| Ga0102963_12229112 | 3300009001 | Pond Water | MVKDTIGMLFVTVFVITFFTNAITDWNFWYLMARFGGQ* |
| Ga0115546_11824722 | 3300009435 | Pelagic Marine | MIKDTIGMLFVTAFVITFFTNAITDWNFWYLMARFGGQ* |
| Ga0129348_11037961 | 3300010296 | Freshwater To Marine Saline Gradient | DTIGMLVLTALVIALGTNFVTETHNIWALMSRYG* |
| Ga0129345_10244442 | 3300010297 | Freshwater To Marine Saline Gradient | MVKDAIGMLVLTALVIALGTNFVTETHNIWALMSRYGG* |
| Ga0129351_11303511 | 3300010300 | Freshwater To Marine Saline Gradient | GNLMVKDAIGMLFVTAFAITFGTNLITTEWNVWALMVKLGGAG* |
| Ga0129324_100778613 | 3300010368 | Freshwater To Marine Saline Gradient | MVKDIIGMLFVTALVITFGTNAITDDYNIWALMVRFGG* |
| Ga0129324_101103451 | 3300010368 | Freshwater To Marine Saline Gradient | GLDMVKDAIGMLFVTALVITFGTNAITQDYNIWALMVRFGG* |
| Ga0129324_101784634 | 3300010368 | Freshwater To Marine Saline Gradient | MVKDAIGMLFVTALVITFGTNAITQDYNIWALMVRFG |
| Ga0129324_104038672 | 3300010368 | Freshwater To Marine Saline Gradient | MVKDTIGMLLVTAFVITFFTNAITDWNFWYLMARFGGQ* |
| Ga0129327_102754002 | 3300013010 | Freshwater To Marine Saline Gradient | RLAGRGKLMLKDTIGMLFVTAFVITFFTNAVTDWNFWYLMARFGGAG* |
| Ga0129327_103853851 | 3300013010 | Freshwater To Marine Saline Gradient | MVKDTIGMLFVTAFVITFFTNAITDWNFWYLMARFGGAG* |
| Ga0180120_101328441 | 3300017697 | Freshwater To Marine Saline Gradient | DTIGMLFVTAFVITFFTNAITDWNFWYLMARFGGAG |
| Ga0181390_10123984 | 3300017719 | Seawater | MVRDTIGMLFVTALVITFGTNAITQDYNIWALMVRFGG |
| Ga0181402_10072808 | 3300017743 | Seawater | MIKDTIGMLFVTAFVITFLTNAVTDWNFWYLMARFGGQ |
| Ga0181402_10641022 | 3300017743 | Seawater | MVKDTIGMLFVTALVITFGTNFITSDYNIWALMVRFGG |
| Ga0181565_104153531 | 3300017818 | Salt Marsh | MVKDTIGMLVLTALVIALGTNFVTETHNIWALMSRYG |
| Ga0181552_101308432 | 3300017824 | Salt Marsh | MVKDAIGMLVLTALVIALGTNFVTETHNIWALMSRYG |
| Ga0181552_104287393 | 3300017824 | Salt Marsh | MVKDTIGMLVLTALVIALGTNFVTETHNIWALMSR |
| Ga0181561_102411702 | 3300018410 | Salt Marsh | MVKDAIGMLILTALVIALGTNFVTETHNIWALMSRYG |
| Ga0181561_102943952 | 3300018410 | Salt Marsh | KDAIGMLFVTAFAITFFTNFITTEWNVWALMVKLGGAG |
| Ga0181560_101255352 | 3300018413 | Salt Marsh | MVKDIIGMLFVTAFAITFFTNLITTEYNVWALMVKLGGAG |
| Ga0181560_101976043 | 3300018413 | Salt Marsh | MVKDAIGMLILTALVIALGTNFVSETHNIWALMSRYG |
| Ga0181553_101093591 | 3300018416 | Salt Marsh | MVKDTIGMLVLTALVITFGTNAITSDYNIWALMVRFGG |
| Ga0181553_101883362 | 3300018416 | Salt Marsh | MVKDAIGMLVLTALVITLGTNFVTETHNIWALMSRYG |
| Ga0181558_101531011 | 3300018417 | Salt Marsh | KDAIGMLVLTVFVIVFCTNAVTNDYNLYALMVRFGG |
| Ga0181563_104072363 | 3300018420 | Salt Marsh | VKDLIGMLFITTLVIVFGTNAVTTQWNMWALMVRFLGGQ |
| Ga0194024_10119113 | 3300019765 | Freshwater | MVKDTIGMLFVTALVITFGTNAITDDYNIWALMVRFGG |
| Ga0181556_10212529 | 3300020176 | Salt Marsh | MVKDAIGMLFVTAFAITFFTNLITTEWNVWSLMVKLGGAG |
| Ga0181556_10664525 | 3300020176 | Salt Marsh | MVKDAIGMLFVTAFAITFFTNFITTEWNVWALMVKLGGAG |
| Ga0181556_11513725 | 3300020176 | Salt Marsh | MVKDAIGMLFVTAFAITFFTNLITTKWNVWSLMYKSS |
| Ga0181557_12004054 | 3300020601 | Salt Marsh | CWGSDMVKDAIGMLVLTALVIALGTNFVTETHNIWALMSRYG |
| Ga0213867_10508624 | 3300021335 | Seawater | MVRDTIGMLFVTALVITFGTNAITDDYNIWALMVRFGG |
| Ga0213863_1000244211 | 3300021371 | Seawater | MIKDTIGMLFVTAFVITFFTNAITDWNFWYLMARFGGAN |
| Ga0213863_100068365 | 3300021371 | Seawater | MVRDAIGMLFVTALVITFGTNAITSDYNIWALMVRFGG |
| Ga0213863_100103417 | 3300021371 | Seawater | MIKDTIGMLFVTAFVITFFTNAVTDWNFWYLMARFGGAG |
| Ga0213865_100594546 | 3300021373 | Seawater | MVRDTIGMLFVTALVITFGTNFITSDYNIWALMVRFGG |
| Ga0213866_103465333 | 3300021425 | Seawater | MRKREIIKDAIGMLFIGMLAIVFGTNAVTEDYNIWALMVHFGS |
| Ga0222717_1000888112 | 3300021957 | Estuarine Water | MVKDTIGMLFVTAFVITFFTNAITDWNFWYLMARFGGQ |
| Ga0222718_1001256611 | 3300021958 | Estuarine Water | MIKDTICMLLLVAFVITFFTNAITDWNFWYLMARFGGAN |
| Ga0222718_100231656 | 3300021958 | Estuarine Water | MLKDTIGMLFVTAFVITFFTNAITDWNFWYLMARFGGQ |
| Ga0222718_101083193 | 3300021958 | Estuarine Water | MLKDTIGMLFVTAFVITFFTNAITDWNFWYLMARFGGAN |
| Ga0222718_101431621 | 3300021958 | Estuarine Water | MVKDAIGMLFVTALVITFGTNAITDEYNIWSLMVRFGG |
| Ga0222716_101426092 | 3300021959 | Estuarine Water | MVKDTICMLFVTAFAITFFTNFITTEYNVWALMVKLGS |
| Ga0222716_102876362 | 3300021959 | Estuarine Water | MVKDTIGMLFVTAFVITFFTNAITDWNFWYLMARFGGAN |
| Ga0222714_105248382 | 3300021961 | Estuarine Water | LAFLGRNLMLKDTIGMLFVTAFVITFFTNAITDWNFWYLMARFGGAN |
| Ga0212030_10143904 | 3300022053 | Aqueous | MVRDTIGMLFVTALVITFGTNAITSDYNIWALMVRFGG |
| Ga0212030_10442732 | 3300022053 | Aqueous | RLAERGKLMLKDTIGMLLVTAFVITFFTNAITDWNFWYLMARFGGAN |
| Ga0212024_10274383 | 3300022065 | Aqueous | WLLKELKQRGKLMVKDTIGMLLVTAFVITFFTNAITDWNFWYLMARFGGAN |
| Ga0212021_10442722 | 3300022068 | Aqueous | MLKDTIGMLFVTAFVITFFTNAITDWNFWYLMARFGGAG |
| Ga0212021_11341762 | 3300022068 | Aqueous | MVKDTIGMLFVTAFVITFFTNAVTDWNFWYLMARFGGQ |
| Ga0212031_10183031 | 3300022176 | Aqueous | LMVKDAIGMLFVTAFAITFFTNLITTEWNVWSLMVKLGGAG |
| Ga0196891_10107673 | 3300022183 | Aqueous | LMLKDTIGMLFVTAFVITFFTNAITDWNFWYLMARFGGAG |
| Ga0196899_10907903 | 3300022187 | Aqueous | GSNMVRDTIGMLFVTALVITFGTNAITQDYNIWALMVRFGG |
| Ga0255779_11433421 | 3300022922 | Salt Marsh | MVKDAIGMLFVTAFAITFFTNLITTKWNVWSLMYKSSQ |
| Ga0208791_10237591 | 3300025083 | Marine | WGLDMVRDTIGMLFVTALVITFGTNAITDDYNIWALMVRFGG |
| Ga0208298_10148134 | 3300025084 | Marine | MVRDTIGMLFVTALVITFGTNAITDDYNIWSLMVRFGG |
| Ga0208298_10275221 | 3300025084 | Marine | DMVKDTIGMLFVTAMVITFGTNAITDDYNIWSLMVRFGG |
| Ga0208434_10129413 | 3300025098 | Marine | MVKDTIGMLFVTAFVITFFTNAVTDWNFWYLMARFGGAG |
| Ga0208666_10794402 | 3300025102 | Marine | MVKDTVGMLFVTAFVITFFTNAITTEYNVWALMVKFGS |
| Ga0208303_10001177 | 3300025543 | Aqueous | MVKDTIGMLFVTAFVITFFTNAVTDWNFWYLMARFGGAN |
| Ga0208303_10394714 | 3300025543 | Aqueous | MLKDTIGMLFVTAFVITFFTNAVTDWNFWYLMARFGGAG |
| Ga0208149_10699152 | 3300025610 | Aqueous | MLKDTIGMLFVTAFVITFFTNAVTDWNFWYLMARFGGAN |
| Ga0208004_10165921 | 3300025630 | Aqueous | TKRGKLMLKDTIGMLFVTAFVITFFTNAITDWNFWYLMARFGGAG |
| Ga0208004_10192903 | 3300025630 | Aqueous | MVKDAIGMLVLTALVITFGTNAITNDYNIWALMVRFGG |
| Ga0208004_10768882 | 3300025630 | Aqueous | MVKDAIGMLFVTALVITFGTNAITTDYNIWALMVRFGG |
| Ga0209251_11370172 | 3300025668 | Marine | MVKDAIGMLFVTALVITFGTNAITQDYNIWALMVRFGG |
| Ga0208898_100042947 | 3300025671 | Aqueous | MVKDAIGMLFVTAFAITFFTNFITTEYNVWALMVKLGGAG |
| Ga0208019_11255473 | 3300025687 | Aqueous | MLKDTIGMLLVTAFVITFFTNAITDWNFWYLMARFGGAN |
| Ga0208899_10006251 | 3300025759 | Aqueous | TCLSNALTKRGKLMLKDTIGMLFVTAFVITFFTNAVTDWNFWYLMARFGGAG |
| Ga0208899_10054256 | 3300025759 | Aqueous | MVKDTIGMLFVTALVITFGTNAITQDYNIWALMVRFGG |
| Ga0208899_10173807 | 3300025759 | Aqueous | MVKDAIGMLFVTALVVTFGTNAITQDYNIWALMVRFGG |
| Ga0208899_12473643 | 3300025759 | Aqueous | GKLMVKDTIGMLFVTAFVITFFTNAVTDWNFWYLMARFGGQ |
| Ga0208767_10246035 | 3300025769 | Aqueous | MVKDTIGMLLVTAFVITFFTNAITDWNFWYLMARFGGAN |
| Ga0208543_10978952 | 3300025810 | Aqueous | ARLAERGKLMLKDTIGMLFVTAFVITFFTNAVTDWNFWYLMARFGGAN |
| Ga0208645_10516652 | 3300025853 | Aqueous | MVKDIIGMLVLTALVITFGTNAITSDYNIWALMVRFGG |
| Ga0208645_10996374 | 3300025853 | Aqueous | MLKDTIGMLFVTAFVITFFTNAITDWNFWYLMARFG |
| Ga0208645_11114201 | 3300025853 | Aqueous | DMVRDAIGMLFVTALVITFGTNAITQDYNIWALMVRFGG |
| Ga0209534_101457452 | 3300025880 | Pelagic Marine | MLKDTIGMLFVTTFVITFFTNAITDWNFWYLMARFGGAN |
| Ga0208644_10869964 | 3300025889 | Aqueous | MVKDAIGMLFVTAFAITFFTNLITTEYNVWALMVKLGGAG |
| Ga0208644_10884271 | 3300025889 | Aqueous | KLMVKDTIGMLLVTAFVITFFTNAITDWNFWYLMARFGGAN |
| Ga0208644_10993503 | 3300025889 | Aqueous | KLMVKDAIGMLFVTAFAITFFTNLITTEWNVWSLMVKLGGAG |
| Ga0208644_11932061 | 3300025889 | Aqueous | GNLMVKDAIGMLFVTAFAITFFTNLITTEWNVWSLMVKLGGAG |
| Ga0307488_105315223 | 3300031519 | Sackhole Brine | MVKDTIGMLFVTAMVITFGTNAITQDYNIWALMVRFGG |
| Ga0307378_104539203 | 3300031566 | Soil | DTIGMLFVTAFVITFFTNAITDWNFWYLMARFGGQ |
| Ga0316202_100452884 | 3300032277 | Microbial Mat | MVKDTIGMLVLTAMVITFGTNFITSDYNIWALMVRFGG |
| Ga0316202_102031022 | 3300032277 | Microbial Mat | MIKDTIGMLFVTAFVITFFTNAITDWNFWYLMARFGGAG |
| Ga0316204_103833454 | 3300032373 | Microbial Mat | MVKDTIGMLVLTAMVITFGTNAITQDYNIWALMVRFGG |
| Ga0348336_088091_2_112 | 3300034375 | Aqueous | MVKDIIGMLVLTALVITFGTNAITSDYNIWAVMVRFS |
| ⦗Top⦘ |